F287960

General Info

Members Datasets Scaffolds Average Seq Length
187 143 374 329

Family's Representative Sequence

Representative Sequence 3300035091|Ga0373951_0000065|Ga0373951_0000065_40203_41363
Length 386
Sequence VYRKDTARVPRTLGGTGDEELTLPGRKREYDEDDVRIRPGRSSRPRTRTRPKHEDAIDALVITVDRGRYGCVREDDERLDDVITSMRARELGRKSVVVGDRVSLVGDTTGEPGALARIVRISERTSVLRRTADDXXTTPEGRLERVVVANADQLVIVSALADPPPRTGFIDRCLVAAYDAGIEPLLCFTKADLAGPEAVLDYYAELHLPYVLVRPDSDLAELREKLAGQISVMVGHSGVGKSTLVNRLVPAALRAVGVVSAIGKGRHTSTSAVALRLPRVGKKKGDPGWIIDTPGIRSFGLAHVSAESLLHGFPDLVEGTIECPPNCGHTANDVGCALDAWVAAGKADPRRLASYRRLLASRAGDGDPRDQAAESGPEEPQPHGRV

Samples

Sample ID Description Type Environment
1 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
40 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
41 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
44 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
45 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
46 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
47 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
48 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
49 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
52 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
53 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
54 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
55 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
56 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
57 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
58 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
64 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
65 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
70 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
78 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
79 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
84 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
85 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
86 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
87 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
97 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
98 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
102 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
103 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
104 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
105 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
106 2582580736 Prauserella sp. Am3 Isolate Unclassified
107 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
108 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
109 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
110 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
111 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
112 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
113 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
114 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
115 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
116 2858868258 Micromonospora sp. MH33 Isolate Unclassified
117 2858882152 Micromonospora noduli MED15 Isolate Nodule
118 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
119 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
120 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
121 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
122 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
123 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
124 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
125 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
126 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
127 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
128 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
129 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
130 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
131 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
132 2902582711 Micromonospora sp. AP08 Isolate Unclassified
133 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
134 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
135 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
136 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
137 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
138 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
139 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
140 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
141 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
142 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
143 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.07
Metatranscriptomes 1.6
Isolates 20.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.67
Nodule 2.67
Rhizoplane 2.14
Rhizosphere 68.98
Stem 0
Stem Tuber 0.53
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373951_0000065 3300035091 Bacteria 41796
2 JGI24737J22298_10020321 3300001990 Bacteria 2120
3 JGI25406J46586_10009113 3300003203 Bacteria 4455
4 Ga0068868_100040331 3300005338 Bacteria 3634
5 Ga0070660_100319148 3300005339 Bacteria 1276
6 Ga0070714_100041052 3300005435 Bacteria 3903
7 Ga0070713_100080155 3300005436 Bacteria 2783
8 Ga0070663_100000114 3300005455 Bacteria 37448
9 Ga0068855_100029972 3300005563 Bacteria 6507
10 Ga0068855_100102053 3300005563 Bacteria 3302
11 Ga0068856_100125237 3300005614 Bacteria 2573
12 Ga0068856_100226887 3300005614 Bacteria 1883
13 Ga0068859_100041474 3300005617 Bacteria 4623
14 Ga0068864_100393709 3300005618 Bacteria 1315
15 Ga0068863_100070765 3300005841 Bacteria 3300
16 Ga0081455_10000111 3300005937 Bacteria 92306
17 Ga0081455_10004489 3300005937 Bacteria 15615
18 Ga0081540_1016528 3300005983 Bacteria 4611
19 Ga0081539_10001605 3300005985 Bacteria 37235
20 Ga0081539_10002008 3300005985 Bacteria 30810
21 Ga0081539_10003456 3300005985 Bacteria 19365
22 Ga0081539_10035388 3300005985 Bacteria 3003
23 Ga0070717_10315923 3300006028 Bacteria 1391
24 Ga0075428_100001715 3300006844 Bacteria 23414
25 Ga0075430_100312386 3300006846 Bacteria 1300
26 Ga0075431_100093432 3300006847 Bacteria 3104
27 Ga0097620_100041475 3300006931 Bacteria 4623
28 Ga0114129_10000010 3300009147 Bacteria 147651
29 Ga0105248_10298130 3300009177 Bacteria 1815
30 Ga0105239_10129429 3300010375 Bacteria 2807
31 Ga0157370_10260794 3300013104 Bacteria 1602
32 Ga0157369_10000069 3300013105 Bacteria 143271
33 Ga0157369_10351130 3300013105 Bacteria 1532
34 Ga0157374_10264522 3300013296 Unclassified 1695
35 Ga0206354_11675179 3300020081 Bacteria 1984
36 Ga0206353_10702552 3300020082 Bacteria 2501
37 Ga0206353_11999094 3300020082 Bacteria 2582
38 Ga0207647_10127563 3300025904 Bacteria 1496
39 Ga0207705_10027612 3300025909 Bacteria 4048
40 Ga0207695_10064923 3300025913 Bacteria 3755
41 Ga0207700_10183052 3300025928 Bacteria 1756
42 Ga0207690_10125197 3300025932 Bacteria 1873
43 Ga0207667_10013104 3300025949 Bacteria 9515
44 Ga0207667_10037373 3300025949 Bacteria 5191
45 Ga0207667_10337949 3300025949 Bacteria 1537
46 Ga0207677_10024240 3300026023 Bacteria 3766
47 Ga0207678_10000289 3300026067 Bacteria 45690
48 Ga0207702_10019292 3300026078 Bacteria 5642
49 Ga0307515_10000065 3300028794 Bacteria 244497
50 Ga0307515_10016973 3300028794 Bacteria 13302
51 Ga0307515_10065068 3300028794 Bacteria 5084
52 Ga0307515_10151931 3300028794 Bacteria 2415
53 Ga0307512_10002479 3300030522 Bacteria 23236
54 Ga0307512_10004108 3300030522 Bacteria 16182
55 Ga0307513_10009309 3300031456 Bacteria 12439
56 Ga0307513_10011772 3300031456 Bacteria 10845
57 Ga0307513_10120756 3300031456 Bacteria 2589
58 Ga0307408_100208289 3300031548 Bacteria 1587
59 Ga0307508_10000654 3300031616 Bacteria 41574
60 Ga0307516_10007505 3300031730 Bacteria 12543
61 Ga0307405_10021502 3300031731 Bacteria 3629
62 Ga0307405_10038301 3300031731 Bacteria 2889
63 Ga0307413_10029766 3300031824 Bacteria 3060
64 Ga0307413_10127521 3300031824 Bacteria 1735
65 Ga0307518_10000287 3300031838 Bacteria 38350
66 Ga0307410_10113131 3300031852 Bacteria 1967
67 Ga0326468_10000101 3300031889 Bacteria 7564
68 Ga0307406_10006159 3300031901 Bacteria 6599
69 Ga0307406_10028463 3300031901 Bacteria 3376
70 Ga0307407_10007318 3300031903 Bacteria 4991
71 Ga0307409_100060478 3300031995 Bacteria 2954
72 Ga0307415_100104894 3300032126 Bacteria 2083
73 Ga0307510_10105039 3300033180 Bacteria 2595
74 Ga0373941_0016300 3300035115 Bacteria 2017
75 Ga0373942_0001275 3300035207 Bacteria 6593
76 Ga0373935_0049789 3300035692 Bacteria 2657
77 Ga0395899_0005856 3300037312 Bacteria 9541
78 Ga0395900_0003016 3300037418 Bacteria 18322
79 Ga0395898_0004251 3300037466 Bacteria 15705
80 Ga0395905_0004182 3300037471 Bacteria 15095
81 Ga0395901_0007354 3300038443 Bacteria 11115
82 Ga0451853_0092352 3300041512 Bacteria 2753
83 Ga0466969_0069903 3300044656 Bacteria 1690
84 Ga0466969_0185638 3300044656 Bacteria 951
85 Ga0466972_0002795 3300044658 Bacteria 8649
86 Ga0466972_0009032 3300044658 Bacteria 5003
87 Ga0466972_0092864 3300044658 Bacteria 1431
88 Ga0466966_0018189 3300044684 Bacteria 4637
89 Ga0466966_0067837 3300044684 Bacteria 2240
90 Ga0466966_0320205 3300044684 Bacteria 932
91 Ga0466961_0011496 3300044693 Bacteria 5661
92 Ga0466961_0035132 3300044693 Bacteria 3218
93 Ga0466961_0063529 3300044693 Bacteria 2346
94 Ga0466961_0076437 3300044693 Bacteria 2122
95 Ga0466963_0006208 3300044694 Bacteria 7057
96 Ga0466963_0008290 3300044694 Bacteria 6226
97 Ga0466963_0110542 3300044694 Bacteria 1886
98 Ga0466971_0020149 3300044719 Bacteria 2965
99 Ga0466971_0033546 3300044719 Bacteria 2300
100 Ga0466968_0003579 3300044735 Bacteria 5747
101 Ga0466970_0036206 3300044765 Bacteria 2614
102 Ga0466970_0038846 3300044765 Bacteria 2526
103 Ga0466970_0050403 3300044765 Bacteria 2220
104 Ga0466970_0064044 3300044765 Bacteria 1971
105 Ga0466957_0012950 3300044842 Bacteria 4832
106 Ga0466957_0126303 3300044842 Bacteria 1634
107 Ga0466960_0010463 3300044901 Bacteria 3854
108 Ga0466959_0127203 3300045049 Bacteria 1808
109 Ga0466959_0175731 3300045049 Bacteria 1500
110 Ga0466959_0229340 3300045049 Bacteria 1286
111 Ga0466959_0296150 3300045049 Bacteria 1108
112 Ga0466958_0012664 3300045836 Bacteria 4781
113 Ga0466958_0033782 3300045836 Bacteria 3048
114 Ga0466967_0033420 3300045976 Bacteria 4354
115 Ga0466967_0046818 3300045976 Bacteria 3768
116 Ga0466967_0356784 3300045976 Bacteria 1416
117 Ga0495594_0001892 3300046499 Bacteria 10894
118 Ga0495606_0000949 3300046507 Bacteria 42671
119 Ga0495668_0000275 3300046616 Bacteria 72330
120 Ga0495625_0000978 3300046660 Bacteria 37965
121 Ga0495626_0000147 3300048091 Bacteria 87994
122 Ga0496105_0262047 3300048908 Bacteria 1398
123 Ga0496112_0012257 3300048915 Bacteria 7873
124 Ga0496112_0027524 3300048915 Bacteria 5481
125 Ga0496113_0415259 3300048916 Bacteria 1081
126 Ga0496118_0135065 3300048921 Bacteria 1576
127 Ga0496119_0002555 3300048922 Bacteria 19813
128 Ga0496120_0012934 3300048923 Bacteria 5649
129 Ga0501031_0016142 3300049568 Bacteria 4850
130 Ga0501032_0002368 3300049569 Bacteria 14732
131 Ga0501032_0050762 3300049569 Bacteria 2797
132 Ga0501034_0021216 3300049571 Bacteria 6625
133 Ga0501038_0004168 3300049574 Bacteria 13446
134 Ga0501039_0172791 3300049575 Bacteria 1699
135 Ga0501043_0012782 3300049579 Bacteria 6562
136 Ga0501047_0010662 3300049581 Bacteria 8684
137 Ga0501048_0003153 3300049582 Bacteria 12573
138 Ga0501070_0024610 3300049586 Bacteria 5048
139 Ga0501074_0077547 3300049590 Bacteria 2385
140 Ga0501035_0012121 3300049822 Bacteria 7973
141 Ga0501044_0009889 3300049823 Bacteria 10365
142 Ga0501044_0218464 3300049823 Bacteria 1857
143 nmdc:mga06r32_88180_c1 3300050510 Bacteria 3028
144 Ga0500644_0031295 3300053088 Bacteria 1691
145 Ga0500644_0055812 3300053088 Bacteria 1373
146 Ga0500641_0005971 3300053096 Bacteria 4312
147 Ga0500594_0021398 3300053118 Bacteria 1621
148 Ga0500568_0003287 3300053139 Bacteria 9120
149 Ga0466962_0002502 3300061719 Bacteria 8718
150 2583152606 2582580736 Bacteria 5325865
151 2586058387 2585427649 Bacteria 9053857
152 2623591572 2622736626 Bacteria 7181580
153 2676481217 2675903059 Bacteria 8644972
154 2772645764 2772190715 Bacteria 6959372
155 2809592768 2808606522 Bacteria 9488490
156 2855670558 2855670206 Bacteria 7120389
157 2855683521 2855676851 Bacteria 7063653
158 2857288904 2857288857 Bacteria 7189066
159 2858854268 2858848962 Bacteria 6963058
160 2858871950 2858868258 Bacteria 7683772
161 2858887249 2858882152 Bacteria 7230291
162 2858892091 2858888857 Bacteria 7060307
163 2858897783 2858895516 Bacteria 7378898
164 2866613483 2866612099 Bacteria 7543886
165 2867305451 2867302475 Bacteria 7087181
166 2867316707 2867312974 Bacteria 7058875
167 2867321900 2867319477 Bacteria 7069771
168 2869052340 2869048445 Bacteria 6875584
169 2869068482 2869061728 Bacteria 7112407
170 2869070542 2869068681 Bacteria 7205615
171 2880495517 2880489317 Bacteria 7096270
172 2880496839 2880495981 Bacteria 7340502
173 2887484824 2887478801 Bacteria 8972725
174 2899367302 2899359706 Bacteria 10940472
175 2899373123 2899370129 Bacteria 6781179
176 2902583840 2902582711 Bacteria 6187705
177 2915775653 2915768154 Bacteria 8424322
178 2929225461 2929219909 Bacteria 6984360
179 2929231564 2929226422 Bacteria 7248583
180 2996223962 2996221748 Bacteria 6799777
181 8001782245 8001781756 Bacteria 9586736
182 8003315814 8003314358 Bacteria 10575343
183 8003835909 8003830390 Bacteria 6541657
184 8003874991 8003870546 Bacteria 7396674
185 8054704475 8054704163 Bacteria 7247792
186 8054734421 8054727385 Bacteria 7558670
187 8054740184 8054734606 Bacteria 6947278
188 Ga0373951_0000065
189 JGI24737J22298_10020321
190 JGI25406J46586_10009113
191 Ga0068868_100040331
192 Ga0070660_100319148
193 Ga0070714_100041052
194 Ga0070713_100080155
195 Ga0070663_100000114
196 Ga0068855_100029972
197 Ga0068855_100102053
198 Ga0068856_100125237
199 Ga0068856_100226887
200 Ga0068859_100041474
201 Ga0068864_100393709
202 Ga0068863_100070765
203 Ga0081455_10000111
204 Ga0081455_10004489
205 Ga0081540_1016528
206 Ga0081539_10001605
207 Ga0081539_10002008
208 Ga0081539_10003456
209 Ga0081539_10035388
210 Ga0070717_10315923
211 Ga0075428_100001715
212 Ga0075430_100312386
213 Ga0075431_100093432
214 Ga0097620_100041475
215 Ga0114129_10000010
216 Ga0105248_10298130
217 Ga0105239_10129429
218 Ga0157370_10260794
219 Ga0157369_10000069
220 Ga0157369_10351130
221 Ga0157374_10264522
222 Ga0206354_11675179
223 Ga0206353_10702552
224 Ga0206353_11999094
225 Ga0207647_10127563
226 Ga0207705_10027612
227 Ga0207695_10064923
228 Ga0207700_10183052
229 Ga0207690_10125197
230 Ga0207667_10013104
231 Ga0207667_10037373
232 Ga0207667_10337949
233 Ga0207677_10024240
234 Ga0207678_10000289
235 Ga0207702_10019292
236 Ga0307515_10000065
237 Ga0307515_10016973
238 Ga0307515_10065068
239 Ga0307515_10151931
240 Ga0307512_10002479
241 Ga0307512_10004108
242 Ga0307513_10009309
243 Ga0307513_10011772
244 Ga0307513_10120756
245 Ga0307408_100208289
246 Ga0307508_10000654
247 Ga0307516_10007505
248 Ga0307405_10021502
249 Ga0307405_10038301
250 Ga0307413_10029766
251 Ga0307413_10127521
252 Ga0307518_10000287
253 Ga0307410_10113131
254 Ga0326468_10000101
255 Ga0307406_10006159
256 Ga0307406_10028463
257 Ga0307407_10007318
258 Ga0307409_100060478
259 Ga0307415_100104894
260 Ga0307510_10105039
261 Ga0373941_0016300
262 Ga0373942_0001275
263 Ga0373935_0049789
264 Ga0395899_0005856
265 Ga0395900_0003016
266 Ga0395898_0004251
267 Ga0395905_0004182
268 Ga0395901_0007354
269 Ga0451853_0092352
270 Ga0466969_0069903
271 Ga0466969_0185638
272 Ga0466972_0002795
273 Ga0466972_0009032
274 Ga0466972_0092864
275 Ga0466966_0018189
276 Ga0466966_0067837
277 Ga0466966_0320205
278 Ga0466961_0011496
279 Ga0466961_0035132
280 Ga0466961_0063529
281 Ga0466961_0076437
282 Ga0466963_0006208
283 Ga0466963_0008290
284 Ga0466963_0110542
285 Ga0466971_0020149
286 Ga0466971_0033546
287 Ga0466968_0003579
288 Ga0466970_0036206
289 Ga0466970_0038846
290 Ga0466970_0050403
291 Ga0466970_0064044
292 Ga0466957_0012950
293 Ga0466957_0126303
294 Ga0466960_0010463
295 Ga0466959_0127203
296 Ga0466959_0175731
297 Ga0466959_0229340
298 Ga0466959_0296150
299 Ga0466958_0012664
300 Ga0466958_0033782
301 Ga0466967_0033420
302 Ga0466967_0046818
303 Ga0466967_0356784
304 Ga0495594_0001892
305 Ga0495606_0000949
306 Ga0495668_0000275
307 Ga0495625_0000978
308 Ga0495626_0000147
309 Ga0496105_0262047
310 Ga0496112_0012257
311 Ga0496112_0027524
312 Ga0496113_0415259
313 Ga0496118_0135065
314 Ga0496119_0002555
315 Ga0496120_0012934
316 Ga0501031_0016142
317 Ga0501032_0002368
318 Ga0501032_0050762
319 Ga0501034_0021216
320 Ga0501038_0004168
321 Ga0501039_0172791
322 Ga0501043_0012782
323 Ga0501047_0010662
324 Ga0501048_0003153
325 Ga0501070_0024610
326 Ga0501074_0077547
327 Ga0501035_0012121
328 Ga0501044_0009889
329 Ga0501044_0218464
330 nmdc:mga06r32_88180_c1
331 Ga0500644_0031295
332 Ga0500644_0055812
333 Ga0500641_0005971
334 Ga0500594_0021398
335 Ga0500568_0003287
336 Ga0466962_0002502
337 2583152606
338 2586058387
339 2623591572
340 2676481217
341 2772645764
342 2809592768
343 2855670558
344 2855683521
345 2857288904
346 2858854268
347 2858871950
348 2858887249
349 2858892091
350 2858897783
351 2866613483
352 2867305451
353 2867316707
354 2867321900
355 2869052340
356 2869068482
357 2869070542
358 2880495517
359 2880496839
360 2887484824
361 2899367302
362 2899373123
363 2902583840
364 2915775653
365 2929225461
366 2929231564
367 2996223962
368 8001782245
369 8003315814
370 8003835909
371 8003874991
372 8054704475
373 8054734421
374 8054740184

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03193

RsgA_GTPase

RsgA GTPase

121

302

0.93

PF01926

MMR_HSR1

50S ribosome-binding GTPase

231

318

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z1c-assembly1.cif.gz_A crystal structure of hypc from thermococcus kodakaraensis kod1 0.8539 37 97
3vyt-assembly1.cif.gz_A-2 crystal structure of the hypc-hypd-hype complex (form i inward) 0.8497 37 99
3vyt-assembly1.cif.gz_A-2 crystal structure of the hypc-hypd-hype complex (form i inward) 0.8205 37 99
3vyr-assembly1.cif.gz_A crystal structure of the hypc-hypd complex 0.8116 37 99
6h4d-assembly1.cif.gz_A crystal structure of rsga from pseudomonas aeruginosa 0.8036 37 326
ID Description Score Start End Superfamily
af_O05873_98_267_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9098 100 265 3.40.50.300
af_O05873_98_267_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8839 100 265 3.40.50.300
3vytA00 Mainly Beta;Roll;SH3 type barrels.; 0.8497 37 99 2.30.30.140
2z1cB00 Mainly Beta;Roll;SH3 type barrels.; 0.8341 37 99 2.30.30.140
3vytA00 Mainly Beta;Roll;SH3 type barrels.; 0.8205 37 99 2.30.30.140
ID Description Score Start End GO Terms
AF-X7YJS7-F1-model_v4 Putative ribosome biogenesis GTPase RsgA 0.9439 42 167 GO:0003924
GO:0005525
AF-A0A7W0CNE4-F1-model_v4 Small ribosomal subunit biogenesis GTPase RsgA (EC 3.6.1.-) 0.929 43 327 GO:0003924
GO:0005525
GO:0005737
GO:0019843
GO:0042274
GO:0046872
AF-A0A6V8L4K9-F1-model_v4 EngC GTPase domain-containing protein 0.919 43 259 GO:0003924
GO:0005525
AF-A0A7G8WKD0-F1-model_v4 Ribosome small subunit-dependent GTPase A 0.9121 42 327 GO:0003924
GO:0005525
AF-A0A132MNE6-F1-model_v4 Small ribosomal subunit biogenesis GTPase RsgA (EC 3.6.1.-) 0.9078 17 328 GO:0003924
GO:0005525
GO:0005737
GO:0019843
GO:0042274
GO:0046872

Map