F287652

General Info

Members Datasets Scaffolds Average Seq Length
187 127 187 140

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10616393|Ga0157370_106163932
Length 151
Sequence VGVLIDSSVLIDYERGRLDLAGRLAGREQEEFFLSVVTASELLHGVHRAARSEVRARRSAFVEAILDRFPMLPVDLATARAHAQLWAELSSDGVVIGPHDLWLAAACIANGLTMVTANVREFSRVPGLLVESWGASEAGATPATPSPRRRR

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
51 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
57 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
58 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
59 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
65 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
66 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
67 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
68 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
69 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
70 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
72 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
107 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
124 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
127 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 1.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.14
Rhizosphere 94.65
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10310915 3300005289 Unclassified 868
2 Ga0065707_10268032 3300005295 Bacteria 1075
3 Ga0070709_10000793 3300005434 Bacteria 17679
4 Ga0070709_10062370 3300005434 Bacteria 2376
5 Ga0070714_100066471 3300005435 Bacteria 3107
6 Ga0070714_100530985 3300005435 Unclassified 1125
7 Ga0070713_100165636 3300005436 Bacteria 1976
8 Ga0070710_10075314 3300005437 Bacteria 1955
9 Ga0070708_100008286 3300005445 Bacteria 8347
10 Ga0070708_100009354 3300005445 Bacteria 7899
11 Ga0070708_100076935 3300005445 Bacteria 3015
12 Ga0070708_100132170 3300005445 Unclassified 2310
13 Ga0070708_100189861 3300005445 Bacteria 1921
14 Ga0070706_100124617 3300005467 Bacteria 2402
15 Ga0070706_100127635 3300005467 Bacteria 2372
16 Ga0070706_100494853 3300005467 Unclassified 1138
17 Ga0070707_100035581 3300005468 Bacteria 4751
18 Ga0070707_100053009 3300005468 Unclassified 3888
19 Ga0070707_100057116 3300005468 Bacteria 3744
20 Ga0070707_100314230 3300005468 Bacteria 1523
21 Ga0070707_100518262 3300005468 Bacteria 1154
22 Ga0070707_100632980 3300005468 Unclassified 1032
23 Ga0070698_100059379 3300005471 Bacteria 3863
24 Ga0070698_100122536 3300005471 Bacteria 2558
25 Ga0070698_100134947 3300005471 Bacteria 2422
26 Ga0070698_100515443 3300005471 Unclassified 1134
27 Ga0070697_100380702 3300005536 Unclassified 1222
28 Ga0068853_100029859 3300005539 Bacteria 4599
29 Ga0070704_100307338 3300005549 Unclassified 1323
30 Ga0070704_100981533 3300005549 Unclassified 763
31 Ga0068856_100019230 3300005614 Bacteria 6631
32 Ga0068856_100070375 3300005614 Bacteria 3461
33 Ga0068856_100117355 3300005614 Bacteria 2662
34 Ga0068852_100118978 3300005616 Bacteria 2415
35 Ga0068861_100901490 3300005719 Unclassified 837
36 Ga0081538_10183719 3300005981 Unclassified 890
37 Ga0070717_10010875 3300006028 Bacteria 6889
38 Ga0070717_10081469 3300006028 Bacteria 2717
39 Ga0070717_10264003 3300006028 Bacteria 1524
40 Ga0070717_10930205 3300006028 Bacteria 792
41 Ga0070712_100148504 3300006175 Bacteria 1797
42 Ga0075433_10271670 3300006852 Unclassified 1502
43 Ga0075434_100144239 3300006871 Bacteria 2401
44 Ga0075434_100451625 3300006871 Unclassified 1306
45 Ga0075429_100302711 3300006880 Unclassified 1400
46 Ga0075436_100451812 3300006914 Unclassified 936
47 Ga0075435_101017169 3300007076 Unclassified 724
48 Ga0105240_10733583 3300009093 Bacteria 1075
49 Ga0105245_10393674 3300009098 Bacteria 1383
50 Ga0105245_11450102 3300009098 Unclassified 737
51 Ga0114129_10065579 3300009147 Bacteria 5068
52 Ga0114129_10130643 3300009147 Bacteria 3450
53 Ga0114129_10277205 3300009147 Unclassified 2241
54 Ga0105237_10046704 3300009545 Bacteria 4355
55 Ga0105239_10010519 3300010375 Bacteria 10342
56 Ga0157370_10616393 3300013104 Bacteria 993
57 Ga0157369_11360804 3300013105 Bacteria 723
58 Ga0197907_11413188 3300020069 Unclassified 900
59 Ga0224712_10103954 3300022467 Unclassified 1209
60 Ga0207692_10130199 3300025898 Bacteria 1420
61 Ga0207699_10000094 3300025906 Bacteria 65720
62 Ga0207699_10111600 3300025906 Bacteria 1753
63 Ga0207684_10008715 3300025910 Bacteria 9004
64 Ga0207684_10158607 3300025910 Unclassified 1948
65 Ga0207684_10491584 3300025910 Viruses 1052
66 Ga0207684_10870051 3300025910 Unclassified 759
67 Ga0207695_10520496 3300025913 Bacteria 1071
68 Ga0207671_10043820 3300025914 Bacteria 3308
69 Ga0207693_10362996 3300025915 Bacteria 1133
70 Ga0207663_10362153 3300025916 Bacteria 1100
71 Ga0207646_10000555 3300025922 Bacteria 49210
72 Ga0207646_10007985 3300025922 Bacteria 10673
73 Ga0207646_10064856 3300025922 Bacteria 3260
74 Ga0207646_10441049 3300025922 Bacteria 1175
75 Ga0207687_10081510 3300025927 Unclassified 2338
76 Ga0207700_10021305 3300025928 Bacteria 4423
77 Ga0207664_10079307 3300025929 Bacteria 2665
78 Ga0207664_10484277 3300025929 Bacteria 1107
79 Ga0207665_10374266 3300025939 Unclassified 1080
80 Ga0207661_10586150 3300025944 Unclassified 1023
81 Ga0207639_10042368 3300026041 Bacteria 3411
82 Ga0207702_10041481 3300026078 Bacteria 3859
83 Ga0207702_10089133 3300026078 Bacteria 2697
84 Ga0207698_10307700 3300026142 Unclassified 1478
85 Ga0265320_10025512 3300031240 Bacteria 3106
86 Ga0265339_10241102 3300031249 Bacteria 878
87 Ga0265316_10482920 3300031344 Unclassified 886
88 Ga0307408_100932247 3300031548 Unclassified 797
89 Ga0265342_10000119 3300031712 Bacteria 87664
90 Ga0307405_10384011 3300031731 Unclassified 1094
91 Ga0307413_10290931 3300031824 Unclassified 1234
92 Ga0307410_10338092 3300031852 Bacteria 1199
93 Ga0307406_10172123 3300031901 Bacteria 1568
94 Ga0307407_10497634 3300031903 Unclassified 893
95 Ga0307409_100291554 3300031995 Bacteria 1513
96 Ga0307409_100953255 3300031995 Unclassified 874
97 Ga0307409_101796530 3300031995 Bacteria 642
98 Ga0307416_100546775 3300032002 Unclassified 1231
99 Ga0307416_100935151 3300032002 Unclassified 968
100 Ga0307416_101067778 3300032002 Bacteria 912
101 Ga0307414_10452823 3300032004 Bacteria 1126
102 Ga0307415_100109177 3300032126 Bacteria 2049
103 Ga0307415_100652264 3300032126 Unclassified 944
104 Ga0373950_0000103 3300034818 Bacteria 20851
105 Ga0373950_0090132 3300034818 Unclassified 650
106 Ga0373934_0093927 3300035086 Bacteria 1210
107 Ga0373936_0034185 3300035113 Unclassified 2018
108 Ga0373956_0004099 3300035119 Bacteria 5846
109 Ga0373955_0103523 3300035172 Bacteria 1637
110 Ga0373924_0181484 3300035410 Unclassified 926
111 Ga0373935_0235226 3300035692 Unclassified 1277
112 Ga0373927_0526747 3300035695 Bacteria 781
113 Ga0373933_0005396 3300035724 Bacteria 6955
114 Ga0373937_0020723 3300036401 Bacteria 5896
115 Ga0373937_0099733 3300036401 Bacteria 2694
116 Ga0373937_0716307 3300036401 Unclassified 948
117 Ga0373925_0797834 3300037068 Bacteria 778
118 Ga0436364_0065185 3300037853 Bacteria 1135
119 Ga0436364_0092309 3300037853 Bacteria 1275
120 Ga0436364_0789203 3300037853 Unclassified 567
121 Ga0436364_1281379 3300037853 Bacteria 2035
122 Ga0436365_1477169 3300039437 Bacteria 949
123 Ga0436360_0297305 3300039438 Unclassified 853
124 Ga0466969_0171623 3300044656 Bacteria 994
125 Ga0466966_0050912 3300044684 Bacteria 2634
126 Ga0466966_0375504 3300044684 Bacteria 854
127 Ga0466961_0001939 3300044693 Bacteria 12892
128 Ga0466963_0116152 3300044694 Bacteria 1839
129 Ga0453684_0058316 3300044712 Bacteria 4988
130 Ga0466968_0181412 3300044735 Bacteria 979
131 Ga0466957_1231082 3300044842 Bacteria 542
132 Ga0466959_0029890 3300045049 Bacteria 4035
133 Ga0466959_0094676 3300045049 Bacteria 2142
134 Ga0466958_0063733 3300045836 Bacteria 2248
135 Ga0466958_0162386 3300045836 Bacteria 1412
136 Ga0466967_0044560 3300045976 Bacteria 3849
137 Ga0466967_0217117 3300045976 Bacteria 1816
138 Ga0495629_0673765 3300046459 Unclassified 688
139 Ga0495651_0046425 3300046462 Bacteria 3361
140 Ga0495653_0000582 3300046463 Bacteria 28064
141 Ga0495653_0024498 3300046463 Bacteria 4862
142 Ga0495664_0686788 3300046477 Unclassified 605
143 Ga0495608_0017425 3300046511 Bacteria 4967
144 Ga0495652_0097338 3300046529 Unclassified 2394
145 Ga0495586_0694055 3300046535 Bacteria 588
146 Ga0495667_0016028 3300046559 Bacteria 5065
147 Ga0495634_0095565 3300046642 Bacteria 1925
148 Ga0495635_0006643 3300046663 Bacteria 8077
149 Ga0495657_0024463 3300046675 Bacteria 4300
150 Ga0495600_0065194 3300046809 Bacteria 2381
151 Ga0495674_0208146 3300047319 Unclassified 1621
152 Ga0495680_0004530 3300047322 Bacteria 13277
153 Ga0495684_0130677 3300047471 Unclassified 1886
154 Ga0495602_0332716 3300048088 Bacteria 1101
155 Ga0496100_0009319 3300048903 Bacteria 5515
156 Ga0496100_0502893 3300048903 Bacteria 934
157 Ga0496102_0028478 3300048905 Bacteria 4990
158 Ga0496103_0053139 3300048906 Bacteria 2510
159 Ga0496118_0259329 3300048921 Bacteria 982
160 Ga0501034_0003174 3300049571 Bacteria 18907
161 Ga0501040_1402272 3300049576 Unclassified 507
162 Ga0501041_0126837 3300049577 Bacteria 1589
163 Ga0501041_1105399 3300049577 Bacteria 511
164 Ga0501042_0455245 3300049578 Unclassified 928
165 Ga0501046_0344146 3300049580 Bacteria 1083
166 Ga0501048_0316844 3300049582 Bacteria 1111
167 Ga0501067_0000048 3300049583 Bacteria 71117
168 Ga0501067_0000089 3300049583 Bacteria 53187
169 Ga0501070_0023053 3300049586 Bacteria 5213
170 Ga0501073_0007887 3300049589 Bacteria 7901
171 Ga0501076_0641441 3300049592 Unclassified 876
172 Ga0501230_139038 3300049667 Unclassified 547
173 Ga0501079_1376861 3300049741 Unclassified 555
174 nmdc:mga05p37_14018_c1 3300050507 Bacteria 9615
175 nmdc:mga05p37_145192_c1 3300050507 Bacteria 2906
176 nmdc:mga05p37_232435_c1 3300050507 Unclassified 2221
177 nmdc:mga09592_308093_c1 3300050508 Bacteria 1372
178 nmdc:mga09592_778050_c1 3300050508 Unclassified 811
179 nmdc:mga0n895_231625_c1 3300050512 Unclassified 1875
180 nmdc:mga0n895_69856_c1 3300050512 Bacteria 3480
181 nmdc:mga08x19_437812_c1 3300050514 Unclassified 919
182 nmdc:mga0a205_169499_c1 3300050515 Unclassified 2079
183 nmdc:mga0a205_614425_c1 3300050515 Unclassified 940
184 Ga0501084_1228880 3300054114 Unclassified 628
185 Ga0501082_0192211 3300060353 Bacteria 1775
186 Ga0501082_1082499 3300060353 Unclassified 701
187 Ga0466962_0568046 3300061719 Bacteria 577

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025944 Ga0207661_10586150 Ga0207661_105861502 111
2 3300005445 Ga0070708_100009354 Ga0070708_1000093546 116
3 3300031344 Ga0265316_10482920 Ga0265316_104829202 116
4 3300046535 Ga0495586_0694055 Ga0495586_0694055_171_572 116
5 3300049577 Ga0501041_1105399 Ga0501041_1105399_63_464 122
6 3300049578 Ga0501042_0455245 Ga0501042_0455245_115_516 122
7 3300049592 Ga0501076_0641441 Ga0501076_0641441_206_607 122
8 3300050512 nmdc:mga0n895_69856_c1 nmdc:mga0n895_69856_c1_2834_3277 122
9 3300060353 Ga0501082_1082499 Ga0501082_1082499_100_501 122
10 3300006871 Ga0075434_100144239 Ga0075434_1001442392 124
11 3300050507 nmdc:mga05p37_145192_c1 nmdc:mga05p37_145192_c1_606_1007 124
12 3300005467 Ga0070706_100494853 Ga0070706_1004948531 126
13 3300025910 Ga0207684_10491584 Ga0207684_104915842 126
14 3300005614 Ga0068856_100019230 Ga0068856_1000192303 128
15 3300026078 Ga0207702_10041481 Ga0207702_100414813 128
16 3300039437 Ga0436365_1477169 Ga0436365_1477169_210_611 129
17 3300044656 Ga0466969_0171623 Ga0466969_0171623_46_447 129
18 3300044684 Ga0466966_0050912 Ga0466966_0050912_1239_1640 129
19 3300044684 Ga0466966_0375504 Ga0466966_0375504_238_639 129
20 3300044693 Ga0466961_0001939 Ga0466961_0001939_2258_2659 129
21 3300044694 Ga0466963_0116152 Ga0466963_0116152_775_1176 129
22 3300044735 Ga0466968_0181412 Ga0466968_0181412_363_764 129
23 3300044842 Ga0466957_1231082 Ga0466957_1231082_58_459 129
24 3300045049 Ga0466959_0029890 Ga0466959_0029890_1019_1420 129
25 3300045049 Ga0466959_0094676 Ga0466959_0094676_347_748 129
26 3300045836 Ga0466958_0063733 Ga0466958_0063733_1137_1538 129
27 3300045836 Ga0466958_0162386 Ga0466958_0162386_459_860 129
28 3300045976 Ga0466967_0217117 Ga0466967_0217117_1273_1674 129
29 3300061719 Ga0466962_0568046 Ga0466962_0568046_76_477 129
30 3300034818 Ga0373950_0090132 Ga0373950_0090132_223_618 130
31 3300049571 Ga0501034_0003174 Ga0501034_0003174_11266_11658 130
32 3300049576 Ga0501040_1402272 Ga0501040_1402272_36_428 130
33 3300050508 nmdc:mga09592_308093_c1 nmdc:mga09592_308093_c1_426_830 130
34 3300009147 Ga0114129_10065579 Ga0114129_100655799 131
35 3300009147 Ga0114129_10130643 Ga0114129_101306433 131
36 3300045976 Ga0466967_0044560 Ga0466967_0044560_764_1195 131
37 3300005434 Ga0070709_10000793 Ga0070709_100007935 132
38 3300005434 Ga0070709_10062370 Ga0070709_100623702 132
39 3300005435 Ga0070714_100066471 Ga0070714_1000664715 132
40 3300005435 Ga0070714_100530985 Ga0070714_1005309851 132
41 3300005436 Ga0070713_100165636 Ga0070713_1001656361 132
42 3300005437 Ga0070710_10075314 Ga0070710_100753141 132
43 3300005445 Ga0070708_100008286 Ga0070708_10000828615 132
44 3300005445 Ga0070708_100076935 Ga0070708_1000769353 132
45 3300005445 Ga0070708_100189861 Ga0070708_1001898614 132
46 3300005467 Ga0070706_100127635 Ga0070706_1001276354 132
47 3300005468 Ga0070707_100035581 Ga0070707_1000355818 132
48 3300005468 Ga0070707_100053009 Ga0070707_1000530093 132
49 3300005468 Ga0070707_100057116 Ga0070707_1000571163 132
50 3300005468 Ga0070707_100314230 Ga0070707_1003142304 132
51 3300005468 Ga0070707_100518262 Ga0070707_1005182622 132
52 3300005471 Ga0070698_100122536 Ga0070698_1001225362 132
53 3300005471 Ga0070698_100134947 Ga0070698_1001349473 132
54 3300005536 Ga0070697_100380702 Ga0070697_1003807023 132
55 3300005539 Ga0068853_100029859 Ga0068853_1000298596 132
56 3300005614 Ga0068856_100070375 Ga0068856_1000703754 132
57 3300005614 Ga0068856_100117355 Ga0068856_1001173552 132
58 3300005616 Ga0068852_100118978 Ga0068852_1001189783 132
59 3300006028 Ga0070717_10010875 Ga0070717_100108756 132
60 3300006028 Ga0070717_10081469 Ga0070717_100814696 132
61 3300006028 Ga0070717_10264003 Ga0070717_102640033 132
62 3300006028 Ga0070717_10930205 Ga0070717_109302052 132
63 3300006175 Ga0070712_100148504 Ga0070712_1001485042 132
64 3300009093 Ga0105240_10733583 Ga0105240_107335832 132
65 3300009098 Ga0105245_11450102 Ga0105245_114501021 132
66 3300009545 Ga0105237_10046704 Ga0105237_100467044 132
67 3300010375 Ga0105239_10010519 Ga0105239_100105198 132
68 3300013105 Ga0157369_11360804 Ga0157369_113608042 132
69 3300020069 Ga0197907_11413188 Ga0197907_114131882 132
70 3300022467 Ga0224712_10103954 Ga0224712_101039542 132
71 3300025898 Ga0207692_10130199 Ga0207692_101301993 132
72 3300025906 Ga0207699_10000094 Ga0207699_1000009437 132
73 3300025906 Ga0207699_10111600 Ga0207699_101116001 132
74 3300025910 Ga0207684_10008715 Ga0207684_100087153 132
75 3300025910 Ga0207684_10158607 Ga0207684_101586072 132
76 3300025913 Ga0207695_10520496 Ga0207695_105204963 132
77 3300025914 Ga0207671_10043820 Ga0207671_100438203 132
78 3300025915 Ga0207693_10362996 Ga0207693_103629962 132
79 3300025916 Ga0207663_10362153 Ga0207663_103621532 132
80 3300025922 Ga0207646_10000555 Ga0207646_1000055551 132
81 3300025922 Ga0207646_10007985 Ga0207646_1000798513 132
82 3300025922 Ga0207646_10064856 Ga0207646_100648564 132
83 3300025922 Ga0207646_10441049 Ga0207646_104410492 132
84 3300025928 Ga0207700_10021305 Ga0207700_100213055 132
85 3300025929 Ga0207664_10079307 Ga0207664_100793072 132
86 3300025929 Ga0207664_10484277 Ga0207664_104842772 132
87 3300026041 Ga0207639_10042368 Ga0207639_100423685 132
88 3300026078 Ga0207702_10089133 Ga0207702_100891332 132
89 3300026142 Ga0207698_10307700 Ga0207698_103077002 132
90 3300031548 Ga0307408_100932247 Ga0307408_1009322472 132
91 3300031731 Ga0307405_10384011 Ga0307405_103840113 132
92 3300031824 Ga0307413_10290931 Ga0307413_102909312 132
93 3300031852 Ga0307410_10338092 Ga0307410_103380922 132
94 3300031901 Ga0307406_10172123 Ga0307406_101721232 132
95 3300031903 Ga0307407_10497634 Ga0307407_104976342 132
96 3300031995 Ga0307409_100291554 Ga0307409_1002915542 132
97 3300032002 Ga0307416_100935151 Ga0307416_1009351512 132
98 3300032004 Ga0307414_10452823 Ga0307414_104528232 132
99 3300032126 Ga0307415_100109177 Ga0307415_1001091772 132
100 3300034818 Ga0373950_0000103 Ga0373950_0000103_9792_10193 132
101 3300035086 Ga0373934_0093927 Ga0373934_0093927_443_886 132
102 3300035113 Ga0373936_0034185 Ga0373936_0034185_569_1012 132
103 3300035119 Ga0373956_0004099 Ga0373956_0004099_3989_4432 132
104 3300035172 Ga0373955_0103523 Ga0373955_0103523_791_1234 132
105 3300035410 Ga0373924_0181484 Ga0373924_0181484_406_849 132
106 3300035692 Ga0373935_0235226 Ga0373935_0235226_145_588 132
107 3300035695 Ga0373927_0526747 Ga0373927_0526747_143_577 132
108 3300035724 Ga0373933_0005396 Ga0373933_0005396_3192_3635 132
109 3300036401 Ga0373937_0020723 Ga0373937_0020723_1623_2066 132
110 3300036401 Ga0373937_0099733 Ga0373937_0099733_53_496 132
111 3300036401 Ga0373937_0716307 Ga0373937_0716307_454_897 132
112 3300037068 Ga0373925_0797834 Ga0373925_0797834_26_469 132
113 3300037853 Ga0436364_0065185 Ga0436364_0065185_352_795 132
114 3300037853 Ga0436364_0092309 Ga0436364_0092309_495_938 132
115 3300037853 Ga0436364_0789203 Ga0436364_0789203_23_466 132
116 3300037853 Ga0436364_1281379 Ga0436364_1281379_247_705 132
117 3300039438 Ga0436360_0297305 Ga0436360_0297305_309_752 132
118 3300046459 Ga0495629_0673765 Ga0495629_0673765_170_613 132
119 3300046462 Ga0495651_0046425 Ga0495651_0046425_1234_1677 132
120 3300046463 Ga0495653_0000582 Ga0495653_0000582_9249_9701 132
121 3300046463 Ga0495653_0024498 Ga0495653_0024498_1641_2084 132
122 3300046477 Ga0495664_0686788 Ga0495664_0686788_17_460 132
123 3300046511 Ga0495608_0017425 Ga0495608_0017425_1051_1494 132
124 3300046529 Ga0495652_0097338 Ga0495652_0097338_365_808 132
125 3300046559 Ga0495667_0016028 Ga0495667_0016028_1973_2416 132
126 3300046642 Ga0495634_0095565 Ga0495634_0095565_344_787 132
127 3300046663 Ga0495635_0006643 Ga0495635_0006643_4383_4826 132
128 3300046675 Ga0495657_0024463 Ga0495657_0024463_1200_1643 132
129 3300046809 Ga0495600_0065194 Ga0495600_0065194_259_702 132
130 3300047319 Ga0495674_0208146 Ga0495674_0208146_715_1158 132
131 3300047322 Ga0495680_0004530 Ga0495680_0004530_9646_10089 132
132 3300047471 Ga0495684_0130677 Ga0495684_0130677_418_861 132
133 3300048088 Ga0495602_0332716 Ga0495602_0332716_434_877 132
134 3300048903 Ga0496100_0009319 Ga0496100_0009319_4843_5283 132
135 3300048903 Ga0496100_0502893 Ga0496100_0502893_167_601 132
136 3300048905 Ga0496102_0028478 Ga0496102_0028478_1694_2128 132
137 3300048906 Ga0496103_0053139 Ga0496103_0053139_747_1181 132
138 3300048921 Ga0496118_0259329 Ga0496118_0259329_138_572 132
139 3300049583 Ga0501067_0000089 Ga0501067_0000089_2347_2748 132
140 3300049586 Ga0501070_0023053 Ga0501070_0023053_2081_2503 132
141 3300049589 Ga0501073_0007887 Ga0501073_0007887_5154_5555 132
142 3300005289 Ga0065704_10310915 Ga0065704_103109151 133
143 3300005295 Ga0065707_10268032 Ga0065707_102680321 133
144 3300005445 Ga0070708_100132170 Ga0070708_1001321702 133
145 3300005467 Ga0070706_100124617 Ga0070706_1001246173 133
146 3300005468 Ga0070707_100632980 Ga0070707_1006329802 133
147 3300005471 Ga0070698_100059379 Ga0070698_1000593793 133
148 3300005471 Ga0070698_100515443 Ga0070698_1005154432 133
149 3300005549 Ga0070704_100307338 Ga0070704_1003073381 133
150 3300005549 Ga0070704_100981533 Ga0070704_1009815331 133
151 3300005719 Ga0068861_100901490 Ga0068861_1009014902 133
152 3300005981 Ga0081538_10183719 Ga0081538_101837193 133
153 3300006852 Ga0075433_10271670 Ga0075433_102716704 133
154 3300006871 Ga0075434_100451625 Ga0075434_1004516254 133
155 3300006880 Ga0075429_100302711 Ga0075429_1003027113 133
156 3300006914 Ga0075436_100451812 Ga0075436_1004518122 133
157 3300007076 Ga0075435_101017169 Ga0075435_1010171692 133
158 3300009098 Ga0105245_10393674 Ga0105245_103936741 133
159 3300009147 Ga0114129_10277205 Ga0114129_102772053 133
160 3300013104 Ga0157370_10616393 Ga0157370_106163932 133
161 3300025910 Ga0207684_10870051 Ga0207684_108700512 133
162 3300025927 Ga0207687_10081510 Ga0207687_100815102 133
163 3300025939 Ga0207665_10374266 Ga0207665_103742663 133
164 3300031240 Ga0265320_10025512 Ga0265320_100255122 133
165 3300031249 Ga0265339_10241102 Ga0265339_102411022 133
166 3300031712 Ga0265342_10000119 Ga0265342_1000011927 133
167 3300031995 Ga0307409_100953255 Ga0307409_1009532552 133
168 3300031995 Ga0307409_101796530 Ga0307409_1017965302 133
169 3300032002 Ga0307416_100546775 Ga0307416_1005467751 133
170 3300032002 Ga0307416_101067778 Ga0307416_1010677782 133
171 3300032126 Ga0307415_100652264 Ga0307415_1006522642 133
172 3300044712 Ga0453684_0058316 Ga0453684_0058316_188_592 133
173 3300049577 Ga0501041_0126837 Ga0501041_0126837_268_681 133
174 3300049580 Ga0501046_0344146 Ga0501046_0344146_196_609 133
175 3300049582 Ga0501048_0316844 Ga0501048_0316844_437_850 133
176 3300049583 Ga0501067_0000048 Ga0501067_0000048_3554_3958 133
177 3300049667 Ga0501230_139038 Ga0501230_139038_118_531 133
178 3300049741 Ga0501079_1376861 Ga0501079_1376861_55_510 133
179 3300050507 nmdc:mga05p37_14018_c1 nmdc:mga05p37_14018_c1_5053_5454 133
180 3300050507 nmdc:mga05p37_232435_c1 nmdc:mga05p37_232435_c1_1284_1685 133
181 3300050508 nmdc:mga09592_778050_c1 nmdc:mga09592_778050_c1_52_453 133
182 3300050512 nmdc:mga0n895_231625_c1 nmdc:mga0n895_231625_c1_1115_1516 133
183 3300050514 nmdc:mga08x19_437812_c1 nmdc:mga08x19_437812_c1_131_532 133
184 3300050515 nmdc:mga0a205_169499_c1 nmdc:mga0a205_169499_c1_630_1031 133
185 3300050515 nmdc:mga0a205_614425_c1 nmdc:mga0a205_614425_c1_184_585 133
186 3300054114 Ga0501084_1228880 Ga0501084_1228880_97_510 133
187 3300060353 Ga0501082_0192211 Ga0501082_0192211_1074_1487 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

3

128

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ifm-assembly1.cif.gz_C crystal structure of dna bound vapbc from salmonella typhimurium 0.9062 1 133
5ecw-assembly1.cif.gz_B structure of the shigella flexneri vapc mutant d7a 0.9055 1 133
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.9052 1 133
5ecy-assembly1.cif.gz_H structure of the shigella flexneri vapc mutant d98n crystal form 2 0.9015 1 133
3zvk-assembly1.cif.gz_B crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.8997 1 133
ID Description Score Start End Superfamily
af_O07783_4_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9392 1 133 3.40.50.1010
af_O07783_4_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9322 1 133 3.40.50.1010
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9055 1 133 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8997 1 133 3.40.50.1010
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8846 1 133 3.40.50.1010
ID Description Score Start End GO Terms
AF-S4XT11-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9841 1 133 GO:0000287
GO:0004540
GO:0090729
AF-A0A2V7ZC90-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.982 1 133 GO:0000287
GO:0004540
GO:0090729
AF-A0A0C1QKM7-F1-model_v4 Putative ribonuclease VapC (EC 3.1.-.-) 0.981 31 133 GO:0004518
GO:0046872
AF-A0A150RAD1-F1-model_v4 PIN domain-containing protein 0.9808 24 133 GO:0004518
GO:0046872
AF-A0A2V7ZC90-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9748 1 133 GO:0000287
GO:0004540
GO:0090729

Feature Viewer

pLDDT pTM Quality
95.41 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map