F286432

General Info

Members Datasets Scaffolds Average Seq Length
186 118 372 150

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0064826|Ga0466964_0064826_733_1266
Length 177
Sequence VTETRIVRTSPSAVRRAGGWDGYRRGVALQTELDRLEVRLLHDGAALPVRTRPGDAGYDLRAAEPFALAPGGRATVGTGIALALPPGVAGLVVPRSGLAARHGLSVVNGPGLIDPNYRGEVRVVLVNLGDEPFAGEPGDRIAQLLLVPYLAPEVVAVEALPPGADDRGELGFGSSGR

Samples

Sample ID Description Type Environment
1 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
61 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
70 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
73 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
74 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
75 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
76 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
77 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
78 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
79 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
80 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
81 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
82 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
83 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
84 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
85 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
86 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
87 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
99 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
100 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
101 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
105 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
106 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
107 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
112 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
113 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
114 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
115 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
116 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
117 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
118 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 8.06
Rhizosphere 90.86
Stem 0
Stem Tuber 0
Unclassified 10.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466964_0064826 3300044706 Bacteria 1529
2 JGI25406J46586_10036257 3300003203 Bacteria 1791
3 Ga0070683_100489558 3300005329 Bacteria 1174
4 Ga0070683_100596884 3300005329 Bacteria 1057
5 Ga0068868_101043090 3300005338 Bacteria 750
6 Ga0070687_100874944 3300005343 Unclassified 642
7 Ga0070661_100947562 3300005344 Bacteria 712
8 Ga0070674_101049800 3300005356 Bacteria 717
9 Ga0070700_100450578 3300005441 Unclassified 979
10 Ga0070663_101270164 3300005455 Unclassified 649
11 Ga0070678_101290234 3300005456 Bacteria 679
12 Ga0070685_10267081 3300005466 Bacteria 1140
13 Ga0070685_10987225 3300005466 Bacteria 631
14 Ga0070686_100749714 3300005544 Bacteria 783
15 Ga0070664_100789028 3300005564 Bacteria 888
16 Ga0068854_100633929 3300005578 Unclassified 916
17 Ga0068854_101137022 3300005578 Bacteria 697
18 Ga0068856_101585765 3300005614 Bacteria 668
19 Ga0070702_100034925 3300005615 Bacteria 2775
20 Ga0068852_101268827 3300005616 Unclassified 758
21 Ga0068852_101311379 3300005616 Bacteria 746
22 Ga0081538_10001837 3300005981 Bacteria 21406
23 Ga0081538_10177400 3300005981 Bacteria 918
24 Ga0081539_10003237 3300005985 Bacteria 20494
25 Ga0081539_10349169 3300005985 Bacteria 622
26 Ga0075428_100287497 3300006844 Bacteria 1769
27 Ga0075428_100379065 3300006844 Bacteria 1516
28 Ga0075429_100094209 3300006880 Bacteria 2612
29 Ga0068865_100325494 3300006881 Bacteria 1238
30 Ga0068865_100432730 3300006881 Bacteria 1084
31 Ga0111539_10112314 3300009094 Bacteria 3197
32 Ga0111539_11732241 3300009094 Unclassified 725
33 Ga0105245_10195675 3300009098 Bacteria 1939
34 Ga0105245_10549028 3300009098 Bacteria 1177
35 Ga0105245_10551632 3300009098 Bacteria 1174
36 Ga0105243_10190952 3300009148 Bacteria 1789
37 Ga0105242_12218169 3300009176 Bacteria 594
38 Ga0105248_12267551 3300009177 Unclassified 618
39 Ga0157369_10828268 3300013105 Bacteria 950
40 Ga0163162_10121277 3300013306 Bacteria 2719
41 Ga0157372_10328171 3300013307 Unclassified 1782
42 Ga0157375_11041566 3300013308 Bacteria 956
43 Ga0163163_10034181 3300014325 Bacteria 4922
44 Ga0163163_10440346 3300014325 Bacteria 1363
45 Ga0157379_10001861 3300014968 Bacteria 17463
46 Ga0163161_10550621 3300017792 Unclassified 945
47 Ga0206354_11378864 3300020081 Bacteria 622
48 Ga0207660_10848255 3300025917 Bacteria 746
49 Ga0207644_10498948 3300025931 Bacteria 1004
50 Ga0207709_10152487 3300025935 Bacteria 1602
51 Ga0207704_10245061 3300025938 Bacteria 1341
52 Ga0207704_10638979 3300025938 Bacteria 875
53 Ga0207661_10311597 3300025944 Bacteria 1413
54 Ga0207661_10548696 3300025944 Bacteria 1059
55 Ga0207661_10815226 3300025944 Bacteria 859
56 Ga0207712_10126292 3300025961 Bacteria 1942
57 Ga0207677_10899484 3300026023 Unclassified 798
58 Ga0207703_10815949 3300026035 Unclassified 891
59 Ga0207639_11046866 3300026041 Bacteria 765
60 Ga0207708_10769023 3300026075 Bacteria 827
61 Ga0207676_12103586 3300026095 Bacteria 563
62 Ga0207675_100167157 3300026118 Bacteria 2101
63 Ga0207698_10614922 3300026142 Bacteria 1073
64 Ga0207428_10040479 3300027907 Bacteria 3780
65 Ga0207428_10313474 3300027907 Bacteria 1159
66 Ga0268264_10314302 3300028381 Bacteria 1479
67 Ga0307408_100056994 3300031548 Bacteria 2835
68 Ga0307408_100400929 3300031548 Bacteria 1178
69 Ga0307405_10333501 3300031731 Bacteria 1163
70 Ga0307405_10417521 3300031731 Unclassified 1055
71 Ga0307413_10314670 3300031824 Bacteria 1193
72 Ga0307410_10025013 3300031852 Bacteria 3739
73 Ga0307406_10638906 3300031901 Unclassified 882
74 Ga0307407_10218216 3300031903 Bacteria 1288
75 Ga0307412_10488381 3300031911 Bacteria 1023
76 Ga0307409_100008173 3300031995 Bacteria 6326
77 Ga0307416_100057082 3300032002 Bacteria 3155
78 Ga0307416_100482509 3300032002 Bacteria 1300
79 Ga0307414_10091295 3300032004 Bacteria 2263
80 Ga0307414_10635846 3300032004 Bacteria 961
81 Ga0307414_10695238 3300032004 Bacteria 920
82 Ga0307411_10160886 3300032005 Bacteria 1681
83 Ga0307415_100339759 3300032126 Bacteria 1260
84 Ga0307415_100437560 3300032126 Bacteria 1127
85 Ga0307415_101203929 3300032126 Bacteria 714
86 Ga0395899_0774830 3300037312 Bacteria 595
87 Ga0395900_0476338 3300037418 Bacteria 1201
88 Ga0395900_0721308 3300037418 Bacteria 929
89 Ga0395898_0062864 3300037466 Bacteria 3604
90 Ga0395898_0115679 3300037466 Bacteria 2570
91 Ga0395898_0500424 3300037466 Unclassified 1156
92 Ga0395901_0090721 3300038443 Bacteria 3199
93 Ga0395901_0274905 3300038443 Bacteria 1751
94 Ga0395901_0359884 3300038443 Bacteria 1501
95 Ga0395901_0586133 3300038443 Bacteria 1126
96 Ga0395901_0682111 3300038443 Bacteria 1027
97 Ga0466965_0066220 3300044683 Bacteria 1811
98 Ga0466963_0008703 3300044694 Bacteria 6092
99 Ga0466963_0036913 3300044694 Bacteria 3189
100 Ga0466963_0045732 3300044694 Bacteria 2884
101 Ga0466963_0052994 3300044694 Bacteria 2693
102 Ga0466963_0131862 3300044694 Bacteria 1727
103 Ga0466963_0525550 3300044694 Bacteria 835
104 Ga0466963_0734980 3300044694 Bacteria 696
105 Ga0466957_0015996 3300044842 Bacteria 4384
106 Ga0466957_0367889 3300044842 Bacteria 978
107 Ga0466960_0096262 3300044901 Bacteria 1517
108 Ga0466960_0737313 3300044901 Bacteria 593
109 Ga0466967_0018258 3300045976 Bacteria 5599
110 Ga0466967_0027664 3300045976 Bacteria 4719
111 Ga0466967_0028606 3300045976 Bacteria 4655
112 Ga0466967_0047476 3300045976 Bacteria 3743
113 Ga0466967_0057900 3300045976 Bacteria 3423
114 Ga0466967_0190807 3300045976 Bacteria 1936
115 Ga0466967_0224852 3300045976 Bacteria 1785
116 Ga0466967_0421206 3300045976 Unclassified 1301
117 Ga0466967_0433989 3300045976 Bacteria 1282
118 Ga0466967_0640629 3300045976 Bacteria 1050
119 Ga0466967_0695148 3300045976 Bacteria 1007
120 Ga0466967_0822838 3300045976 Bacteria 922
121 Ga0466967_0946888 3300045976 Bacteria 857
122 Ga0466967_1003658 3300045976 Bacteria 831
123 Ga0466967_1781270 3300045976 Unclassified 613
124 Ga0495650_0000054 3300046471 Bacteria 313631
125 Ga0495596_0190992 3300046500 Bacteria 796
126 Ga0495663_0353220 3300046525 Bacteria 536
127 Ga0495645_0000051 3300046543 Bacteria 87212
128 Ga0496100_0083583 3300048903 Bacteria 2162
129 Ga0496101_0021477 3300048904 Bacteria 4436
130 Ga0496101_0735370 3300048904 Unclassified 779
131 Ga0496102_0067494 3300048905 Bacteria 3281
132 Ga0496102_1172793 3300048905 Bacteria 688
133 Ga0496105_0101283 3300048908 Bacteria 2379
134 Ga0496106_0007104 3300048909 Bacteria 8277
135 Ga0496107_0076741 3300048910 Bacteria 2434
136 Ga0496107_1136708 3300048910 Bacteria 563
137 Ga0496109_0626220 3300048912 Bacteria 1012
138 Ga0496110_1246485 3300048913 Bacteria 653
139 Ga0496111_0073327 3300048914 Bacteria 2493
140 Ga0496111_0248362 3300048914 Bacteria 1321
141 Ga0496112_0019562 3300048915 Bacteria 6393
142 Ga0496114_1638172 3300048917 Bacteria 532
143 Ga0496121_0034573 3300048924 Bacteria 4548
144 Ga0501031_0040151 3300049568 Bacteria 3055
145 Ga0501034_0004008 3300049571 Bacteria 16525
146 Ga0501036_0081835 3300049572 Bacteria 2729
147 Ga0501037_0235107 3300049573 Bacteria 1286
148 Ga0501039_0026423 3300049575 Bacteria 4461
149 Ga0501040_0024617 3300049576 Bacteria 4041
150 Ga0501040_0340090 3300049576 Bacteria 1074
151 Ga0501041_0021275 3300049577 Bacteria 3887
152 Ga0501041_0064899 3300049577 Bacteria 2236
153 Ga0501042_0081198 3300049578 Bacteria 2323
154 Ga0501042_0556978 3300049578 Bacteria 833
155 Ga0501043_0385281 3300049579 Bacteria 1061
156 Ga0501048_0371788 3300049582 Bacteria 1020
157 Ga0501048_0522315 3300049582 Bacteria 851
158 Ga0501067_0599854 3300049583 Unclassified 618
159 Ga0501068_0301278 3300049584 Bacteria 1026
160 Ga0501069_0152647 3300049585 Bacteria 1328
161 Ga0501069_0356407 3300049585 Bacteria 863
162 Ga0501071_0031269 3300049587 Bacteria 3772
163 Ga0501071_0031489 3300049587 Bacteria 3760
164 Ga0501072_0018235 3300049588 Bacteria 5400
165 Ga0501072_0811475 3300049588 Bacteria 732
166 Ga0501074_0091391 3300049590 Bacteria 2180
167 Ga0501075_0114313 3300049591 Bacteria 2052
168 Ga0501075_0171338 3300049591 Bacteria 1656
169 Ga0501076_0010420 3300049592 Bacteria 6901
170 Ga0501079_0085690 3300049741 Bacteria 2438
171 Ga0501079_0111573 3300049741 Bacteria 2125
172 Ga0501081_0332330 3300049743 Bacteria 1118
173 Ga0501083_0189788 3300049744 Bacteria 1341
174 Ga0501044_0386413 3300049823 Bacteria 1314
175 Ga0501045_0071138 3300049824 Bacteria 2560
176 nmdc:mga09592_71552_c1 3300050508 Bacteria 2943
177 nmdc:mga08y16_1111935_c1 3300050511 Unclassified 765
178 nmdc:mga08y16_234443_c2 3300050511 Bacteria 1477
179 Ga0495601_0370852 3300053077 Bacteria 930
180 Ga0500616_0002823 3300053153 Bacteria 13968
181 Ga0501084_0032558 3300054114 Bacteria 4361
182 Ga0501082_0062865 3300060353 Bacteria 3196
183 Ga0501082_0209119 3300060353 Bacteria 1698
184 Ga0466962_0376663 3300061719 Bacteria 709
185 Ga0530510_0007691 3300061734 Bacteria 7505
186 Ga0530510_0097813 3300061734 Bacteria 2146
187 Ga0466964_0064826
188 JGI25406J46586_10036257
189 Ga0070683_100489558
190 Ga0070683_100596884
191 Ga0068868_101043090
192 Ga0070687_100874944
193 Ga0070661_100947562
194 Ga0070674_101049800
195 Ga0070700_100450578
196 Ga0070663_101270164
197 Ga0070678_101290234
198 Ga0070685_10267081
199 Ga0070685_10987225
200 Ga0070686_100749714
201 Ga0070664_100789028
202 Ga0068854_100633929
203 Ga0068854_101137022
204 Ga0068856_101585765
205 Ga0070702_100034925
206 Ga0068852_101268827
207 Ga0068852_101311379
208 Ga0081538_10001837
209 Ga0081538_10177400
210 Ga0081539_10003237
211 Ga0081539_10349169
212 Ga0075428_100287497
213 Ga0075428_100379065
214 Ga0075429_100094209
215 Ga0068865_100325494
216 Ga0068865_100432730
217 Ga0111539_10112314
218 Ga0111539_11732241
219 Ga0105245_10195675
220 Ga0105245_10549028
221 Ga0105245_10551632
222 Ga0105243_10190952
223 Ga0105242_12218169
224 Ga0105248_12267551
225 Ga0157369_10828268
226 Ga0163162_10121277
227 Ga0157372_10328171
228 Ga0157375_11041566
229 Ga0163163_10034181
230 Ga0163163_10440346
231 Ga0157379_10001861
232 Ga0163161_10550621
233 Ga0206354_11378864
234 Ga0207660_10848255
235 Ga0207644_10498948
236 Ga0207709_10152487
237 Ga0207704_10245061
238 Ga0207704_10638979
239 Ga0207661_10311597
240 Ga0207661_10548696
241 Ga0207661_10815226
242 Ga0207712_10126292
243 Ga0207677_10899484
244 Ga0207703_10815949
245 Ga0207639_11046866
246 Ga0207708_10769023
247 Ga0207676_12103586
248 Ga0207675_100167157
249 Ga0207698_10614922
250 Ga0207428_10040479
251 Ga0207428_10313474
252 Ga0268264_10314302
253 Ga0307408_100056994
254 Ga0307408_100400929
255 Ga0307405_10333501
256 Ga0307405_10417521
257 Ga0307413_10314670
258 Ga0307410_10025013
259 Ga0307406_10638906
260 Ga0307407_10218216
261 Ga0307412_10488381
262 Ga0307409_100008173
263 Ga0307416_100057082
264 Ga0307416_100482509
265 Ga0307414_10091295
266 Ga0307414_10635846
267 Ga0307414_10695238
268 Ga0307411_10160886
269 Ga0307415_100339759
270 Ga0307415_100437560
271 Ga0307415_101203929
272 Ga0395899_0774830
273 Ga0395900_0476338
274 Ga0395900_0721308
275 Ga0395898_0062864
276 Ga0395898_0115679
277 Ga0395898_0500424
278 Ga0395901_0090721
279 Ga0395901_0274905
280 Ga0395901_0359884
281 Ga0395901_0586133
282 Ga0395901_0682111
283 Ga0466965_0066220
284 Ga0466963_0008703
285 Ga0466963_0036913
286 Ga0466963_0045732
287 Ga0466963_0052994
288 Ga0466963_0131862
289 Ga0466963_0525550
290 Ga0466963_0734980
291 Ga0466957_0015996
292 Ga0466957_0367889
293 Ga0466960_0096262
294 Ga0466960_0737313
295 Ga0466967_0018258
296 Ga0466967_0027664
297 Ga0466967_0028606
298 Ga0466967_0047476
299 Ga0466967_0057900
300 Ga0466967_0190807
301 Ga0466967_0224852
302 Ga0466967_0421206
303 Ga0466967_0433989
304 Ga0466967_0640629
305 Ga0466967_0695148
306 Ga0466967_0822838
307 Ga0466967_0946888
308 Ga0466967_1003658
309 Ga0466967_1781270
310 Ga0495650_0000054
311 Ga0495596_0190992
312 Ga0495663_0353220
313 Ga0495645_0000051
314 Ga0496100_0083583
315 Ga0496101_0021477
316 Ga0496101_0735370
317 Ga0496102_0067494
318 Ga0496102_1172793
319 Ga0496105_0101283
320 Ga0496106_0007104
321 Ga0496107_0076741
322 Ga0496107_1136708
323 Ga0496109_0626220
324 Ga0496110_1246485
325 Ga0496111_0073327
326 Ga0496111_0248362
327 Ga0496112_0019562
328 Ga0496114_1638172
329 Ga0496121_0034573
330 Ga0501031_0040151
331 Ga0501034_0004008
332 Ga0501036_0081835
333 Ga0501037_0235107
334 Ga0501039_0026423
335 Ga0501040_0024617
336 Ga0501040_0340090
337 Ga0501041_0021275
338 Ga0501041_0064899
339 Ga0501042_0081198
340 Ga0501042_0556978
341 Ga0501043_0385281
342 Ga0501048_0371788
343 Ga0501048_0522315
344 Ga0501067_0599854
345 Ga0501068_0301278
346 Ga0501069_0152647
347 Ga0501069_0356407
348 Ga0501071_0031269
349 Ga0501071_0031489
350 Ga0501072_0018235
351 Ga0501072_0811475
352 Ga0501074_0091391
353 Ga0501075_0114313
354 Ga0501075_0171338
355 Ga0501076_0010420
356 Ga0501079_0085690
357 Ga0501079_0111573
358 Ga0501081_0332330
359 Ga0501083_0189788
360 Ga0501044_0386413
361 Ga0501045_0071138
362 nmdc:mga09592_71552_c1
363 nmdc:mga08y16_1111935_c1
364 nmdc:mga08y16_234443_c2
365 Ga0495601_0370852
366 Ga0500616_0002823
367 Ga0501084_0032558
368 Ga0501082_0062865
369 Ga0501082_0209119
370 Ga0466962_0376663
371 Ga0530510_0007691
372 Ga0530510_0097813

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

dUTPase

43

176

0.96

PF22769

DCD

dCTP deaminase-like

40

148

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1six-assembly1.cif.gz_A mycobacterium tuberculosis dutpase complexed with magnesium and alpha,beta-imido-dutp 0.9695 9 133
3i93-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dutpase stop138t mutant 0.9664 8 133
3lqw-assembly1.cif.gz_A crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from entamoeba histolytica 0.9662 9 137
1sm8-assembly1.cif.gz_C m. tuberculosis dutpase complexed with chromium and dutp 0.9653 9 134
1slh-assembly1.cif.gz_B mycobacterium tuberculosis dutpase complexed with magnesium and dudp 0.9632 9 133
ID Description Score Start End Superfamily
1sjnC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9693 9 133 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9632 9 134 2.70.40.10
2p9oA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9529 9 136 2.70.40.10
2d4lA01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9353 22 123 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9344 9 134 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A3D4QSR2-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9839 9 128 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A2E9CZE5-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9801 10 121 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A661AFJ9-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9796 9 138 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A3N5L877-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9753 9 117 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A6I5CJI7-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9724 11 138 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Map