F286217

General Info

Members Datasets Scaffolds Average Seq Length
186 136 133 170

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10000482|Ga0265327_1000048213
Length 201
Sequence VSEALPIIDPHLPSPLYAKFPAPRMTDYRRNRVPGGTYFFTVNLADRRSDLLVRRIDVLRDAVRRARARAPFHIDAWIVLPEHMHCLWTLPDGDTDFSMRWQAIKTAFSRNVPPGEYRSASRIAKGERGVWQRRFWEHTIRDDRDYAQHMDYIHLNPIKHGLVASVGNWPYSSFHRCVAMGLYLPGWGGGAIEPDAAGEPW

Samples

Sample ID Description Type Environment
1 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
2 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
3 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
4 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
5 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
6 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
7 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
8 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
9 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
10 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
11 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
12 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
13 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
14 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
15 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
16 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
17 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
18 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
19 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
20 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
21 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
22 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
23 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
24 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
25 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
26 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
27 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
28 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
29 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
30 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
31 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
32 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
33 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
34 2636415599 Klebsiella variicola DX120E Isolate Unclassified
35 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
36 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
37 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
38 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
39 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
40 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
41 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
42 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
43 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
44 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
45 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
46 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
47 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
48 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
49 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
71 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
72 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
80 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
81 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
86 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
89 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
90 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
93 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
94 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
109 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
112 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
122 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
123 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
124 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
125 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
126 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
136 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.35
Metatranscriptomes 2.69
Isolates 27.96

Biome Distribution

Category Percentage (%)
Aerial Root 2.15
Bulb 0
Endosphere 1.61
Nodule 1.08
Rhizoplane 20.43
Rhizosphere 47.31
Stem 0
Stem Tuber 0
Unclassified 27.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000185 3300002773 Bacteria 41843
2 Ga0058692_1009220 3300003856 Bacteria 2500
3 Ga0070694_101202134 3300005444 Bacteria 635
4 Ga0070708_100209668 3300005445 Bacteria 1826
5 Ga0070681_10076149 3300005458 Bacteria 3314
6 Ga0070706_100091709 3300005467 Bacteria 2818
7 Ga0070706_100282024 3300005467 Bacteria 1550
8 Ga0070707_100004904 3300005468 Bacteria 12540
9 Ga0070698_100057037 3300005471 Bacteria 3953
10 Ga0070698_100376082 3300005471 Bacteria 1353
11 Ga0070699_100107963 3300005518 Bacteria 2442
12 Ga0070699_100418010 3300005518 Bacteria 1213
13 Ga0070697_100124247 3300005536 Bacteria 2161
14 Ga0068854_100423136 3300005578 Bacteria 1107
15 Ga0075430_100135898 3300006846 Bacteria 2049
16 Ga0079104_1001387 3300006946 Bacteria 16446
17 Ga0105251_10135041 3300009011 Bacteria 1117
18 Ga0105244_10000183 3300009036 Bacteria 63415
19 Ga0105244_10008971 3300009036 Bacteria 6188
20 Ga0105240_10662649 3300009093 Bacteria 1143
21 Ga0157370_10277256 3300013104 Bacteria 1549
22 Ga0157372_10010302 3300013307 Bacteria 9932
23 Ga0213872_10003889 3300021361 Bacteria 8105
24 Ga0213872_10041360 3300021361 Unclassified 2103
25 Ga0213872_10096660 3300021361 Bacteria 1319
26 Ga0213872_10192391 3300021361 Bacteria 877
27 Ga0213874_10131316 3300021377 Bacteria 860
28 Ga0213874_10272601 3300021377 Bacteria 630
29 Ga0213876_10000025 3300021384 Bacteria 236747
30 Ga0213875_10003351 3300021388 Bacteria 9140
31 Ga0213875_10021187 3300021388 Bacteria 3116
32 Ga0213875_10023550 3300021388 Bacteria 2940
33 Ga0213875_10182714 3300021388 Bacteria 985
34 Ga0207425_1048861 3300025245 Bacteria 779
35 Ga0209129_1000018 3300025258 Bacteria 469298
36 Ga0207655_1000370 3300025728 Bacteria 63426
37 Ga0207713_1109591 3300025735 Bacteria 941
38 Ga0207684_10022917 3300025910 Bacteria 5332
39 Ga0207684_11196608 3300025910 Bacteria 629
40 Ga0207695_10214537 3300025913 Bacteria 1834
41 Ga0207695_10596990 3300025913 Bacteria 985
42 Ga0207671_10612903 3300025914 Bacteria 867
43 Ga0207652_10260417 3300025921 Bacteria 1564
44 Ga0207646_10057479 3300025922 Bacteria 3475
45 Ga0209281_1004963 3300027111 Bacteria 3814
46 Ga0209371_1000041 3300027312 Bacteria 340377
47 Ga0209371_1000246 3300027312 Bacteria 67449
48 Ga0268256_1000003 3300030500 Bacteria 1289401
49 Ga0268256_1000225 3300030500 Bacteria 61749
50 Ga0265339_10304814 3300031249 Unclassified 759
51 Ga0265327_10000482 3300031251 Bacteria 70214
52 Ga0307408_100000260 3300031548 Bacteria 53792
53 Ga0316575_10318728 3300031665 Bacteria 659
54 Ga0316579_10190838 3300031691 Bacteria 990
55 Ga0265314_10325744 3300031711 Bacteria 853
56 Ga0316576_10080138 3300031727 Bacteria 2421
57 Ga0316578_10289747 3300031728 Bacteria 979
58 Ga0316578_10370899 3300031728 Bacteria 850
59 Ga0316577_10086317 3300031733 Bacteria 1756
60 Ga0316577_10239827 3300031733 Bacteria 1025
61 Ga0307414_10121599 3300032004 Bacteria 2008
62 Ga0316585_10039891 3300032137 Bacteria 1494
63 Ga0316580_10055804 3300032139 Bacteria 1214
64 Ga0316593_10023402 3300032168 Bacteria 1949
65 Ga0316592_1006019 3300033524 Bacteria 2323
66 Ga0316592_1054431 3300033524 Bacteria 895
67 Ga0316588_1114709 3300033528 Bacteria 679
68 Ga0316588_1157600 3300033528 Bacteria 584
69 Ga0316574_0097582 3300035398 Bacteria 1878
70 Ga0316574_0208691 3300035398 Bacteria 1253
71 Ga0316582_0268898 3300036647 Bacteria 1169
72 Ga0316582_0510278 3300036647 Bacteria 828
73 Ga0316584_0541696 3300036712 Bacteria 813
74 Ga0373925_0424878 3300037068 Bacteria 1086
75 Ga0395905_1029282 3300037471 Bacteria 727
76 Ga0436364_0662925 3300037853 Bacteria 818
77 Ga0436364_0743223 3300037853 Bacteria 10028
78 Ga0436364_0768236 3300037853 Bacteria 1296
79 Ga0436364_0837377 3300037853 Bacteria 7615
80 Ga0436364_0984333 3300037853 Bacteria 4589
81 Ga0436365_1279401 3300039437 Bacteria 294819
82 Ga0436360_0189679 3300039438 Unclassified 1046
83 Ga0436361_0347538 3300039447 Bacteria 884
84 Ga0436361_0393909 3300039447 Bacteria 1411
85 Ga0436361_0611678 3300039447 Bacteria 1445
86 Ga0436361_0618707 3300039447 Bacteria 1370
87 Ga0436361_0696796 3300039447 Unclassified 2344
88 Ga0436363_1156729 3300039450 Bacteria 865
89 Ga0436363_1339779 3300039450 Bacteria 724
90 Ga0436362_1170873 3300039453 Unclassified 884
91 Ga0439466_0017480 3300041411 Bacteria 2584
92 Ga0451789_0256936 3300041443 Bacteria 636
93 Ga0451807_0707343 3300041486 Bacteria 708
94 Ga0466986_0522452 3300044650 Bacteria 657
95 Ga0466981_0000016 3300044669 Bacteria 100013
96 Ga0453684_0001266 3300044712 Bacteria 75915
97 Ga0495591_001095 3300046458 Bacteria 18036
98 Ga0495638_0017233 3300046460 Bacteria 4822
99 Ga0495620_0001734 3300046515 Bacteria 12873
100 Ga0495649_0000794 3300046694 Bacteria 25459
101 Ga0495649_0001047 3300046694 Bacteria 21709
102 Ga0495679_001436 3300047446 Bacteria 13538
103 Ga0496104_0019264 3300048907 Bacteria 6241
104 Ga0496105_0550705 3300048908 Bacteria 900
105 Ga0496116_0053204 3300048919 Bacteria 2675
106 Ga0496116_0137437 3300048919 Bacteria 1381
107 Ga0496117_0008733 3300048920 Bacteria 9571
108 Ga0496117_0055810 3300048920 Bacteria 2756
109 Ga0496117_0057077 3300048920 Bacteria 2714
110 Ga0496117_0145669 3300048920 Bacteria 1410
111 Ga0496118_0007011 3300048921 Bacteria 12137
112 Ga0496118_0008044 3300048921 Bacteria 11010
113 Ga0496118_0163432 3300048921 Bacteria 1372
114 Ga0496118_0230720 3300048921 Bacteria 1068
115 Ga0496119_0000008 3300048922 Bacteria 446822
116 Ga0496119_0000352 3300048922 Bacteria 64461
117 Ga0496120_0000673 3300048923 Bacteria 50130
118 Ga0496120_0012569 3300048923 Bacteria 5753
119 Ga0496122_0040775 3300048925 Bacteria 3683
120 Ga0496122_0080369 3300048925 Bacteria 2273
121 Ga0496123_0010333 3300048926 Bacteria 8270
122 Ga0496123_0013208 3300048926 Bacteria 6961
123 Ga0496123_0121180 3300048926 Bacteria 1471
124 Ga0496124_0294030 3300048927 Bacteria 1177
125 Ga0496124_0497494 3300048927 Bacteria 818
126 Ga0496124_0529735 3300048927 Bacteria 782
127 Ga0496124_0676053 3300048927 Bacteria 658
128 Ga0496125_0111184 3300048928 Bacteria 1983
129 Ga0496126_0149171 3300048929 Bacteria 2005
130 Ga0501044_0426078 3300049823 Bacteria 1236
131 nmdc:mga0qj67_106476_c1 3300050509 Bacteria 2262
132 nmdc:mga0n895_307703_c1 3300050512 Bacteria 1606
133 nmdc:mga0a205_271622_c1 3300050515 Bacteria 1572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_1029282 Ga0395905_1029282_62_592 148
2 3300009036 Ga0105244_10000183 Ga0105244_1000018318 152
3 3300025728 Ga0207655_1000370 Ga0207655_100037018 152
4 3300021384 Ga0213876_10000025 Ga0213876_1000002587 155
5 3300036647 Ga0316582_0268898 Ga0316582_0268898_578_1084 155
6 3300039437 Ga0436365_1279401 Ga0436365_1279401_141307_141774 155
7 iso_pu_bacteria 3007252601 3007256620 156
8 iso_pu_bacteria 2919501602 2919504752 157
9 iso_pu_bacteria 2926063275 2926066429 157
10 iso_pu_bacteria 2554235132 2554818928 159
11 iso_pu_bacteria 2600255255 2601530470 159
12 iso_pu_bacteria 2600255280 2601616926 159
13 iso_pu_bacteria 2600255281 2601621727 159
14 iso_pu_bacteria 2600255287 2601644861 159
15 iso_pu_bacteria 2600255288 2601650549 159
16 iso_pu_bacteria 2600255289 2601655051 159
17 iso_pu_bacteria 2600255290 2601660282 159
18 iso_pu_bacteria 2600255291 2601665169 159
19 iso_pu_bacteria 2600255298 2601697784 159
20 iso_pu_bacteria 2600255299 2601703172 159
21 iso_pu_bacteria 2600255300 2601708129 159
22 iso_pu_bacteria 2600255301 2601713222 159
23 iso_pu_bacteria 2600255302 2601718610 159
24 iso_pu_bacteria 2600255303 2601723333 159
25 iso_pu_bacteria 2600255304 2601728157 159
26 iso_pu_bacteria 2600255305 2601733558 159
27 iso_pu_bacteria 2600255306 2601738141 159
28 iso_pu_bacteria 2600255307 2601742264 159
29 iso_pu_bacteria 2600255309 2601753478 159
30 iso_pu_bacteria 2600255392 2602020135 159
31 iso_pu_bacteria 2602042052 2603661965 159
32 iso_pu_bacteria 2602042053 2603666863 159
33 iso_pu_bacteria 2602042103 2603840671 159
34 iso_pu_bacteria 2602042104 2603845667 159
35 iso_pu_bacteria 2602042105 2603850740 159
36 iso_pu_bacteria 2602042106 2603855888 159
37 iso_pu_bacteria 2602042110 2603873469 159
38 iso_pu_bacteria 2602042111 2603877481 159
39 iso_pu_bacteria 2603880178 2606050569 159
40 iso_pu_bacteria 2603880184 2606071295 159
41 iso_pu_bacteria 2603880202 2606148253 159
42 iso_pu_bacteria 2603880211 2606178538 159
43 iso_pu_bacteria 2636415599 2637226853 159
44 iso_pu_bacteria 2675903046 2676406995 159
45 iso_pu_bacteria 2675903046 2676407850 159
46 iso_pu_bacteria 2904513164 2904513172 159
47 iso_pu_bacteria 2919108558 2919109967 159
48 iso_pu_bacteria 2939617950 2939619172 159
49 iso_pu_bacteria 2969079654 2969083837 159
50 iso_pu_bacteria 2974435778 2974438044 159
51 iso_pu_bacteria 2984559226 2984559984 159
52 iso_pu_bacteria 2984559226 2984560941 159
53 iso_pu_bacteria 2984595703 2984598063 159
54 iso_pu_bacteria 2984595703 2984599015 159
55 iso_pu_bacteria 2989392574 2989394738 159
56 iso_pu_bacteria 2990196909 2990200113 159
57 iso_pu_bacteria 640427133 640487010 159
58 iso_pu_bacteria 8019504834 8019506056 159
59 3300021361 Ga0213872_10041360 Ga0213872_100413603 160
60 3300021361 Ga0213872_10192391 Ga0213872_101923912 160
61 3300039447 Ga0436361_0611678 Ga0436361_0611678_636_1160 160
62 3300039447 Ga0436361_0696796 Ga0436361_0696796_1384_1911 160
63 3300021361 Ga0213872_10003889 Ga0213872_100038894 161
64 3300032004 Ga0307414_10121599 Ga0307414_101215993 161
65 3300032168 Ga0316593_10023402 Ga0316593_100234024 161
66 3300033524 Ga0316592_1054431 Ga0316592_10544311 161
67 3300033528 Ga0316588_1157600 Ga0316588_11576001 161
68 3300039447 Ga0436361_0618707 Ga0436361_0618707_638_1192 161
69 3300041411 Ga0439466_0017480 Ga0439466_0017480_2007_2537 161
70 3300041443 Ga0451789_0256936 Ga0451789_0256936_18_590 161
71 3300041486 Ga0451807_0707343 Ga0451807_0707343_23_553 161
72 3300009011 Ga0105251_10135041 Ga0105251_101350412 162
73 3300009093 Ga0105240_10662649 Ga0105240_106626492 162
74 3300025913 Ga0207695_10214537 Ga0207695_102145372 162
75 3300025914 Ga0207671_10612903 Ga0207671_106129031 162
76 3300031665 Ga0316575_10318728 Ga0316575_103187281 162
77 3300031691 Ga0316579_10190838 Ga0316579_101908381 162
78 3300031728 Ga0316578_10289747 Ga0316578_102897472 162
79 3300031733 Ga0316577_10086317 Ga0316577_100863171 162
80 3300032137 Ga0316585_10039891 Ga0316585_100398911 162
81 3300032139 Ga0316580_10055804 Ga0316580_100558041 162
82 3300033524 Ga0316592_1006019 Ga0316592_10060191 162
83 3300033528 Ga0316588_1114709 Ga0316588_11147091 162
84 3300035398 Ga0316574_0208691 Ga0316574_0208691_445_975 162
85 3300041411 Ga0439466_0017480 Ga0439466_0017480_136_669 162
86 3300048907 Ga0496104_0019264 Ga0496104_0019264_2940_3428 162
87 3300048920 Ga0496117_0008733 Ga0496117_0008733_7268_7756 162
88 3300048921 Ga0496118_0007011 Ga0496118_0007011_10103_10591 162
89 3300048922 Ga0496119_0000352 Ga0496119_0000352_14221_14709 162
90 3300048923 Ga0496120_0000673 Ga0496120_0000673_47917_48405 162
91 3300048926 Ga0496123_0121180 Ga0496123_0121180_417_905 162
92 3300049823 Ga0501044_0426078 Ga0501044_0426078_63_596 162
93 3300050512 nmdc:mga0n895_307703_c1 nmdc:mga0n895_307703_c1_63_605 162
94 3300050515 nmdc:mga0a205_271622_c1 nmdc:mga0a205_271622_c1_377_919 162
95 3300002773 JGI25152J39213_1000185 JGI25152J39213_100018531 163
96 3300003856 Ga0058692_1009220 Ga0058692_10092202 163
97 3300005444 Ga0070694_101202134 Ga0070694_1012021341 163
98 3300005445 Ga0070708_100209668 Ga0070708_1002096682 163
99 3300005458 Ga0070681_10076149 Ga0070681_100761492 163
100 3300005467 Ga0070706_100091709 Ga0070706_1000917093 163
101 3300005467 Ga0070706_100282024 Ga0070706_1002820242 163
102 3300005468 Ga0070707_100004904 Ga0070707_10000490415 163
103 3300005471 Ga0070698_100057037 Ga0070698_1000570372 163
104 3300005471 Ga0070698_100376082 Ga0070698_1003760823 163
105 3300005518 Ga0070699_100107963 Ga0070699_1001079632 163
106 3300005518 Ga0070699_100418010 Ga0070699_1004180101 163
107 3300005536 Ga0070697_100124247 Ga0070697_1001242473 163
108 3300005578 Ga0068854_100423136 Ga0068854_1004231361 163
109 3300006846 Ga0075430_100135898 Ga0075430_1001358982 163
110 3300006946 Ga0079104_1001387 Ga0079104_10013873 163
111 3300009036 Ga0105244_10008971 Ga0105244_100089711 163
112 3300013104 Ga0157370_10277256 Ga0157370_102772562 163
113 3300013307 Ga0157372_10010302 Ga0157372_100103027 163
114 3300021361 Ga0213872_10096660 Ga0213872_100966602 163
115 3300021377 Ga0213874_10131316 Ga0213874_101313161 163
116 3300021377 Ga0213874_10272601 Ga0213874_102726011 163
117 3300021388 Ga0213875_10003351 Ga0213875_100033515 163
118 3300021388 Ga0213875_10021187 Ga0213875_100211875 163
119 3300021388 Ga0213875_10023550 Ga0213875_100235503 163
120 3300021388 Ga0213875_10182714 Ga0213875_101827141 163
121 3300025245 Ga0207425_1048861 Ga0207425_10488611 163
122 3300025258 Ga0209129_1000018 Ga0209129_1000018335 163
123 3300025735 Ga0207713_1109591 Ga0207713_11095911 163
124 3300025910 Ga0207684_10022917 Ga0207684_100229175 163
125 3300025910 Ga0207684_11196608 Ga0207684_111966081 163
126 3300025913 Ga0207695_10596990 Ga0207695_105969902 163
127 3300025921 Ga0207652_10260417 Ga0207652_102604172 163
128 3300025922 Ga0207646_10057479 Ga0207646_100574792 163
129 3300027111 Ga0209281_1004963 Ga0209281_10049633 163
130 3300027312 Ga0209371_1000041 Ga0209371_100004135 163
131 3300027312 Ga0209371_1000246 Ga0209371_100024663 163
132 3300030500 Ga0268256_1000003 Ga0268256_1000003859 163
133 3300030500 Ga0268256_1000225 Ga0268256_10002254 163
134 3300031249 Ga0265339_10304814 Ga0265339_103048141 163
135 3300031251 Ga0265327_10000482 Ga0265327_1000048213 163
136 3300031548 Ga0307408_100000260 Ga0307408_1000002608 163
137 3300031711 Ga0265314_10325744 Ga0265314_103257442 163
138 3300031727 Ga0316576_10080138 Ga0316576_100801381 163
139 3300031728 Ga0316578_10370899 Ga0316578_103708991 163
140 3300031733 Ga0316577_10239827 Ga0316577_102398271 163
141 3300035398 Ga0316574_0097582 Ga0316574_0097582_220_756 163
142 3300036647 Ga0316582_0510278 Ga0316582_0510278_202_738 163
143 3300036712 Ga0316584_0541696 Ga0316584_0541696_241_777 163
144 3300037068 Ga0373925_0424878 Ga0373925_0424878_324_860 163
145 3300037853 Ga0436364_0662925 Ga0436364_0662925_78_611 163
146 3300037853 Ga0436364_0743223 Ga0436364_0743223_8260_8802 163
147 3300037853 Ga0436364_0768236 Ga0436364_0768236_195_746 163
148 3300037853 Ga0436364_0837377 Ga0436364_0837377_2259_2792 163
149 3300037853 Ga0436364_0984333 Ga0436364_0984333_210_755 163
150 3300039438 Ga0436360_0189679 Ga0436360_0189679_212_802 163
151 3300039447 Ga0436361_0347538 Ga0436361_0347538_164_697 163
152 3300039447 Ga0436361_0393909 Ga0436361_0393909_514_1080 163
153 3300039450 Ga0436363_1156729 Ga0436363_1156729_123_662 163
154 3300039450 Ga0436363_1339779 Ga0436363_1339779_124_669 163
155 3300039453 Ga0436362_1170873 Ga0436362_1170873_129_680 163
156 3300044650 Ga0466986_0522452 Ga0466986_0522452_79_570 163
157 3300044669 Ga0466981_0000016 Ga0466981_0000016_23515_24006 163
158 3300044712 Ga0453684_0001266 Ga0453684_0001266_9287_9829 163
159 3300046458 Ga0495591_001095 Ga0495591_001095_5235_5780 163
160 3300046460 Ga0495638_0017233 Ga0495638_0017233_4199_4744 163
161 3300046515 Ga0495620_0001734 Ga0495620_0001734_6853_7344 163
162 3300046694 Ga0495649_0000794 Ga0495649_0000794_4613_5104 163
163 3300046694 Ga0495649_0001047 Ga0495649_0001047_9206_9751 163
164 3300047446 Ga0495679_001436 Ga0495679_001436_9422_9913 163
165 3300048908 Ga0496105_0550705 Ga0496105_0550705_343_834 163
166 3300048919 Ga0496116_0053204 Ga0496116_0053204_1830_2321 163
167 3300048919 Ga0496116_0137437 Ga0496116_0137437_843_1334 163
168 3300048920 Ga0496117_0055810 Ga0496117_0055810_1114_1605 163
169 3300048920 Ga0496117_0057077 Ga0496117_0057077_1195_1686 163
170 3300048920 Ga0496117_0145669 Ga0496117_0145669_823_1314 163
171 3300048921 Ga0496118_0008044 Ga0496118_0008044_1650_2141 163
172 3300048921 Ga0496118_0163432 Ga0496118_0163432_59_550 163
173 3300048921 Ga0496118_0230720 Ga0496118_0230720_192_683 163
174 3300048922 Ga0496119_0000008 Ga0496119_0000008_428035_428526 163
175 3300048923 Ga0496120_0012569 Ga0496120_0012569_651_1142 163
176 3300048925 Ga0496122_0040775 Ga0496122_0040775_2365_2856 163
177 3300048925 Ga0496122_0080369 Ga0496122_0080369_385_876 163
178 3300048926 Ga0496123_0010333 Ga0496123_0010333_4099_4590 163
179 3300048926 Ga0496123_0013208 Ga0496123_0013208_3298_3789 163
180 3300048927 Ga0496124_0294030 Ga0496124_0294030_634_1167 163
181 3300048927 Ga0496124_0497494 Ga0496124_0497494_265_756 163
182 3300048927 Ga0496124_0529735 Ga0496124_0529735_229_720 163
183 3300048927 Ga0496124_0676053 Ga0496124_0676053_81_572 163
184 3300048928 Ga0496125_0111184 Ga0496125_0111184_14_505 163
185 3300048929 Ga0496126_0149171 Ga0496126_0149171_828_1319 163
186 3300050509 nmdc:mga0qj67_106476_c1 nmdc:mga0qj67_106476_c1_791_1327 163

Structural Annotation

Top 5 Hits

ID Description Score Start End
4er8-assembly1.cif.gz_A structure of the rep associates tyrosine transposase bound to a rep hairpin 0.9182 1 163
4er8-assembly1.cif.gz_A structure of the rep associates tyrosine transposase bound to a rep hairpin 0.9127 1 163
2j0x-assembly1.cif.gz_B crystal structure of e. coli aspartokinase iii in complex with lysine and aspartate (t-state) 0.69 12 103
2a6m-assembly2.cif.gz_A-2 crystal structure of the ishp608 transposase 0.6825 5 115
2fyx-assembly1.cif.gz_B crystal structure of a putative transposase (dr_0177) from deinococcus radiodurans r1 at 1.90 a resolution 0.6605 3 116
ID Description Score Start End Superfamily
4er8A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.9182 1 163 3.30.70.1290
4er8A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.9127 1 163 3.30.70.1290
2a6mB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.7212 12 122 3.30.70.1290
2vjvB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.6847 5 116 3.30.70.1290
2xm3E00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.6767 3 116 3.30.70.1290
ID Description Score Start End GO Terms
AF-A0A7W9Z850-F1-model_v4 REP element-mobilizing transposase RayT 0.9966 3 88 GO:0004803
GO:0006313
GO:0043565
AF-A0A318G2L4-F1-model_v4 REP element-mobilizing transposase RayT 0.9958 1 123 GO:0004803
GO:0006313
GO:0043565
AF-A0A2K4PD66-F1-model_v4 deleted 0.9921 1 149
AF-A0A444R7Z9-F1-model_v4 Transposase 0.9913 1 126 GO:0004803
GO:0006313
GO:0043565
AF-A0A450T0D2-F1-model_v4 REP element-mobilizing transposase RayT 0.9901 4 88 GO:0004803
GO:0006313
GO:0043565

Feature Viewer

pLDDT pTM Quality
91.38 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map