F284813

General Info

Members Datasets Scaffolds Average Seq Length
185 66 185 383

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0278236|Ga0453684_0278236_169_1374
Length 401
Sequence VEPEKFKGRSDNFIKKAAMFFNRQQLEEVEDKSLASYGMRSKDSKGRAYLDSEPDYRTSFQRDRDRILHTTAFRRLEYKTQVFINFEGDYFRTRLTHTLEVAQIGRTLARALGANEDLVETICLAHDLGHSPFGHSGEIALARLMKDYGGFDHNKQSLRIVTELEQRYPEFPGLNLTWEVREGMVKHESEYDISDARDYSPELRGNLETQIANVADELAYTTHDLDDGLRSAMINPPLLEGVALWEILRETYNWHGSILNDMERHRMIRHLVGLMVTDMLQATQIRIKDSKVITALDIQKLKHNIIGYSEEMQRRNRELKDLLYKKLYRHYRVVRMQVKAERIISDLFHAYRAEPAMLPDHVQFFIEKRGLERTICDYIAGMTDRYAIEEHQKLFNPFEKP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
20 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
24 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
25 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
26 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
27 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
28 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
29 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
30 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
31 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
32 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
33 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
34 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
35 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
36 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
37 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
38 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
39 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
40 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
41 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
42 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
43 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
44 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
45 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
46 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
47 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
48 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
49 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
50 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
51 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
52 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
53 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
54 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
55 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
56 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
57 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
58 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
59 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
60 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
61 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
62 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
63 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
64 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
65 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
66 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.54
Rhizosphere 97.84
Stem 0
Stem Tuber 0
Unclassified 1.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2342705 2162886007 Bacteria 1428
2 JGI25406J46586_10020454 3300003203 Bacteria 2677
3 Ga0065704_10081752 3300005289 Bacteria 3706
4 Ga0065707_10000447 3300005295 Bacteria 51333
5 Ga0065707_10002078 3300005295 Bacteria 5228
6 Ga0065707_10086350 3300005295 Bacteria 5506
7 Ga0065707_10087423 3300005295 Bacteria 5030
8 Ga0070689_100059408 3300005340 Bacteria 2972
9 Ga0070689_100174426 3300005340 Bacteria 1743
10 Ga0070673_100205016 3300005364 Bacteria 1700
11 Ga0070698_100021291 3300005471 Bacteria 6793
12 Ga0070698_100186927 3300005471 Bacteria 2009
13 Ga0070699_100010255 3300005518 Bacteria 8105
14 Ga0070699_100039179 3300005518 Bacteria 4103
15 Ga0070704_100151441 3300005549 Bacteria 1824
16 Ga0068859_100050230 3300005617 Bacteria 4189
17 Ga0068862_100011767 3300005844 Bacteria 7222
18 Ga0068862_100054588 3300005844 Bacteria 3421
19 Ga0081539_10006353 3300005985 Bacteria 11382
20 Ga0075428_100033034 3300006844 Bacteria 5714
21 Ga0075428_100093391 3300006844 Bacteria 3280
22 Ga0075430_100225375 3300006846 Bacteria 1555
23 Ga0075431_100009064 3300006847 Bacteria 9977
24 Ga0075431_100115611 3300006847 Bacteria 2770
25 Ga0075431_100152732 3300006847 Bacteria 2377
26 Ga0075429_100036410 3300006880 Bacteria 4280
27 Ga0075429_100047763 3300006880 Bacteria 3723
28 Ga0075429_100072916 3300006880 Bacteria 2990
29 Ga0075429_100261742 3300006880 Bacteria 1514
30 Ga0097620_100050232 3300006931 Bacteria 4189
31 Ga0114129_10004942 3300009147 Bacteria 18798
32 Ga0114129_10010295 3300009147 Bacteria 13342
33 Ga0114129_10027093 3300009147 Bacteria 8115
34 Ga0114129_10043330 3300009147 Bacteria 6331
35 Ga0114129_10052668 3300009147 Bacteria 5712
36 Ga0114129_10059522 3300009147 Bacteria 5340
37 Ga0114129_10098186 3300009147 Bacteria 4053
38 Ga0105249_10061391 3300009553 Bacteria 3449
39 Ga0207674_10103765 3300026116 Bacteria 2822
40 Ga0207675_100093129 3300026118 Bacteria 2834
41 Ga0268265_10149431 3300028380 Bacteria 1968
42 Ga0265334_10022730 3300028573 Unclassified 2553
43 Ga0265318_10002425 3300028577 Bacteria 9971
44 Ga0265322_10029497 3300028654 Bacteria 1567
45 Ga0265338_10041342 3300028800 Bacteria 4312
46 Ga0265324_10026919 3300029957 Bacteria 2034
47 Ga0265320_10016700 3300031240 Bacteria 4107
48 Ga0265340_10012046 3300031247 Bacteria 4573
49 Ga0265331_10025414 3300031250 Bacteria 2990
50 Ga0265327_10007339 3300031251 Bacteria 8539
51 Ga0265316_10000298 3300031344 Bacteria 55842
52 Ga0316575_10010812 3300031665 Bacteria 3365
53 Ga0316575_10011984 3300031665 Unclassified 3218
54 Ga0316575_10013859 3300031665 Bacteria 3018
55 Ga0316575_10017432 3300031665 Unclassified 2727
56 Ga0316579_10005404 3300031691 Bacteria 5153
57 Ga0316579_10009092 3300031691 Bacteria 4170
58 Ga0316579_10014637 3300031691 Bacteria 3397
59 Ga0316579_10017023 3300031691 Bacteria 3184
60 Ga0316576_10005193 3300031727 Bacteria 7914
61 Ga0316576_10031538 3300031727 Bacteria 3761
62 Ga0316576_10082087 3300031727 Unclassified 2393
63 Ga0316578_10001990 3300031728 Bacteria 8682
64 Ga0316578_10028979 3300031728 Bacteria 3139
65 Ga0316578_10071539 3300031728 Bacteria 2054
66 Ga0316578_10100118 3300031728 Bacteria 1737
67 Ga0316578_10104752 3300031728 Bacteria 1697
68 Ga0316577_10000417 3300031733 Bacteria 16458
69 Ga0316577_10001175 3300031733 Bacteria 12038
70 Ga0316577_10001740 3300031733 Bacteria 10467
71 Ga0316577_10004777 3300031733 Bacteria 7039
72 Ga0316577_10011581 3300031733 Bacteria 4779
73 Ga0316577_10016099 3300031733 Bacteria 4118
74 Ga0316577_10016116 3300031733 Bacteria 4115
75 Ga0316577_10022724 3300031733 Bacteria 3483
76 Ga0307413_10036115 3300031824 Unclassified 2842
77 Ga0307414_10138996 3300032004 Unclassified 1899
78 Ga0316574_0003566 3300035398 Bacteria 8043
79 Ga0316574_0006688 3300035398 Bacteria 6258
80 Ga0316574_0013514 3300035398 Bacteria 4697
81 Ga0316574_0100138 3300035398 Bacteria 1854
82 Ga0316582_0000588 3300036647 Bacteria 14064
83 Ga0316582_0000769 3300036647 Bacteria 12939
84 Ga0316582_0001214 3300036647 Bacteria 11069
85 Ga0316582_0011368 3300036647 Bacteria 4917
86 Ga0316582_0018490 3300036647 Bacteria 4058
87 Ga0316582_0023073 3300036647 Bacteria 3704
88 Ga0316582_0090968 3300036647 Bacteria 2008
89 Ga0316582_0091769 3300036647 Bacteria 2000
90 Ga0316582_0242014 3300036647 Bacteria 1236
91 Ga0316584_0008747 3300036712 Bacteria 6989
92 Ga0316584_0015362 3300036712 Bacteria 5475
93 Ga0316584_0018059 3300036712 Bacteria 5084
94 Ga0316584_0021832 3300036712 Bacteria 4658
95 Ga0316584_0024667 3300036712 Bacteria 4404
96 Ga0316584_0028790 3300036712 Bacteria 4099
97 Ga0316584_0033639 3300036712 Bacteria 3798
98 Ga0316584_0034308 3300036712 Bacteria 3762
99 Ga0316584_0067771 3300036712 Bacteria 2675
100 Ga0316584_0082498 3300036712 Bacteria 2408
101 Ga0316584_0185102 3300036712 Bacteria 1541
102 Ga0316584_0218261 3300036712 Bacteria 1402
103 Ga0316581_0005551 3300037588 Bacteria 3299
104 Ga0316581_0015578 3300037588 Bacteria 2174
105 Ga0316581_0019988 3300037588 Unclassified 1957
106 Ga0316581_0023204 3300037588 Bacteria 1834
107 Ga0400490_18621 3300038726 Bacteria 5028
108 Ga0400488_51721 3300038741 Bacteria 2357
109 Ga0400489_25342 3300039093 Bacteria 115424
110 Ga0451577_0004225 3300042876 Bacteria 15312
111 Ga0451577_0018908 3300042876 Bacteria 6343
112 Ga0451577_0061381 3300042876 Bacteria 3352
113 Ga0451577_0256893 3300042876 Bacteria 1582
114 Ga0451577_0260110 3300042876 Bacteria 1571
115 Ga0453683_0000540 3300044673 Bacteria 42176
116 Ga0453683_0010213 3300044673 Bacteria 6231
117 Ga0453683_0012205 3300044673 Bacteria 5636
118 Ga0453683_0024137 3300044673 Bacteria 3872
119 Ga0453683_0080951 3300044673 Bacteria 2034
120 Ga0453683_0096521 3300044673 Bacteria 1855
121 Ga0453684_0000003 3300044712 Bacteria 1481694
122 Ga0453684_0000021 3300044712 Bacteria 873490
123 Ga0453684_0000435 3300044712 Bacteria 170233
124 Ga0453684_0000827 3300044712 Bacteria 104649
125 Ga0453684_0000865 3300044712 Bacteria 101801
126 Ga0453684_0001153 3300044712 Bacteria 82518
127 Ga0453684_0001624 3300044712 Bacteria 61357
128 Ga0453684_0003064 3300044712 Bacteria 38716
129 Ga0453684_0003832 3300044712 Bacteria 33175
130 Ga0453684_0005781 3300044712 Bacteria 24125
131 Ga0453684_0008432 3300044712 Bacteria 18459
132 Ga0453684_0009527 3300044712 Bacteria 16975
133 Ga0453684_0010056 3300044712 Bacteria 16265
134 Ga0453684_0012968 3300044712 Bacteria 13636
135 Ga0453684_0022354 3300044712 Bacteria 9386
136 Ga0453684_0025401 3300044712 Bacteria 8603
137 Ga0453684_0025723 3300044712 Bacteria 8534
138 Ga0453684_0078136 3300044712 Bacteria 4143
139 Ga0453684_0102978 3300044712 Unclassified 3489
140 Ga0453684_0158395 3300044712 Bacteria 2681
141 Ga0453684_0185440 3300044712 Bacteria 2439
142 Ga0453684_0191911 3300044712 Bacteria 2389
143 Ga0453684_0221441 3300044712 Bacteria 2192
144 Ga0453684_0224894 3300044712 Bacteria 2171
145 Ga0453684_0258203 3300044712 Bacteria 1997
146 Ga0453684_0278236 3300044712 Bacteria 1910
147 Ga0453684_0291658 3300044712 Bacteria 1857
148 Ga0453684_0293740 3300044712 Bacteria 1849
149 Ga0453684_0305228 3300044712 Bacteria 1808
150 Ga0453684_0314491 3300044712 Bacteria 1775
151 Ga0451576_0000045 3300045051 Bacteria 334210
152 Ga0451576_0004418 3300045051 Bacteria 18289
153 Ga0451576_0012954 3300045051 Bacteria 9344
154 Ga0451576_0037711 3300045051 Bacteria 5118
155 Ga0451576_0099766 3300045051 Bacteria 3020
156 Ga0451576_0126644 3300045051 Unclassified 2661
157 Ga0451576_0217576 3300045051 Bacteria 1995
158 Ga0451576_0424424 3300045051 Bacteria 1395
159 Ga0496106_0333811 3300048909 Bacteria 1217
160 Ga0501042_0151423 3300049578 Bacteria 1673
161 Ga0501071_0080012 3300049587 Bacteria 2389
162 Ga0501073_0003329 3300049589 Bacteria 12078
163 Ga0501073_0051391 3300049589 Bacteria 2887
164 Ga0501074_0065776 3300049590 Bacteria 2609
165 Ga0501075_0022572 3300049591 Bacteria 4598
166 Ga0501075_0050288 3300049591 Bacteria 3133
167 Ga0501076_0088238 3300049592 Bacteria 2493
168 Ga0501076_0185053 3300049592 Bacteria 1698
169 Ga0501079_0008008 3300049741 Bacteria 8010
170 Ga0501080_0064704 3300049742 Bacteria 3401
171 Ga0501080_0242683 3300049742 Bacteria 1644
172 Ga0501081_0110673 3300049743 Bacteria 1949
173 Ga0501081_0135302 3300049743 Bacteria 1764
174 nmdc:mga05p37_116162_c1 3300050507 Bacteria 3289
175 nmdc:mga05p37_16659_c1 3300050507 Bacteria 8855
176 nmdc:mga05p37_280911_c1 3300050507 Bacteria 1986
177 nmdc:mga05p37_71928_c1 3300050507 Bacteria 4255
178 nmdc:mga09592_15727_c1 3300050508 Bacteria 6183
179 nmdc:mga09592_37256_c1 3300050508 Bacteria 4080
180 nmdc:mga09592_63756_c1 3300050508 Bacteria 3119
181 nmdc:mga0qj67_213686_c1 3300050509 Bacteria 1566
182 nmdc:mga06r32_4075_c1 3300050510 Bacteria 13096
183 Ga0501084_0011499 3300054114 Bacteria 7329
184 Ga0501084_0241397 3300054114 Bacteria 1525
185 Ga0501082_0183944 3300060353 Bacteria 1818

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10103765 Ga0207674_101037652 323
2 3300042876 Ga0451577_0260110 Ga0451577_0260110_499_1557 352
3 3300036647 Ga0316582_0011368 Ga0316582_0011368_1246_2319 354
4 3300036712 Ga0316584_0008747 Ga0316584_0008747_5294_6367 354
5 3300037588 Ga0316581_0015578 Ga0316581_0015578_576_1649 354
6 3300038726 Ga0400490_18621 Ga0400490_18621_1161_2258 355
7 3300031344 Ga0265316_10000298 Ga0265316_1000029821 356
8 3300049592 Ga0501076_0185053 Ga0501076_0185053_229_1377 365
9 3300049743 Ga0501081_0135302 Ga0501081_0135302_366_1514 365
10 3300037588 Ga0316581_0005551 Ga0316581_0005551_1752_2912 372
11 3300006847 Ga0075431_100009064 Ga0075431_1000090647 377
12 3300009147 Ga0114129_10052668 Ga0114129_100526684 377
13 3300050507 nmdc:mga05p37_71928_c1 nmdc:mga05p37_71928_c1_1225_2391 377
14 3300050510 nmdc:mga06r32_4075_c1 nmdc:mga06r32_4075_c1_4569_5735 377
15 3300036712 Ga0316584_0082498 Ga0316584_0082498_12_1157 378
16 3300031728 Ga0316578_10100118 Ga0316578_101001182 382
17 3300031733 Ga0316577_10011581 Ga0316577_100115814 382
18 3300031733 Ga0316577_10016099 Ga0316577_100160991 382
19 3300035398 Ga0316574_0013514 Ga0316574_0013514_3379_4527 382
20 3300036712 Ga0316584_0018059 Ga0316584_0018059_3709_4857 382
21 3300036712 Ga0316584_0067771 Ga0316584_0067771_1467_2615 382
22 3300038741 Ga0400488_51721 Ga0400488_51721_228_1376 382
23 3300042876 Ga0451577_0018908 Ga0451577_0018908_2192_3340 382
24 3300044712 Ga0453684_0000003 Ga0453684_0000003_1425960_1427108 382
25 3300044712 Ga0453684_0000865 Ga0453684_0000865_19320_20468 382
26 3300044712 Ga0453684_0008432 Ga0453684_0008432_2603_3751 382
27 3300044712 Ga0453684_0258203 Ga0453684_0258203_712_1860 382
28 2162886007 SwRhRL2b_contig_2342705 SwRhRL2b_0878.00004000 383
29 3300003203 JGI25406J46586_10020454 JGI25406J46586_100204542 383
30 3300005289 Ga0065704_10081752 Ga0065704_100817521 383
31 3300005295 Ga0065707_10000447 Ga0065707_1000044748 383
32 3300005295 Ga0065707_10002078 Ga0065707_100020783 383
33 3300005295 Ga0065707_10086350 Ga0065707_100863506 383
34 3300005295 Ga0065707_10087423 Ga0065707_100874236 383
35 3300005340 Ga0070689_100059408 Ga0070689_1000594084 383
36 3300005340 Ga0070689_100174426 Ga0070689_1001744262 383
37 3300005364 Ga0070673_100205016 Ga0070673_1002050162 383
38 3300005471 Ga0070698_100021291 Ga0070698_1000212916 383
39 3300005471 Ga0070698_100186927 Ga0070698_1001869272 383
40 3300005518 Ga0070699_100010255 Ga0070699_1000102553 383
41 3300005518 Ga0070699_100039179 Ga0070699_1000391794 383
42 3300005549 Ga0070704_100151441 Ga0070704_1001514411 383
43 3300005617 Ga0068859_100050230 Ga0068859_1000502305 383
44 3300005844 Ga0068862_100011767 Ga0068862_1000117677 383
45 3300005844 Ga0068862_100054588 Ga0068862_1000545882 383
46 3300005985 Ga0081539_10006353 Ga0081539_1000635310 383
47 3300006844 Ga0075428_100033034 Ga0075428_1000330346 383
48 3300006844 Ga0075428_100093391 Ga0075428_1000933912 383
49 3300006846 Ga0075430_100225375 Ga0075430_1002253753 383
50 3300006847 Ga0075431_100115611 Ga0075431_1001156113 383
51 3300006847 Ga0075431_100152732 Ga0075431_1001527322 383
52 3300006880 Ga0075429_100036410 Ga0075429_1000364103 383
53 3300006880 Ga0075429_100047763 Ga0075429_1000477631 383
54 3300006880 Ga0075429_100072916 Ga0075429_1000729164 383
55 3300006880 Ga0075429_100261742 Ga0075429_1002617422 383
56 3300006931 Ga0097620_100050232 Ga0097620_1000502325 383
57 3300009147 Ga0114129_10004942 Ga0114129_100049423 383
58 3300009147 Ga0114129_10010295 Ga0114129_100102953 383
59 3300009147 Ga0114129_10027093 Ga0114129_100270934 383
60 3300009147 Ga0114129_10043330 Ga0114129_100433303 383
61 3300009147 Ga0114129_10059522 Ga0114129_100595222 383
62 3300009147 Ga0114129_10098186 Ga0114129_100981864 383
63 3300009553 Ga0105249_10061391 Ga0105249_100613913 383
64 3300026118 Ga0207675_100093129 Ga0207675_1000931293 383
65 3300028380 Ga0268265_10149431 Ga0268265_101494312 383
66 3300028573 Ga0265334_10022730 Ga0265334_100227303 383
67 3300028577 Ga0265318_10002425 Ga0265318_100024253 383
68 3300028654 Ga0265322_10029497 Ga0265322_100294972 383
69 3300028800 Ga0265338_10041342 Ga0265338_100413424 383
70 3300029957 Ga0265324_10026919 Ga0265324_100269193 383
71 3300031240 Ga0265320_10016700 Ga0265320_100167003 383
72 3300031247 Ga0265340_10012046 Ga0265340_100120463 383
73 3300031250 Ga0265331_10025414 Ga0265331_100254142 383
74 3300031251 Ga0265327_10007339 Ga0265327_100073394 383
75 3300031665 Ga0316575_10010812 Ga0316575_100108122 383
76 3300031665 Ga0316575_10011984 Ga0316575_100119842 383
77 3300031665 Ga0316575_10013859 Ga0316575_100138593 383
78 3300031665 Ga0316575_10017432 Ga0316575_100174322 383
79 3300031691 Ga0316579_10005404 Ga0316579_100054043 383
80 3300031691 Ga0316579_10009092 Ga0316579_100090922 383
81 3300031691 Ga0316579_10014637 Ga0316579_100146372 383
82 3300031691 Ga0316579_10017023 Ga0316579_100170232 383
83 3300031727 Ga0316576_10005193 Ga0316576_100051937 383
84 3300031727 Ga0316576_10031538 Ga0316576_100315383 383
85 3300031727 Ga0316576_10082087 Ga0316576_100820872 383
86 3300031728 Ga0316578_10001990 Ga0316578_100019903 383
87 3300031728 Ga0316578_10028979 Ga0316578_100289793 383
88 3300031728 Ga0316578_10071539 Ga0316578_100715391 383
89 3300031728 Ga0316578_10104752 Ga0316578_101047522 383
90 3300031733 Ga0316577_10000417 Ga0316577_100004172 383
91 3300031733 Ga0316577_10001175 Ga0316577_100011757 383
92 3300031733 Ga0316577_10001740 Ga0316577_100017407 383
93 3300031733 Ga0316577_10004777 Ga0316577_100047772 383
94 3300031733 Ga0316577_10016116 Ga0316577_100161163 383
95 3300031733 Ga0316577_10022724 Ga0316577_100227242 383
96 3300031824 Ga0307413_10036115 Ga0307413_100361152 383
97 3300032004 Ga0307414_10138996 Ga0307414_101389961 383
98 3300035398 Ga0316574_0003566 Ga0316574_0003566_1659_2810 383
99 3300035398 Ga0316574_0006688 Ga0316574_0006688_2260_3411 383
100 3300035398 Ga0316574_0100138 Ga0316574_0100138_382_1533 383
101 3300036647 Ga0316582_0000588 Ga0316582_0000588_9764_10915 383
102 3300036647 Ga0316582_0000769 Ga0316582_0000769_303_1457 383
103 3300036647 Ga0316582_0001214 Ga0316582_0001214_2613_3773 383
104 3300036647 Ga0316582_0018490 Ga0316582_0018490_1209_2360 383
105 3300036647 Ga0316582_0023073 Ga0316582_0023073_1486_2637 383
106 3300036647 Ga0316582_0090968 Ga0316582_0090968_422_1612 383
107 3300036647 Ga0316582_0091769 Ga0316582_0091769_229_1389 383
108 3300036647 Ga0316582_0242014 Ga0316582_0242014_11_1186 383
109 3300036712 Ga0316584_0015362 Ga0316584_0015362_2706_3857 383
110 3300036712 Ga0316584_0021832 Ga0316584_0021832_1643_2803 383
111 3300036712 Ga0316584_0024667 Ga0316584_0024667_1851_3011 383
112 3300036712 Ga0316584_0028790 Ga0316584_0028790_734_1885 383
113 3300036712 Ga0316584_0033639 Ga0316584_0033639_2008_3168 383
114 3300036712 Ga0316584_0034308 Ga0316584_0034308_2442_3602 383
115 3300036712 Ga0316584_0185102 Ga0316584_0185102_200_1360 383
116 3300036712 Ga0316584_0218261 Ga0316584_0218261_138_1298 383
117 3300037588 Ga0316581_0019988 Ga0316581_0019988_343_1494 383
118 3300037588 Ga0316581_0023204 Ga0316581_0023204_464_1624 383
119 3300039093 Ga0400489_25342 Ga0400489_25342_80401_81552 383
120 3300042876 Ga0451577_0004225 Ga0451577_0004225_1753_2904 383
121 3300042876 Ga0451577_0061381 Ga0451577_0061381_1130_2281 383
122 3300042876 Ga0451577_0256893 Ga0451577_0256893_392_1543 383
123 3300044673 Ga0453683_0000540 Ga0453683_0000540_7489_8640 383
124 3300044673 Ga0453683_0010213 Ga0453683_0010213_1716_2867 383
125 3300044673 Ga0453683_0012205 Ga0453683_0012205_4178_5329 383
126 3300044673 Ga0453683_0024137 Ga0453683_0024137_2577_3728 383
127 3300044673 Ga0453683_0080951 Ga0453683_0080951_701_1852 383
128 3300044673 Ga0453683_0096521 Ga0453683_0096521_581_1732 383
129 3300044712 Ga0453684_0000021 Ga0453684_0000021_758206_759357 383
130 3300044712 Ga0453684_0000435 Ga0453684_0000435_159415_160566 383
131 3300044712 Ga0453684_0000827 Ga0453684_0000827_49148_50299 383
132 3300044712 Ga0453684_0001153 Ga0453684_0001153_7720_8871 383
133 3300044712 Ga0453684_0001624 Ga0453684_0001624_42364_43515 383
134 3300044712 Ga0453684_0003064 Ga0453684_0003064_31895_33046 383
135 3300044712 Ga0453684_0003832 Ga0453684_0003832_5590_6741 383
136 3300044712 Ga0453684_0005781 Ga0453684_0005781_4484_5635 383
137 3300044712 Ga0453684_0009527 Ga0453684_0009527_184_1335 383
138 3300044712 Ga0453684_0010056 Ga0453684_0010056_836_1990 383
139 3300044712 Ga0453684_0012968 Ga0453684_0012968_533_1684 383
140 3300044712 Ga0453684_0022354 Ga0453684_0022354_5323_6474 383
141 3300044712 Ga0453684_0025401 Ga0453684_0025401_1297_2448 383
142 3300044712 Ga0453684_0025723 Ga0453684_0025723_6486_7637 383
143 3300044712 Ga0453684_0078136 Ga0453684_0078136_805_1956 383
144 3300044712 Ga0453684_0102978 Ga0453684_0102978_1672_2823 383
145 3300044712 Ga0453684_0158395 Ga0453684_0158395_1312_2463 383
146 3300044712 Ga0453684_0185440 Ga0453684_0185440_728_1879 383
147 3300044712 Ga0453684_0191911 Ga0453684_0191911_1116_2267 383
148 3300044712 Ga0453684_0221441 Ga0453684_0221441_211_1362 383
149 3300044712 Ga0453684_0224894 Ga0453684_0224894_592_1755 383
150 3300044712 Ga0453684_0278236 Ga0453684_0278236_169_1374 383
151 3300044712 Ga0453684_0291658 Ga0453684_0291658_346_1506 383
152 3300044712 Ga0453684_0293740 Ga0453684_0293740_140_1300 383
153 3300044712 Ga0453684_0305228 Ga0453684_0305228_395_1546 383
154 3300044712 Ga0453684_0314491 Ga0453684_0314491_372_1523 383
155 3300045051 Ga0451576_0000045 Ga0451576_0000045_249811_250962 383
156 3300045051 Ga0451576_0004418 Ga0451576_0004418_3734_4885 383
157 3300045051 Ga0451576_0012954 Ga0451576_0012954_6605_7756 383
158 3300045051 Ga0451576_0037711 Ga0451576_0037711_2015_3166 383
159 3300045051 Ga0451576_0099766 Ga0451576_0099766_383_1534 383
160 3300045051 Ga0451576_0126644 Ga0451576_0126644_819_1970 383
161 3300045051 Ga0451576_0217576 Ga0451576_0217576_57_1208 383
162 3300045051 Ga0451576_0424424 Ga0451576_0424424_172_1323 383
163 3300048909 Ga0496106_0333811 Ga0496106_0333811_56_1207 383
164 3300049578 Ga0501042_0151423 Ga0501042_0151423_476_1627 383
165 3300049587 Ga0501071_0080012 Ga0501071_0080012_270_1421 383
166 3300049589 Ga0501073_0003329 Ga0501073_0003329_903_2057 383
167 3300049589 Ga0501073_0051391 Ga0501073_0051391_639_1793 383
168 3300049590 Ga0501074_0065776 Ga0501074_0065776_208_1359 383
169 3300049591 Ga0501075_0022572 Ga0501075_0022572_2100_3251 383
170 3300049591 Ga0501075_0050288 Ga0501075_0050288_1341_2492 383
171 3300049592 Ga0501076_0088238 Ga0501076_0088238_1048_2199 383
172 3300049741 Ga0501079_0008008 Ga0501079_0008008_4609_5760 383
173 3300049742 Ga0501080_0064704 Ga0501080_0064704_1845_2999 383
174 3300049742 Ga0501080_0242683 Ga0501080_0242683_38_1189 383
175 3300049743 Ga0501081_0110673 Ga0501081_0110673_269_1420 383
176 3300050507 nmdc:mga05p37_116162_c1 nmdc:mga05p37_116162_c1_1165_2316 383
177 3300050507 nmdc:mga05p37_16659_c1 nmdc:mga05p37_16659_c1_2668_3891 383
178 3300050507 nmdc:mga05p37_280911_c1 nmdc:mga05p37_280911_c1_636_1787 383
179 3300050508 nmdc:mga09592_15727_c1 nmdc:mga09592_15727_c1_3376_4527 383
180 3300050508 nmdc:mga09592_37256_c1 nmdc:mga09592_37256_c1_1596_2747 383
181 3300050508 nmdc:mga09592_63756_c1 nmdc:mga09592_63756_c1_1195_2346 383
182 3300050509 nmdc:mga0qj67_213686_c1 nmdc:mga0qj67_213686_c1_324_1502 383
183 3300054114 Ga0501084_0011499 Ga0501084_0011499_6112_7266 383
184 3300054114 Ga0501084_0241397 Ga0501084_0241397_131_1282 383
185 3300060353 Ga0501082_0183944 Ga0501082_0183944_41_1192 383

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13286

HD_assoc

Phosphohydrolase-associated domain

306

393

0.96

PF01966

HD

HD domain

94

221

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dqb-assembly1.cif.gz_A crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.9734 1 376
2dqb-assembly1.cif.gz_E crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.9712 1 376
2dqb-assembly1.cif.gz_C crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.9703 1 376
2dqb-assembly1.cif.gz_F crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.9697 1 376
2dqb-assembly1.cif.gz_D crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.967 1 376
ID Description Score Start End Superfamily
2dqbE00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9708 3 376 1.10.3210.10
2dqbE00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9601 3 376 1.10.3210.10
af_P9WNY7_7_418_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7992 30 371 1.10.3210.10
af_P9WNY7_7_418_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7175 30 371 1.10.3210.10
af_Q2FZ08_320_474_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7096 54 201 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A3N5UFG7-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase 0.9906 182 383 GO:0016787
AF-A0A3D4JAL7-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase 0.9892 149 383 GO:0016787
AF-A0A3B9A7F4-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase 0.9867 56 383 GO:0006203
GO:0008832
AF-A0A3N5UFG7-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase 0.9857 182 383 GO:0016787
AF-A0A3D4JAL7-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase 0.985 149 383 GO:0016787

Feature Viewer

pLDDT pTM Quality
90.2 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map