F284748

General Info

Members Datasets Scaffolds Average Seq Length
185 113 185 112

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_2325378|Ga0451853_2325378_48_419
Length 123
Sequence MSAAEATEETVDEERCSWCGAAIELDDGFRIYEPAGARRAAFCRLEHVVPWAIQGAHWEPGTIIDPGDPDDGLGRCAHCGGDLGDRRVLLVRHRGEHRIADAFCGVDHLLAWAKAGGRWQTSR

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
3 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
4 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
5 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
6 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
7 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
52 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
53 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
54 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
55 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
56 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
57 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
58 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
59 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
62 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
63 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
64 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
65 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
66 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
67 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
68 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
69 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
70 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
71 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
72 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
73 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
74 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
75 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
76 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
84 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
85 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
86 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
87 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
88 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
89 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
90 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
91 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
94 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
97 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
98 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
99 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
100 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
103 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
108 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
110 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
111 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
112 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
113 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0
Rhizoplane 2.7
Rhizosphere 92.97
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100128385 3300005338 Bacteria 2073
2 Ga0070669_100471952 3300005353 Bacteria 1037
3 Ga0070701_11170636 3300005438 Bacteria 544
4 Ga0070700_100872486 3300005441 Bacteria 730
5 Ga0070684_100335093 3300005535 Bacteria 1390
6 Ga0070686_100008141 3300005544 Bacteria 5864
7 Ga0070704_101798699 3300005549 Bacteria 567
8 Ga0068856_100098893 3300005614 Bacteria 2908
9 Ga0068862_101362251 3300005844 Bacteria 712
10 Ga0081455_10054796 3300005937 Bacteria 3396
11 Ga0081538_10006014 3300005981 Bacteria 10787
12 Ga0081538_10012562 3300005981 Bacteria 6781
13 Ga0081538_10014211 3300005981 Bacteria 6250
14 Ga0081538_10045733 3300005981 Bacteria 2709
15 Ga0081538_10045755 3300005981 Bacteria 2708
16 Ga0081538_10270284 3300005981 Bacteria 637
17 Ga0075365_10008402 3300006038 Bacteria 5858
18 Ga0075364_10182580 3300006051 Bacteria 1420
19 Ga0075428_100059768 3300006844 Bacteria 4173
20 Ga0075428_100615061 3300006844 Bacteria 1160
21 Ga0075428_101023032 3300006844 Bacteria 874
22 Ga0075430_100014607 3300006846 Bacteria 6689
23 Ga0075430_100657739 3300006846 Bacteria 864
24 Ga0075430_100729769 3300006846 Bacteria 817
25 Ga0075431_100006735 3300006847 Bacteria 11410
26 Ga0075431_100105113 3300006847 Bacteria 2914
27 Ga0075433_11657169 3300006852 Bacteria 551
28 Ga0075434_100038871 3300006871 Bacteria 4715
29 Ga0075429_100825252 3300006880 Bacteria 812
30 Ga0075435_100447483 3300007076 Bacteria 1114
31 Ga0111539_10226120 3300009094 Bacteria 2179
32 Ga0111539_10244422 3300009094 Bacteria 2089
33 Ga0111539_11492259 3300009094 Bacteria 784
34 Ga0114129_10046061 3300009147 Bacteria 6130
35 Ga0114129_10356671 3300009147 Bacteria 1936
36 Ga0114129_10400867 3300009147 Bacteria 1808
37 Ga0114129_11060987 3300009147 Bacteria 1017
38 Ga0105243_11936805 3300009148 Bacteria 623
39 Ga0105242_13153944 3300009176 Bacteria 511
40 Ga0105248_10796265 3300009177 Bacteria 1067
41 Ga0105249_10404683 3300009553 Bacteria 1396
42 Ga0105249_10695695 3300009553 Bacteria 1076
43 Ga0105249_10887693 3300009553 Bacteria 958
44 Ga0105249_11674331 3300009553 Bacteria 709
45 Ga0105239_10544007 3300010375 Bacteria 1322
46 Ga0157369_10679661 3300013105 Unclassified 1061
47 Ga0157372_11039870 3300013307 Bacteria 948
48 Ga0157380_12276860 3300014326 Bacteria 606
49 Ga0157379_12005626 3300014968 Bacteria 572
50 Ga0207705_10551347 3300025909 Bacteria 896
51 Ga0207652_10764151 3300025921 Bacteria 860
52 Ga0207646_10835623 3300025922 Bacteria 819
53 Ga0207681_10440953 3300025923 Bacteria 1058
54 Ga0207687_11453792 3300025927 Bacteria 589
55 Ga0207690_10749987 3300025932 Bacteria 805
56 Ga0207661_10322268 3300025944 Bacteria 1389
57 Ga0207661_10352390 3300025944 Bacteria 1328
58 Ga0207677_10083113 3300026023 Bacteria 2304
59 Ga0207708_10147169 3300026075 Bacteria 1852
60 Ga0207675_101480971 3300026118 Bacteria 699
61 Ga0207675_101716039 3300026118 Bacteria 648
62 Ga0268265_10734657 3300028380 Bacteria 957
63 Ga0268265_11935225 3300028380 Unclassified 597
64 Ga0307405_11553613 3300031731 Bacteria 583
65 Ga0307410_10849360 3300031852 Bacteria 779
66 Ga0307412_11981214 3300031911 Bacteria 539
67 Ga0307409_100064540 3300031995 Bacteria 2877
68 Ga0307416_100089971 3300032002 Bacteria 2630
69 Ga0373943_0944152 3300035170 Bacteria 516
70 Ga0395900_0960720 3300037418 Bacteria 776
71 Ga0395901_0906822 3300038443 Bacteria 863
72 Ga0242420_085175 3300038996 Bacteria 657
73 Ga0436363_1636449 3300039450 Bacteria 671
74 Ga0451793_0067291 3300041452 Bacteria 980
75 Ga0451853_2325378 3300041512 Bacteria 529
76 Ga0439463_098168 3300042016 Bacteria 755
77 Ga0439444_0026874 3300042437 Bacteria 1056
78 Ga0439464_0058780 3300042439 Bacteria 1123
79 Ga0439440_0208795 3300042993 Bacteria 582
80 Ga0466964_0395328 3300044706 Bacteria 721
81 Ga0466967_0058375 3300045976 Bacteria 3411
82 Ga0466967_0445650 3300045976 Bacteria 1265
83 Ga0466967_0597527 3300045976 Bacteria 1089
84 Ga0466967_0825124 3300045976 Bacteria 921
85 Ga0466967_2244653 3300045976 Bacteria 542
86 Ga0495603_0444036 3300046455 Bacteria 743
87 Ga0495641_0051423 3300046461 Bacteria 1881
88 Ga0495582_0184934 3300046473 Bacteria 1188
89 Ga0495594_0385337 3300046499 Bacteria 798
90 Ga0495583_0115279 3300046506 Bacteria 1136
91 Ga0495630_0438191 3300046517 Bacteria 1001
92 Ga0495647_0515083 3300046681 Bacteria 557
93 Ga0495658_0206902 3300046683 Bacteria 1225
94 Ga0495613_0217000 3300046689 Bacteria 1344
95 Ga0495581_0062199 3300047315 Bacteria 2157
96 Ga0495676_0027172 3300047321 Bacteria 4912
97 Ga0495676_0193407 3300047321 Bacteria 1418
98 Ga0496106_0007762 3300048909 Bacteria 7937
99 Ga0496110_0211679 3300048913 Bacteria 1762
100 Ga0496111_0088116 3300048914 Bacteria 2272
101 Ga0496112_0986801 3300048915 Bacteria 762
102 Ga0501036_0140439 3300049572 Unclassified 2038
103 Ga0501036_0469765 3300049572 Unclassified 1047
104 Ga0501038_0633005 3300049574 Unclassified 807
105 Ga0501038_0672220 3300049574 Bacteria 778
106 Ga0501038_0733417 3300049574 Bacteria 738
107 Ga0501039_0324365 3300049575 Unclassified 1210
108 Ga0501039_0770910 3300049575 Unclassified 751
109 Ga0501040_0027065 3300049576 Bacteria 3859
110 Ga0501040_0151685 3300049576 Bacteria 1635
111 Ga0501041_0259408 3300049577 Bacteria 1093
112 Ga0501042_0071944 3300049578 Bacteria 2474
113 Ga0501042_1448767 3300049578 Unclassified 501
114 Ga0501046_0260623 3300049580 Unclassified 1274
115 Ga0501046_0651155 3300049580 Unclassified 745
116 Ga0501046_0858972 3300049580 Bacteria 634
117 Ga0501067_0525192 3300049583 Bacteria 662
118 Ga0501067_0850146 3300049583 Bacteria 514
119 Ga0501069_0918672 3300049585 Unclassified 533
120 Ga0501071_0041233 3300049587 Bacteria 3306
121 Ga0501071_0228365 3300049587 Unclassified 1402
122 Ga0501071_1216888 3300049587 Bacteria 582
123 Ga0501072_0088038 3300049588 Unclassified 2464
124 Ga0501072_0095604 3300049588 Unclassified 2361
125 Ga0501072_0230441 3300049588 Bacteria 1476
126 Ga0501072_1341142 3300049588 Bacteria 554
127 Ga0501074_0259249 3300049590 Unclassified 1236
128 Ga0501074_0400596 3300049590 Bacteria 973
129 Ga0501074_0646934 3300049590 Bacteria 747
130 Ga0501075_0261399 3300049591 Unclassified 1319
131 Ga0501075_0505747 3300049591 Bacteria 922
132 Ga0501076_0040516 3300049592 Bacteria 3662
133 Ga0501076_0076708 3300049592 Bacteria 2681
134 Ga0501076_0077184 3300049592 Bacteria 2672
135 Ga0501076_1549531 3300049592 Bacteria 544
136 Ga0501077_0242162 3300049593 Bacteria 1147
137 Ga0501077_0447500 3300049593 Bacteria 827
138 Ga0501079_0067277 3300049741 Bacteria 2765
139 Ga0501079_0108062 3300049741 Unclassified 2160
140 Ga0501079_0129766 3300049741 Unclassified 1961
141 Ga0501080_0366882 3300049742 Bacteria 1299
142 Ga0501081_0011234 3300049743 Bacteria 5857
143 Ga0501081_0280338 3300049743 Unclassified 1220
144 Ga0501081_0369756 3300049743 Bacteria 1058
145 Ga0501081_0541194 3300049743 Bacteria 870
146 Ga0501081_1367417 3300049743 Bacteria 537
147 Ga0501083_0787643 3300049744 Bacteria 619
148 Ga0501035_0312040 3300049822 Unclassified 1323
149 Ga0501045_0039834 3300049824 Bacteria 3419
150 Ga0501045_1195231 3300049824 Unclassified 555
151 nmdc:mga03n38_390573_c1 3300050490 Unclassified 764
152 nmdc:mga00v17_162912_c1 3300050491 Bacteria 1436
153 nmdc:mga0yw44_613608_c1 3300050492 Unclassified 739
154 nmdc:mga06z11_213421_c1 3300050494 Bacteria 1125
155 nmdc:mga05p37_1245758_c1 3300050507 Bacteria 764
156 nmdc:mga05p37_157128_c1 3300050507 Bacteria 2778
157 nmdc:mga05p37_284578_c1 3300050507 Bacteria 1970
158 nmdc:mga05p37_353592_c1 3300050507 Bacteria 1729
159 nmdc:mga09592_751895_c1 3300050508 Bacteria 827
160 nmdc:mga0qj67_606563_c1 3300050509 Bacteria 875
161 nmdc:mga0qj67_89011_c1 3300050509 Bacteria 2479
162 nmdc:mga0qj67_937214_c1 3300050509 Bacteria 681
163 nmdc:mga06r32_396724_c1 3300050510 Bacteria 1362
164 nmdc:mga08y16_1422368_c1 3300050511 Bacteria 656
165 nmdc:mga08y16_305714_c1 3300050511 Bacteria 1638
166 nmdc:mga0n895_592470_c1 3300050512 Bacteria 1112
167 nmdc:mga0rr50_124749_c1 3300050513 Bacteria 2054
168 nmdc:mga0rr50_357414_c1 3300050513 Bacteria 1229
169 nmdc:mga08x19_974110_c1 3300050514 Bacteria 602
170 nmdc:mga0a205_71341_c1 3300050515 Bacteria 3355
171 Ga0501084_0156330 3300054114 Bacteria 1923
172 Ga0501084_0357906 3300054114 Bacteria 1233
173 Ga0501084_0519509 3300054114 Bacteria 1007
174 Ga0501084_0727700 3300054114 Bacteria 836
175 Ga0501084_0768679 3300054114 Bacteria 812
176 Ga0501082_0062691 3300060353 Bacteria 3201
177 Ga0501082_0275859 3300060353 Bacteria 1464
178 Ga0501082_0369436 3300060353 Unclassified 1251
179 Ga0501082_1016089 3300060353 Unclassified 725
180 Ga0501082_1237235 3300060353 Archaea 652
181 Ga0466962_0578420 3300061719 Bacteria 572
182 Ga0530510_0022250 3300061734 Bacteria 4515
183 Ga0530510_0117102 3300061734 Bacteria 1954
184 Ga0530510_0326930 3300061734 Unclassified 1150
185 Ga0530510_1047884 3300061734 Unclassified 624

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_101716039 Ga0207675_1017160392 98
2 3300050514 nmdc:mga08x19_974110_c1 nmdc:mga08x19_974110_c1_151_450 99
3 3300014968 Ga0157379_12005626 Ga0157379_120056262 100
4 3300044706 Ga0466964_0395328 Ga0466964_0395328_305_607 100
5 3300025932 Ga0207690_10749987 Ga0207690_107499872 102
6 3300049574 Ga0501038_0633005 Ga0501038_0633005_17_349 102
7 3300005981 Ga0081538_10014211 Ga0081538_100142116 103
8 3300005981 Ga0081538_10045733 Ga0081538_100457332 104
9 3300031731 Ga0307405_11553613 Ga0307405_115536132 104
10 3300005353 Ga0070669_100471952 Ga0070669_1004719522 105
11 3300005438 Ga0070701_11170636 Ga0070701_111706362 105
12 3300005441 Ga0070700_100872486 Ga0070700_1008724862 105
13 3300005549 Ga0070704_101798699 Ga0070704_1017986992 105
14 3300005844 Ga0068862_101362251 Ga0068862_1013622511 105
15 3300006846 Ga0075430_100729769 Ga0075430_1007297692 105
16 3300009094 Ga0111539_11492259 Ga0111539_114922592 105
17 3300009148 Ga0105243_11936805 Ga0105243_119368052 105
18 3300009176 Ga0105242_13153944 Ga0105242_131539441 105
19 3300009553 Ga0105249_11674331 Ga0105249_116743312 105
20 3300013307 Ga0157372_11039870 Ga0157372_110398702 105
21 3300025921 Ga0207652_10764151 Ga0207652_107641512 105
22 3300025923 Ga0207681_10440953 Ga0207681_104409532 105
23 3300026075 Ga0207708_10147169 Ga0207708_101471693 105
24 3300026118 Ga0207675_101480971 Ga0207675_1014809712 105
25 3300028380 Ga0268265_10734657 Ga0268265_107346572 105
26 3300039450 Ga0436363_1636449 Ga0436363_1636449_73_405 105
27 3300045976 Ga0466967_0058375 Ga0466967_0058375_864_1196 105
28 3300045976 Ga0466967_2244653 Ga0466967_2244653_103_435 105
29 3300047321 Ga0495676_0193407 Ga0495676_0193407_973_1305 105
30 3300049577 Ga0501041_0259408 Ga0501041_0259408_510_842 105
31 3300049583 Ga0501067_0850146 Ga0501067_0850146_71_403 105
32 3300049743 Ga0501081_1367417 Ga0501081_1367417_23_355 105
33 3300050509 nmdc:mga0qj67_937214_c1 nmdc:mga0qj67_937214_c1_162_494 105
34 3300050511 nmdc:mga08y16_1422368_c1 nmdc:mga08y16_1422368_c1_101_433 105
35 3300061719 Ga0466962_0578420 Ga0466962_0578420_71_403 105
36 3300005535 Ga0070684_100335093 Ga0070684_1003350934 107
37 3300005544 Ga0070686_100008141 Ga0070686_1000081417 107
38 3300005937 Ga0081455_10054796 Ga0081455_100547962 107
39 3300005981 Ga0081538_10006014 Ga0081538_1000601410 107
40 3300005981 Ga0081538_10012562 Ga0081538_1001256210 107
41 3300005981 Ga0081538_10045755 Ga0081538_100457554 107
42 3300005981 Ga0081538_10270284 Ga0081538_102702842 107
43 3300006038 Ga0075365_10008402 Ga0075365_100084026 107
44 3300006051 Ga0075364_10182580 Ga0075364_101825802 107
45 3300006844 Ga0075428_100059768 Ga0075428_1000597682 107
46 3300006844 Ga0075428_100615061 Ga0075428_1006150612 107
47 3300006844 Ga0075428_101023032 Ga0075428_1010230322 107
48 3300006846 Ga0075430_100014607 Ga0075430_1000146073 107
49 3300006846 Ga0075430_100657739 Ga0075430_1006577391 107
50 3300006847 Ga0075431_100006735 Ga0075431_10000673511 107
51 3300006847 Ga0075431_100105113 Ga0075431_1001051134 107
52 3300006852 Ga0075433_11657169 Ga0075433_116571692 107
53 3300006871 Ga0075434_100038871 Ga0075434_1000388712 107
54 3300006880 Ga0075429_100825252 Ga0075429_1008252522 107
55 3300007076 Ga0075435_100447483 Ga0075435_1004474832 107
56 3300009094 Ga0111539_10226120 Ga0111539_102261202 107
57 3300009094 Ga0111539_10244422 Ga0111539_102444222 107
58 3300009147 Ga0114129_10046061 Ga0114129_100460612 107
59 3300009147 Ga0114129_10356671 Ga0114129_103566712 107
60 3300009147 Ga0114129_10400867 Ga0114129_104008672 107
61 3300009147 Ga0114129_11060987 Ga0114129_110609872 107
62 3300009177 Ga0105248_10796265 Ga0105248_107962652 107
63 3300009553 Ga0105249_10404683 Ga0105249_104046831 107
64 3300009553 Ga0105249_10695695 Ga0105249_106956952 107
65 3300009553 Ga0105249_10887693 Ga0105249_108876931 107
66 3300010375 Ga0105239_10544007 Ga0105239_105440072 107
67 3300013105 Ga0157369_10679661 Ga0157369_106796611 107
68 3300014326 Ga0157380_12276860 Ga0157380_122768602 107
69 3300025909 Ga0207705_10551347 Ga0207705_105513472 107
70 3300025922 Ga0207646_10835623 Ga0207646_108356232 107
71 3300025944 Ga0207661_10322268 Ga0207661_103222681 107
72 3300025944 Ga0207661_10352390 Ga0207661_103523901 107
73 3300031852 Ga0307410_10849360 Ga0307410_108493602 107
74 3300031911 Ga0307412_11981214 Ga0307412_119812141 107
75 3300031995 Ga0307409_100064540 Ga0307409_1000645403 107
76 3300032002 Ga0307416_100089971 Ga0307416_1000899712 107
77 3300037418 Ga0395900_0960720 Ga0395900_0960720_323_661 107
78 3300038443 Ga0395901_0906822 Ga0395901_0906822_278_610 107
79 3300038996 Ga0242420_085175 Ga0242420_085175_135_482 107
80 3300041452 Ga0451793_0067291 Ga0451793_0067291_154_486 107
81 3300042016 Ga0439463_098168 Ga0439463_098168_146_487 107
82 3300042437 Ga0439444_0026874 Ga0439444_0026874_63_404 107
83 3300042439 Ga0439464_0058780 Ga0439464_0058780_744_1085 107
84 3300042993 Ga0439440_0208795 Ga0439440_0208795_44_385 107
85 3300045976 Ga0466967_0597527 Ga0466967_0597527_309_644 107
86 3300045976 Ga0466967_0825124 Ga0466967_0825124_314_646 107
87 3300046455 Ga0495603_0444036 Ga0495603_0444036_199_531 107
88 3300046461 Ga0495641_0051423 Ga0495641_0051423_713_1045 107
89 3300046473 Ga0495582_0184934 Ga0495582_0184934_244_576 107
90 3300046499 Ga0495594_0385337 Ga0495594_0385337_400_732 107
91 3300046506 Ga0495583_0115279 Ga0495583_0115279_591_923 107
92 3300046517 Ga0495630_0438191 Ga0495630_0438191_24_356 107
93 3300046681 Ga0495647_0515083 Ga0495647_0515083_36_368 107
94 3300046683 Ga0495658_0206902 Ga0495658_0206902_724_1056 107
95 3300046689 Ga0495613_0217000 Ga0495613_0217000_64_396 107
96 3300047315 Ga0495581_0062199 Ga0495581_0062199_1400_1732 107
97 3300047321 Ga0495676_0027172 Ga0495676_0027172_1045_1377 107
98 3300048909 Ga0496106_0007762 Ga0496106_0007762_1821_2153 107
99 3300048913 Ga0496110_0211679 Ga0496110_0211679_17_349 107
100 3300048914 Ga0496111_0088116 Ga0496111_0088116_352_684 107
101 3300048915 Ga0496112_0986801 Ga0496112_0986801_183_515 107
102 3300049572 Ga0501036_0140439 Ga0501036_0140439_61_408 107
103 3300049572 Ga0501036_0469765 Ga0501036_0469765_11_352 107
104 3300049574 Ga0501038_0733417 Ga0501038_0733417_262_603 107
105 3300049575 Ga0501039_0324365 Ga0501039_0324365_531_878 107
106 3300049575 Ga0501039_0770910 Ga0501039_0770910_324_665 107
107 3300049576 Ga0501040_0027065 Ga0501040_0027065_2763_3110 107
108 3300049576 Ga0501040_0151685 Ga0501040_0151685_44_385 107
109 3300049578 Ga0501042_0071944 Ga0501042_0071944_151_498 107
110 3300049578 Ga0501042_1448767 Ga0501042_1448767_155_484 107
111 3300049580 Ga0501046_0260623 Ga0501046_0260623_462_809 107
112 3300049580 Ga0501046_0651155 Ga0501046_0651155_282_629 107
113 3300049580 Ga0501046_0858972 Ga0501046_0858972_69_416 107
114 3300049583 Ga0501067_0525192 Ga0501067_0525192_62_409 107
115 3300049585 Ga0501069_0918672 Ga0501069_0918672_136_483 107
116 3300049587 Ga0501071_0041233 Ga0501071_0041233_319_666 107
117 3300049587 Ga0501071_0228365 Ga0501071_0228365_1005_1334 107
118 3300049587 Ga0501071_1216888 Ga0501071_1216888_182_523 107
119 3300049588 Ga0501072_0088038 Ga0501072_0088038_967_1314 107
120 3300049588 Ga0501072_0095604 Ga0501072_0095604_434_781 107
121 3300049588 Ga0501072_0230441 Ga0501072_0230441_919_1266 107
122 3300049590 Ga0501074_0259249 Ga0501074_0259249_356_703 107
123 3300049590 Ga0501074_0400596 Ga0501074_0400596_126_467 107
124 3300049590 Ga0501074_0646934 Ga0501074_0646934_79_408 107
125 3300049591 Ga0501075_0261399 Ga0501075_0261399_481_828 107
126 3300049591 Ga0501075_0505747 Ga0501075_0505747_310_651 107
127 3300049592 Ga0501076_0040516 Ga0501076_0040516_2991_3332 107
128 3300049592 Ga0501076_0076708 Ga0501076_0076708_2308_2655 107
129 3300049592 Ga0501076_1549531 Ga0501076_1549531_110_445 107
130 3300049593 Ga0501077_0242162 Ga0501077_0242162_598_945 107
131 3300049593 Ga0501077_0447500 Ga0501077_0447500_468_809 107
132 3300049741 Ga0501079_0067277 Ga0501079_0067277_621_968 107
133 3300049741 Ga0501079_0108062 Ga0501079_0108062_710_1057 107
134 3300049741 Ga0501079_0129766 Ga0501079_0129766_1488_1835 107
135 3300049742 Ga0501080_0366882 Ga0501080_0366882_639_986 107
136 3300049743 Ga0501081_0011234 Ga0501081_0011234_1577_1924 107
137 3300049743 Ga0501081_0280338 Ga0501081_0280338_47_394 107
138 3300049743 Ga0501081_0369756 Ga0501081_0369756_288_635 107
139 3300049743 Ga0501081_0541194 Ga0501081_0541194_381_710 107
140 3300049744 Ga0501083_0787643 Ga0501083_0787643_69_398 107
141 3300049822 Ga0501035_0312040 Ga0501035_0312040_947_1294 107
142 3300049824 Ga0501045_0039834 Ga0501045_0039834_2618_2965 107
143 3300049824 Ga0501045_1195231 Ga0501045_1195231_158_487 107
144 3300050490 nmdc:mga03n38_390573_c1 nmdc:mga03n38_390573_c1_70_402 107
145 3300050491 nmdc:mga00v17_162912_c1 nmdc:mga00v17_162912_c1_297_629 107
146 3300050492 nmdc:mga0yw44_613608_c1 nmdc:mga0yw44_613608_c1_396_728 107
147 3300050494 nmdc:mga06z11_213421_c1 nmdc:mga06z11_213421_c1_637_984 107
148 3300050507 nmdc:mga05p37_1245758_c1 nmdc:mga05p37_1245758_c1_194_523 107
149 3300050507 nmdc:mga05p37_157128_c1 nmdc:mga05p37_157128_c1_1867_2214 107
150 3300050507 nmdc:mga05p37_284578_c1 nmdc:mga05p37_284578_c1_540_872 107
151 3300050507 nmdc:mga05p37_353592_c1 nmdc:mga05p37_353592_c1_319_648 107
152 3300050508 nmdc:mga09592_751895_c1 nmdc:mga09592_751895_c1_265_594 107
153 3300050509 nmdc:mga0qj67_606563_c1 nmdc:mga0qj67_606563_c1_121_450 107
154 3300050509 nmdc:mga0qj67_89011_c1 nmdc:mga0qj67_89011_c1_1222_1551 107
155 3300050510 nmdc:mga06r32_396724_c1 nmdc:mga06r32_396724_c1_175_504 107
156 3300050511 nmdc:mga08y16_305714_c1 nmdc:mga08y16_305714_c1_280_609 107
157 3300050512 nmdc:mga0n895_592470_c1 nmdc:mga0n895_592470_c1_448_795 107
158 3300050513 nmdc:mga0rr50_124749_c1 nmdc:mga0rr50_124749_c1_68_415 107
159 3300050513 nmdc:mga0rr50_357414_c1 nmdc:mga0rr50_357414_c1_786_1148 107
160 3300050515 nmdc:mga0a205_71341_c1 nmdc:mga0a205_71341_c1_865_1212 107
161 3300054114 Ga0501084_0156330 Ga0501084_0156330_569_916 107
162 3300054114 Ga0501084_0357906 Ga0501084_0357906_440_787 107
163 3300054114 Ga0501084_0519509 Ga0501084_0519509_598_945 107
164 3300054114 Ga0501084_0727700 Ga0501084_0727700_117_446 107
165 3300054114 Ga0501084_0768679 Ga0501084_0768679_191_532 107
166 3300060353 Ga0501082_0062691 Ga0501082_0062691_2187_2534 107
167 3300060353 Ga0501082_0275859 Ga0501082_0275859_612_959 107
168 3300060353 Ga0501082_0369436 Ga0501082_0369436_201_542 107
169 3300060353 Ga0501082_1016089 Ga0501082_1016089_360_689 107
170 3300061734 Ga0530510_0022250 Ga0530510_0022250_2972_3313 107
171 3300061734 Ga0530510_0117102 Ga0530510_0117102_983_1312 107
172 3300061734 Ga0530510_0326930 Ga0530510_0326930_315_662 107
173 3300061734 Ga0530510_1047884 Ga0530510_1047884_235_582 107
174 3300005338 Ga0068868_100128385 Ga0068868_1001283852 108
175 3300005614 Ga0068856_100098893 Ga0068856_1000988935 108
176 3300025927 Ga0207687_11453792 Ga0207687_114537922 108
177 3300026023 Ga0207677_10083113 Ga0207677_100831131 108
178 3300028380 Ga0268265_11935225 Ga0268265_119352251 108
179 3300035170 Ga0373943_0944152 Ga0373943_0944152_88_429 108
180 3300041512 Ga0451853_2325378 Ga0451853_2325378_48_419 108
181 3300045976 Ga0466967_0445650 Ga0466967_0445650_11_367 108
182 3300049574 Ga0501038_0672220 Ga0501038_0672220_203_538 108
183 3300049588 Ga0501072_1341142 Ga0501072_1341142_69_404 108
184 3300049592 Ga0501076_0077184 Ga0501076_0077184_26_361 108
185 3300060353 Ga0501082_1237235 Ga0501082_1237235_306_641 108

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wtf-assembly1.cif.gz_A structure of paxx 0.5455 70 89
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.5453 73 92
6f58-assembly1.cif.gz_B crystal structure of human brachyury (t) in complex with dna 0.5288 73 92
5v01-assembly1.cif.gz_B crystal structure of the competence damage-inducible protein a (coma) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.5036 67 102
1yyw-assembly1.cif.gz_B crystal structure of rnase iii from aquifex aeolicus complexed with double stranded rna at 2.8-angstrom resolution 0.4955 68 103
ID Description Score Start End Superfamily
af_G5EG78_346_440_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7562 73 90 2.60.40.10
af_A0A1D6ICV2_27_214_1.25.40.20 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.7177 73 89 1.25.40.20
af_Q9QZ05_1393_1492_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.7164 74 103 3.40.50.800
af_Q4CWW1_321_436_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7138 73 102 2.30.29.30
af_Q8WZ42_12037_12135_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6835 67 90 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7V9ARF9-F1-model_v4 C2H2-type domain-containing protein 0.9572 2 106
AF-A0A840II84-F1-model_v4 Uncharacterized protein 0.9464 1 107
AF-A0A3M1NHN5-F1-model_v4 MYM-type domain-containing protein 0.9349 62 102
AF-A0A840II84-F1-model_v4 Uncharacterized protein 0.9295 1 107
AF-A0A7V9ARF9-F1-model_v4 C2H2-type domain-containing protein 0.9228 2 106

Feature Viewer

pLDDT pTM Quality
85.38 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map