F284125

General Info

Members Datasets Scaffolds Average Seq Length
185 144 185 165

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10387630|Ga0075364_103876302
Length 188
Sequence MPVFLATICCRGVASKLPRGYTVVMANFSFDIVSDYDKAEMNNVFDQALREIDNRYDFKGTPAALDWLKDKAGLKVVGNGDWQIDAILDIVRKKLASRGQSQKVLDTSKEAIVANLKTTKEVPFKQGLDQEKAKQITKLLREQFPKVKAQIQGDAVRVTSSSKDDLQGVMQLLRSQDLDFPIDFTNYR

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
44 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
84 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
85 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
86 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
87 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
88 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
98 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
99 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
100 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
101 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
102 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
103 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
104 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
105 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
110 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
122 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
125 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
126 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
129 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
130 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
131 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
132 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
133 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
134 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
135 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
136 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
137 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
138 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
139 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
140 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
141 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
144 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.38
Nodule 0
Rhizoplane 1.08
Rhizosphere 79.46
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001062 3300001904 Bacteria 5019
2 JGI24742J22300_10000006 3300002244 Bacteria 41202
3 Ga0070676_10000782 3300005328 Bacteria 15687
4 Ga0070690_100100682 3300005330 Bacteria 1916
5 Ga0070666_10000203 3300005335 Bacteria 40659
6 Ga0070666_10020825 3300005335 Bacteria 4243
7 Ga0070680_100256873 3300005336 Bacteria 1478
8 Ga0070682_100000753 3300005337 Bacteria 19276
9 Ga0070668_100272402 3300005347 Bacteria 1411
10 Ga0070669_100307156 3300005353 Unclassified 1277
11 Ga0070675_100914484 3300005354 Bacteria 804
12 Ga0070671_100000001 3300005355 Bacteria 1228151
13 Ga0070671_100048521 3300005355 Bacteria 3531
14 Ga0070674_100010517 3300005356 Bacteria 5599
15 Ga0070673_101410111 3300005364 Unclassified 656
16 Ga0070667_100101714 3300005367 Bacteria 2483
17 Ga0070705_101220637 3300005440 Bacteria 620
18 Ga0068867_100414551 3300005459 Bacteria 1139
19 Ga0070707_100146786 3300005468 Bacteria 2296
20 Ga0070679_100091143 3300005530 Bacteria 3036
21 Ga0070686_100127586 3300005544 Unclassified 1755
22 Ga0070686_100542742 3300005544 Bacteria 908
23 Ga0068855_100000107 3300005563 Bacteria 103580
24 Ga0068855_100021964 3300005563 Bacteria 7652
25 Ga0068855_100676758 3300005563 Bacteria 1106
26 Ga0068856_100000001 3300005614 Bacteria 565602
27 Ga0068856_100026945 3300005614 Bacteria 5606
28 Ga0070702_100126400 3300005615 Bacteria 1608
29 Ga0068859_100343339 3300005617 Bacteria 1587
30 Ga0068859_100400091 3300005617 Bacteria 1469
31 Ga0068863_100159259 3300005841 Bacteria 2162
32 Ga0068863_101089489 3300005841 Unclassified 803
33 Ga0068858_100005850 3300005842 Bacteria 12014
34 Ga0068858_100022311 3300005842 Bacteria 5912
35 Ga0068860_100306741 3300005843 Bacteria 1556
36 Ga0081539_10371801 3300005985 Unclassified 597
37 Ga0075365_10286924 3300006038 Bacteria 1158
38 Ga0075365_10603526 3300006038 Unclassified 776
39 Ga0075364_10040858 3300006051 Unclassified 3009
40 Ga0075364_10387630 3300006051 Unclassified 953
41 Ga0075362_10037631 3300006177 Bacteria 2122
42 Ga0075369_10051228 3300006186 Bacteria 1787
43 Ga0075366_10042825 3300006195 Bacteria 2681
44 Ga0075430_100287834 3300006846 Bacteria 1359
45 Ga0097620_100343316 3300006931 Bacteria 1587
46 Ga0097620_100400100 3300006931 Bacteria 1469
47 Ga0105240_10011284 3300009093 Bacteria 12453
48 Ga0105240_10046523 3300009093 Bacteria 5497
49 Ga0105240_10522714 3300009093 Bacteria 1317
50 Ga0105245_10000001 3300009098 Bacteria 939270
51 Ga0105245_10008253 3300009098 Bacteria 9104
52 Ga0105245_10270773 3300009098 Bacteria 1656
53 Ga0105247_10211750 3300009101 Bacteria 1308
54 Ga0105242_10226870 3300009176 Bacteria 1672
55 Ga0105248_10384799 3300009177 Bacteria 1580
56 Ga0105237_10006253 3300009545 Bacteria 13255
57 Ga0105238_10000462 3300009551 Bacteria 42703
58 Ga0105249_10527011 3300009553 Bacteria 1229
59 Ga0105032_100001 3300009979 Bacteria 472394
60 Ga0105030_100320 3300009987 Bacteria 4208
61 Ga0105246_10250572 3300011119 Bacteria 1405
62 Ga0157373_10679085 3300013100 Bacteria 754
63 Ga0157370_10321685 3300013104 Bacteria 1427
64 Ga0157369_10083284 3300013105 Unclassified 3421
65 Ga0157369_10614069 3300013105 Bacteria 1122
66 Ga0157374_10096133 3300013296 Bacteria 2833
67 Ga0157374_11098382 3300013296 Bacteria 816
68 Ga0157378_10012463 3300013297 Bacteria 7445
69 Ga0157378_12368885 3300013297 Unclassified 583
70 Ga0163162_10206647 3300013306 Bacteria 2093
71 Ga0157372_10000194 3300013307 Bacteria 66925
72 Ga0157372_10578283 3300013307 Bacteria 1309
73 Ga0163163_10001421 3300014325 Bacteria 20253
74 Ga0163163_10005508 3300014325 Bacteria 10959
75 Ga0157379_11016516 3300014968 Bacteria 791
76 Ga0207697_10075571 3300025315 Bacteria 1416
77 Ga0207710_10166362 3300025900 Unclassified 1076
78 Ga0207680_10000121 3300025903 Bacteria 36291
79 Ga0207680_10013250 3300025903 Bacteria 4229
80 Ga0207647_10000003 3300025904 Bacteria 321014
81 Ga0207705_10014896 3300025909 Bacteria 5593
82 Ga0207654_10261094 3300025911 Bacteria 1164
83 Ga0207695_10008923 3300025913 Bacteria 12481
84 Ga0207695_10172481 3300025913 Bacteria 2088
85 Ga0207671_10000146 3300025914 Bacteria 109245
86 Ga0207660_10703386 3300025917 Unclassified 824
87 Ga0207652_10317751 3300025921 Bacteria 1406
88 Ga0207652_10531144 3300025921 Bacteria 1058
89 Ga0207694_10002002 3300025924 Bacteria 16859
90 Ga0207659_10699484 3300025926 Bacteria 868
91 Ga0207687_10000030 3300025927 Bacteria 155548
92 Ga0207687_10171256 3300025927 Unclassified 1675
93 Ga0207644_10000001 3300025931 Bacteria 1243214
94 Ga0207644_10037362 3300025931 Bacteria 3416
95 Ga0207644_10643271 3300025931 Bacteria 882
96 Ga0207686_10069577 3300025934 Bacteria 2259
97 Ga0207669_10005757 3300025937 Bacteria 5595
98 Ga0207667_10000128 3300025949 Bacteria 116173
99 Ga0207667_10019047 3300025949 Bacteria 7672
100 Ga0207667_10712501 3300025949 Unclassified 1005
101 Ga0207651_10512870 3300025960 Unclassified 1038
102 Ga0207658_10402562 3300025986 Bacteria 1203
103 Ga0207703_10022117 3300026035 Bacteria 4984
104 Ga0207703_10032429 3300026035 Bacteria 4135
105 Ga0207702_10000001 3300026078 Bacteria 895738
106 Ga0207641_10056954 3300026088 Bacteria 3323
107 Ga0207641_11071350 3300026088 Unclassified 804
108 Ga0209999_1074173 3300027543 Unclassified 654
109 Ga0210002_1009854 3300027617 Unclassified 1461
110 Ga0209983_1054416 3300027665 Unclassified 878
111 Ga0209974_10000378 3300027876 Bacteria 14758
112 Ga0268264_10372234 3300028381 Bacteria 1366
113 Ga0265338_10000052 3300028800 Bacteria 209239
114 Ga0265338_10000107 3300028800 Bacteria 153589
115 Ga0265338_10001630 3300028800 Bacteria 35917
116 Ga0265338_10003756 3300028800 Bacteria 21096
117 Ga0265338_10010209 3300028800 Bacteria 11065
118 Ga0265338_10018696 3300028800 Bacteria 7405
119 Ga0265324_10005239 3300029957 Bacteria 5638
120 Ga0314311_1126012 3300030733 Unclassified 1036
121 Ga0316179_1051408 3300030734 Bacteria 17585
122 Ga0316180_1019647 3300030736 Bacteria 2886
123 Ga0316182_1041010 3300030745 Bacteria 16751
124 Ga0316182_1043486 3300030745 Bacteria 3921
125 Ga0265332_10007520 3300031238 Bacteria 4924
126 Ga0265339_10130625 3300031249 Bacteria 1285
127 Ga0265316_10279611 3300031344 Bacteria 1220
128 Ga0307516_10006385 3300031730 Bacteria 13822
129 Ga0373951_0053543 3300035091 Bacteria 997
130 Ga0395899_0002540 3300037312 Bacteria 14790
131 Ga0395898_0049568 3300037466 Bacteria 4114
132 Ga0395905_0080304 3300037471 Bacteria 3056
133 Ga0395901_1641048 3300038443 Bacteria 595
134 Ga0451787_156817 3300041441 Unclassified 616
135 Ga0451807_1120199 3300041486 Bacteria 575
136 Ga0451835_1060866 3300041492 Unclassified 687
137 Ga0439432_001730 3300042006 Bacteria 8173
138 Ga0450920_007902 3300042122 Bacteria 1935
139 Ga0450903_009069 3300042138 Bacteria 1624
140 Ga0450906_011260 3300042145 Bacteria 1676
141 Ga0450909_003464 3300042185 Bacteria 2251
142 Ga0439434_0215153 3300042435 Unclassified 651
143 Ga0451577_0837060 3300042876 Bacteria 830
144 Ga0453684_0891895 3300044712 Bacteria 953
145 Ga0495638_0000189 3300046460 Bacteria 93205
146 Ga0495583_0010224 3300046506 Bacteria 5503
147 Ga0495597_0068146 3300046542 Unclassified 1538
148 Ga0495622_0000082 3300046557 Bacteria 85266
149 Ga0495658_0023518 3300046683 Bacteria 3271
150 Ga0495670_0301872 3300046691 Unclassified 858
151 Ga0495600_0008680 3300046809 Bacteria 6254
152 Ga0495660_0000090 3300046810 Bacteria 98309
153 Ga0495672_0000129 3300047320 Bacteria 112879
154 Ga0501069_0156926 3300049585 Bacteria 1309
155 Ga0501071_0185621 3300049587 Bacteria 1559
156 Ga0501073_0119963 3300049589 Bacteria 1822
157 Ga0501080_0000133 3300049742 Bacteria 52488
158 nmdc:mga03683_172_c1 3300050489 Bacteria 21646
159 nmdc:mga03n38_290510_c1 3300050490 Bacteria 875
160 nmdc:mga00v17_34704_c1 3300050491 Unclassified 2998
161 nmdc:mga00v17_702_c1 3300050491 Bacteria 15977
162 nmdc:mga0yw44_281720_c1 3300050492 Unclassified 1111
163 nmdc:mga0yw44_512457_c1 3300050492 Unclassified 814
164 nmdc:mga0k408_3391_c2 3300050493 Bacteria 2737
165 nmdc:mga07m45_15581_c1 3300050496 Unclassified 4059
166 nmdc:mga0qj67_461422_c1 3300050509 Bacteria 1023
167 nmdc:mga0sz30_9801_c1 3300050516 Bacteria 2096
168 Ga0500643_000022 3300053087 Bacteria 277519
169 Ga0500643_088219 3300053087 Bacteria 847
170 Ga0500644_0029580 3300053088 Unclassified 1724
171 Ga0500651_0000441 3300053093 Bacteria 22180
172 Ga0500566_0000001 3300053094 Bacteria 1101031
173 Ga0500555_000006 3300053103 Bacteria 304416
174 Ga0500555_030797 3300053103 Bacteria 1522
175 Ga0500556_0000272 3300053104 Bacteria 40585
176 Ga0500562_133120 3300053108 Unclassified 678
177 Ga0500569_000013 3300053109 Bacteria 50700
178 Ga0500597_295097 3300053120 Unclassified 649
179 Ga0500614_006770 3300053123 Bacteria 2410
180 Ga0500628_000141 3300053129 Bacteria 13888
181 Ga0500568_0012798 3300053139 Bacteria 3846
182 Ga0500588_0000033 3300053146 Bacteria 27588
183 Ga0500616_0000005 3300053153 Bacteria 961725
184 Ga0500627_0019514 3300053158 Bacteria 2704
185 Ga0500570_000005 3300053724 Bacteria 132994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046506 Ga0495583_0010224 Ga0495583_0010224_2815_3312 136
2 3300053103 Ga0500555_030797 Ga0500555_030797_704_1201 136
3 3300009101 Ga0105247_10211750 Ga0105247_102117502 143
4 3300025900 Ga0207710_10166362 Ga0207710_101663622 143
5 3300042006 Ga0439432_001730 Ga0439432_001730_7558_8052 152
6 3300042435 Ga0439434_0215153 Ga0439434_0215153_52_546 152
7 3300030734 Ga0316179_1051408 Ga0316179_10514088 154
8 3300030736 Ga0316180_1019647 Ga0316180_10196472 154
9 3300030745 Ga0316182_1041010 Ga0316182_104101013 154
10 3300002244 JGI24742J22300_10000006 JGI24742J22300_1000000630 155
11 3300005328 Ga0070676_10000782 Ga0070676_100007823 155
12 3300005440 Ga0070705_101220637 Ga0070705_1012206371 163
13 3300042876 Ga0451577_0837060 Ga0451577_0837060_154_645 163
14 3300044712 Ga0453684_0891895 Ga0453684_0891895_434_925 163
15 3300005330 Ga0070690_100100682 Ga0070690_1001006822 164
16 3300005336 Ga0070680_100256873 Ga0070680_1002568731 164
17 3300005337 Ga0070682_100000753 Ga0070682_10000075310 164
18 3300005347 Ga0070668_100272402 Ga0070668_1002724022 164
19 3300005353 Ga0070669_100307156 Ga0070669_1003071563 164
20 3300005354 Ga0070675_100914484 Ga0070675_1009144842 164
21 3300005355 Ga0070671_100000001 Ga0070671_100000001559 164
22 3300005459 Ga0068867_100414551 Ga0068867_1004145512 164
23 3300005544 Ga0070686_100127586 Ga0070686_1001275862 164
24 3300005563 Ga0068855_100000107 Ga0068855_10000010771 164
25 3300005563 Ga0068855_100021964 Ga0068855_1000219647 164
26 3300005614 Ga0068856_100000001 Ga0068856_100000001186 164
27 3300005614 Ga0068856_100026945 Ga0068856_1000269452 164
28 3300005617 Ga0068859_100343339 Ga0068859_1003433392 164
29 3300005842 Ga0068858_100022311 Ga0068858_1000223116 164
30 3300006038 Ga0075365_10286924 Ga0075365_102869242 164
31 3300006038 Ga0075365_10603526 Ga0075365_106035261 164
32 3300006051 Ga0075364_10040858 Ga0075364_100408582 164
33 3300006177 Ga0075362_10037631 Ga0075362_100376313 164
34 3300006186 Ga0075369_10051228 Ga0075369_100512282 164
35 3300006195 Ga0075366_10042825 Ga0075366_100428253 164
36 3300006846 Ga0075430_100287834 Ga0075430_1002878342 164
37 3300006931 Ga0097620_100343316 Ga0097620_1003433162 164
38 3300009093 Ga0105240_10011284 Ga0105240_1001128414 164
39 3300009098 Ga0105245_10000001 Ga0105245_10000001423 164
40 3300009177 Ga0105248_10384799 Ga0105248_103847993 164
41 3300009979 Ga0105032_100001 Ga0105032_10000136 164
42 3300011119 Ga0105246_10250572 Ga0105246_102505721 164
43 3300013105 Ga0157369_10083284 Ga0157369_100832843 164
44 3300013105 Ga0157369_10614069 Ga0157369_106140692 164
45 3300013307 Ga0157372_10000194 Ga0157372_1000019452 164
46 3300014325 Ga0163163_10001421 Ga0163163_100014213 164
47 3300014325 Ga0163163_10005508 Ga0163163_100055087 164
48 3300014968 Ga0157379_11016516 Ga0157379_110165161 164
49 3300025913 Ga0207695_10008923 Ga0207695_1000892314 164
50 3300025917 Ga0207660_10703386 Ga0207660_107033862 164
51 3300025921 Ga0207652_10531144 Ga0207652_105311441 164
52 3300025926 Ga0207659_10699484 Ga0207659_106994842 164
53 3300025927 Ga0207687_10000030 Ga0207687_1000003016 164
54 3300025931 Ga0207644_10000001 Ga0207644_10000001876 164
55 3300025931 Ga0207644_10643271 Ga0207644_106432711 164
56 3300025934 Ga0207686_10069577 Ga0207686_100695773 164
57 3300025949 Ga0207667_10000128 Ga0207667_1000012856 164
58 3300025949 Ga0207667_10019047 Ga0207667_100190474 164
59 3300026035 Ga0207703_10032429 Ga0207703_100324292 164
60 3300026078 Ga0207702_10000001 Ga0207702_10000001735 164
61 3300027543 Ga0209999_1074173 Ga0209999_10741731 164
62 3300027617 Ga0210002_1009854 Ga0210002_10098543 164
63 3300027665 Ga0209983_1054416 Ga0209983_10544162 164
64 3300027876 Ga0209974_10000378 Ga0209974_100003787 164
65 3300028800 Ga0265338_10000052 Ga0265338_10000052160 164
66 3300028800 Ga0265338_10003756 Ga0265338_1000375616 164
67 3300028800 Ga0265338_10018696 Ga0265338_100186967 164
68 3300030733 Ga0314311_1126012 Ga0314311_11260122 164
69 3300030745 Ga0316182_1043486 Ga0316182_10434862 164
70 3300031730 Ga0307516_10006385 Ga0307516_100063855 164
71 3300037312 Ga0395899_0002540 Ga0395899_0002540_11747_12244 164
72 3300037466 Ga0395898_0049568 Ga0395898_0049568_1691_2188 164
73 3300037471 Ga0395905_0080304 Ga0395905_0080304_1000_1497 164
74 3300038443 Ga0395901_1641048 Ga0395901_1641048_26_520 164
75 3300041486 Ga0451807_1120199 Ga0451807_1120199_16_510 164
76 3300041492 Ga0451835_1060866 Ga0451835_1060866_148_642 164
77 3300042122 Ga0450920_007902 Ga0450920_007902_686_1180 164
78 3300042138 Ga0450903_009069 Ga0450903_009069_897_1391 164
79 3300042145 Ga0450906_011260 Ga0450906_011260_373_867 164
80 3300042185 Ga0450909_003464 Ga0450909_003464_22_516 164
81 3300046460 Ga0495638_0000189 Ga0495638_0000189_49986_50480 164
82 3300046542 Ga0495597_0068146 Ga0495597_0068146_425_919 164
83 3300046557 Ga0495622_0000082 Ga0495622_0000082_61882_62376 164
84 3300046683 Ga0495658_0023518 Ga0495658_0023518_1770_2264 164
85 3300046691 Ga0495670_0301872 Ga0495670_0301872_59_556 164
86 3300046809 Ga0495600_0008680 Ga0495600_0008680_1846_2340 164
87 3300046810 Ga0495660_0000090 Ga0495660_0000090_74453_74947 164
88 3300047320 Ga0495672_0000129 Ga0495672_0000129_71487_71984 164
89 3300049585 Ga0501069_0156926 Ga0501069_0156926_702_1199 164
90 3300049587 Ga0501071_0185621 Ga0501071_0185621_342_839 164
91 3300049589 Ga0501073_0119963 Ga0501073_0119963_253_750 164
92 3300049742 Ga0501080_0000133 Ga0501080_0000133_10923_11420 164
93 3300050489 nmdc:mga03683_172_c1 nmdc:mga03683_172_c1_4794_5291 164
94 3300050490 nmdc:mga03n38_290510_c1 nmdc:mga03n38_290510_c1_15_512 164
95 3300050491 nmdc:mga00v17_34704_c1 nmdc:mga00v17_34704_c1_782_1279 164
96 3300050491 nmdc:mga00v17_702_c1 nmdc:mga00v17_702_c1_12680_13177 164
97 3300050492 nmdc:mga0yw44_281720_c1 nmdc:mga0yw44_281720_c1_354_848 164
98 3300050492 nmdc:mga0yw44_512457_c1 nmdc:mga0yw44_512457_c1_284_778 164
99 3300050493 nmdc:mga0k408_3391_c2 nmdc:mga0k408_3391_c2_1412_1906 164
100 3300050496 nmdc:mga07m45_15581_c1 nmdc:mga07m45_15581_c1_2728_3225 164
101 3300050509 nmdc:mga0qj67_461422_c1 nmdc:mga0qj67_461422_c1_285_782 164
102 3300050516 nmdc:mga0sz30_9801_c1 nmdc:mga0sz30_9801_c1_511_1008 164
103 3300053087 Ga0500643_000022 Ga0500643_000022_38597_39091 164
104 3300053087 Ga0500643_088219 Ga0500643_088219_325_819 164
105 3300053093 Ga0500651_0000441 Ga0500651_0000441_13763_14257 164
106 3300053094 Ga0500566_0000001 Ga0500566_0000001_584106_584600 164
107 3300053103 Ga0500555_000006 Ga0500555_000006_276362_276856 164
108 3300053104 Ga0500556_0000272 Ga0500556_0000272_37524_38021 164
109 3300053109 Ga0500569_000013 Ga0500569_000013_42726_43220 164
110 3300053120 Ga0500597_295097 Ga0500597_295097_68_562 164
111 3300053123 Ga0500614_006770 Ga0500614_006770_1839_2333 164
112 3300053146 Ga0500588_0000033 Ga0500588_0000033_5366_5860 164
113 3300053153 Ga0500616_0000005 Ga0500616_0000005_306013_306507 164
114 3300053724 Ga0500570_000005 Ga0500570_000005_109158_109655 164
115 3300001904 JGI24736J21556_1001062 JGI24736J21556_10010628 165
116 3300005335 Ga0070666_10000203 Ga0070666_1000020314 165
117 3300005335 Ga0070666_10020825 Ga0070666_100208254 165
118 3300005355 Ga0070671_100048521 Ga0070671_1000485214 165
119 3300005356 Ga0070674_100010517 Ga0070674_1000105179 165
120 3300005364 Ga0070673_101410111 Ga0070673_1014101111 165
121 3300005367 Ga0070667_100101714 Ga0070667_1001017142 165
122 3300005468 Ga0070707_100146786 Ga0070707_1001467862 165
123 3300005530 Ga0070679_100091143 Ga0070679_1000911433 165
124 3300005544 Ga0070686_100542742 Ga0070686_1005427422 165
125 3300005563 Ga0068855_100676758 Ga0068855_1006767582 165
126 3300005615 Ga0070702_100126400 Ga0070702_1001264002 165
127 3300005617 Ga0068859_100400091 Ga0068859_1004000912 165
128 3300005841 Ga0068863_100159259 Ga0068863_1001592593 165
129 3300005841 Ga0068863_101089489 Ga0068863_1010894891 165
130 3300005842 Ga0068858_100005850 Ga0068858_1000058507 165
131 3300005843 Ga0068860_100306741 Ga0068860_1003067413 165
132 3300005985 Ga0081539_10371801 Ga0081539_103718011 165
133 3300006051 Ga0075364_10387630 Ga0075364_103876302 165
134 3300006931 Ga0097620_100400100 Ga0097620_1004001002 165
135 3300009093 Ga0105240_10046523 Ga0105240_100465233 165
136 3300009093 Ga0105240_10522714 Ga0105240_105227142 165
137 3300009098 Ga0105245_10008253 Ga0105245_100082536 165
138 3300009098 Ga0105245_10270773 Ga0105245_102707733 165
139 3300009176 Ga0105242_10226870 Ga0105242_102268701 165
140 3300009545 Ga0105237_10006253 Ga0105237_1000625310 165
141 3300009551 Ga0105238_10000462 Ga0105238_1000046230 165
142 3300009553 Ga0105249_10527011 Ga0105249_105270111 165
143 3300009987 Ga0105030_100320 Ga0105030_1003203 165
144 3300013100 Ga0157373_10679085 Ga0157373_106790851 165
145 3300013104 Ga0157370_10321685 Ga0157370_103216852 165
146 3300013296 Ga0157374_10096133 Ga0157374_100961332 165
147 3300013296 Ga0157374_11098382 Ga0157374_110983822 165
148 3300013297 Ga0157378_10012463 Ga0157378_100124633 165
149 3300013297 Ga0157378_12368885 Ga0157378_123688851 165
150 3300013306 Ga0163162_10206647 Ga0163162_102066472 165
151 3300013307 Ga0157372_10578283 Ga0157372_105782832 165
152 3300025315 Ga0207697_10075571 Ga0207697_100755712 165
153 3300025903 Ga0207680_10000121 Ga0207680_1000012134 165
154 3300025903 Ga0207680_10013250 Ga0207680_100132501 165
155 3300025904 Ga0207647_10000003 Ga0207647_10000003287 165
156 3300025909 Ga0207705_10014896 Ga0207705_100148965 165
157 3300025911 Ga0207654_10261094 Ga0207654_102610942 165
158 3300025913 Ga0207695_10172481 Ga0207695_101724813 165
159 3300025914 Ga0207671_10000146 Ga0207671_10000146112 165
160 3300025921 Ga0207652_10317751 Ga0207652_103177512 165
161 3300025924 Ga0207694_10002002 Ga0207694_1000200211 165
162 3300025927 Ga0207687_10171256 Ga0207687_101712562 165
163 3300025931 Ga0207644_10037362 Ga0207644_100373624 165
164 3300025937 Ga0207669_10005757 Ga0207669_100057572 165
165 3300025949 Ga0207667_10712501 Ga0207667_107125012 165
166 3300025960 Ga0207651_10512870 Ga0207651_105128702 165
167 3300025986 Ga0207658_10402562 Ga0207658_104025622 165
168 3300026035 Ga0207703_10022117 Ga0207703_100221173 165
169 3300026088 Ga0207641_10056954 Ga0207641_100569544 165
170 3300026088 Ga0207641_11071350 Ga0207641_110713502 165
171 3300028381 Ga0268264_10372234 Ga0268264_103722342 165
172 3300028800 Ga0265338_10000107 Ga0265338_10000107107 165
173 3300028800 Ga0265338_10001630 Ga0265338_1000163011 165
174 3300028800 Ga0265338_10010209 Ga0265338_1001020913 165
175 3300029957 Ga0265324_10005239 Ga0265324_100052392 165
176 3300031238 Ga0265332_10007520 Ga0265332_100075208 165
177 3300031249 Ga0265339_10130625 Ga0265339_101306252 165
178 3300031344 Ga0265316_10279611 Ga0265316_102796112 165
179 3300035091 Ga0373951_0053543 Ga0373951_0053543_309_806 165
180 3300041441 Ga0451787_156817 Ga0451787_156817_34_552 165
181 3300053088 Ga0500644_0029580 Ga0500644_0029580_503_1000 165
182 3300053108 Ga0500562_133120 Ga0500562_133120_167_667 165
183 3300053129 Ga0500628_000141 Ga0500628_000141_357_854 165
184 3300053139 Ga0500568_0012798 Ga0500568_0012798_2545_3045 165
185 3300053158 Ga0500627_0019514 Ga0500627_0019514_226_723 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04461

DUF520

Protein of unknown function (DUF520)

28

188

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.9025 6 165
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.8871 6 165
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.8837 5 165
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.8686 5 165
8r79-assembly1.cif.gz_D the d2 domain of human dtx3l 0.7438 111 153
ID Description Score Start End Superfamily
1in0B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9658 104 165 3.30.70.860
1in0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9307 12 103 3.30.70.990
1in0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9213 12 103 3.30.70.990
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9188 14 100 3.30.70.990
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.8893 14 100 3.30.70.990
ID Description Score Start End GO Terms
AF-A0A563BEM0-F1-model_v4 DUF520 family protein 0.9899 104 165 GO:0000166
GO:0005829
AF-A0A537XNU2-F1-model_v4 DUF520 family protein 0.9781 104 165 GO:0000166
GO:0005829
AF-A0A7X6P619-F1-model_v4 UPF0234 protein GX865_00995 0.9729 3 165 GO:0000166
GO:0005829
AF-T0YCL1-F1-model_v4 Nucleotide-binding protein 0.9705 102 165 GO:0000166
GO:0005829
AF-A0A522WJB4-F1-model_v4 DUF520 family protein 0.9699 104 165 GO:0000166
GO:0005829

Feature Viewer

pLDDT pTM Quality
93.41 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map