F283810

General Info

Members Datasets Scaffolds Average Seq Length
185 111 370 193

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10383193|Ga0070692_103831931
Length 217
Sequence VAARGFDRVRRFRGRRFLNRCANHGRPRRAAPTVRGMKTTPITWRVFCAVELPHEIRAQLGDHIARLRKEVPDVAASWSRVENIHLTLKFYGNVEVDRIASISSAIERAGKDIAPFEIAVGKTGAFRSQVLWIGVSDPAEKLTTLHQRLGSEDRVYRPHLTIARIRRPDGARRLVDAHLQMKFEPVAVKVNQVILFRSELSPKGSKYTVISKHGLDG

Samples

Sample ID Description Type Environment
1 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
91 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
95 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
102 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
103 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
104 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
107 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
108 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
109 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.7
Rhizosphere 97.3
Stem 0
Stem Tuber 0
Unclassified 34.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070692_10383193 3300005345 Unclassified 883
2 SwRhRL2b_contig_159288 2162886007 Bacteria 1785
3 JGI24751J29686_10000023 3300002459 Bacteria 97529
4 JGI25406J46586_10005909 3300003203 Bacteria 5662
5 Ga0065704_10003238 3300005289 Bacteria 4393
6 Ga0065712_10067730 3300005290 Bacteria 133482
7 Ga0065712_10068957 3300005290 Bacteria 8466
8 Ga0065715_10097065 3300005293 Unclassified 3770
9 Ga0065707_10096997 3300005295 Bacteria 3214
10 Ga0065707_10605779 3300005295 Unclassified 687
11 Ga0070670_100000324 3300005331 Bacteria 40556
12 Ga0070670_100068813 3300005331 Bacteria 3039
13 Ga0070670_100547617 3300005331 Bacteria 1032
14 Ga0068869_100118019 3300005334 Bacteria 2026
15 Ga0068869_100796989 3300005334 Unclassified 812
16 Ga0068868_100548396 3300005338 Bacteria 1019
17 Ga0070689_100074801 3300005340 Bacteria 2651
18 Ga0070689_100384873 3300005340 Bacteria 1183
19 Ga0070692_10148356 3300005345 Unclassified 1333
20 Ga0070673_100194655 3300005364 Bacteria 1743
21 Ga0070673_100625687 3300005364 Bacteria 983
22 Ga0070659_100302066 3300005366 Bacteria 1335
23 Ga0070705_100806715 3300005440 Unclassified 747
24 Ga0070694_100005424 3300005444 Bacteria 7721
25 Ga0070694_100100374 3300005444 Unclassified 2047
26 Ga0070694_100513936 3300005444 Unclassified 955
27 Ga0070681_10218015 3300005458 Bacteria 1824
28 Ga0070698_100448262 3300005471 Bacteria 1226
29 Ga0070697_100058435 3300005536 Unclassified 3139
30 Ga0070695_100314511 3300005545 Bacteria 1162
31 Ga0070696_100348932 3300005546 Bacteria 1146
32 Ga0070693_100072581 3300005547 Archaea 2030
33 Ga0070665_101012422 3300005548 Unclassified 843
34 Ga0070704_100455896 3300005549 Unclassified 1102
35 Ga0070664_100513458 3300005564 Bacteria 1105
36 Ga0068854_100218386 3300005578 Bacteria 1507
37 Ga0068854_100241692 3300005578 Bacteria 1438
38 Ga0068852_100318291 3300005616 Bacteria 1510
39 Ga0068859_100030391 3300005617 Bacteria 5421
40 Ga0068859_100041443 3300005617 Unclassified 4624
41 Ga0068859_100314937 3300005617 Bacteria 1658
42 Ga0068859_100521272 3300005617 Unclassified 1283
43 Ga0068859_100596639 3300005617 Bacteria 1198
44 Ga0068859_100948529 3300005617 Unclassified 944
45 Ga0068864_100027005 3300005618 Bacteria 4843
46 Ga0068864_100249161 3300005618 Bacteria 1648
47 Ga0068861_100003940 3300005719 Bacteria 9929
48 Ga0068861_100644630 3300005719 Bacteria 978
49 Ga0068870_10520763 3300005840 Bacteria 796
50 Ga0068863_100273826 3300005841 Bacteria 1634
51 Ga0068858_100143429 3300005842 Bacteria 2243
52 Ga0068858_100279451 3300005842 Archaea 1590
53 Ga0068860_100005046 3300005843 Bacteria 13431
54 Ga0068860_100057618 3300005843 Unclassified 3693
55 Ga0068860_100066484 3300005843 Unclassified 3424
56 Ga0068860_100077916 3300005843 Bacteria 3152
57 Ga0068862_100362355 3300005844 Bacteria 1348
58 Ga0081539_10000395 3300005985 Bacteria 93818
59 Ga0097621_100297087 3300006237 Unclassified 1426
60 Ga0068871_100002555 3300006358 Bacteria 12426
61 Ga0075430_100034828 3300006846 Bacteria 4274
62 Ga0075431_100091859 3300006847 Bacteria 3132
63 Ga0075431_100143511 3300006847 Bacteria 2460
64 Ga0075433_10579479 3300006852 Unclassified 986
65 Ga0075434_100141534 3300006871 Unclassified 2426
66 Ga0075434_100556495 3300006871 Unclassified 1167
67 Ga0075434_100762155 3300006871 Unclassified 985
68 Ga0075429_100279620 3300006880 Unclassified 1462
69 Ga0097620_100030389 3300006931 Bacteria 5421
70 Ga0097620_100041442 3300006931 Unclassified 4624
71 Ga0097620_100097791 3300006931 Unclassified 2988
72 Ga0097620_100314937 3300006931 Bacteria 1658
73 Ga0097620_100521300 3300006931 Unclassified 1283
74 Ga0097620_100596681 3300006931 Bacteria 1198
75 Ga0097620_100948512 3300006931 Unclassified 944
76 Ga0097620_100960269 3300006931 Bacteria 938
77 Ga0111539_10022163 3300009094 Bacteria 7808
78 Ga0105247_10389416 3300009101 Unclassified 990
79 Ga0114129_10053441 3300009147 Bacteria 5664
80 Ga0114129_11413903 3300009147 Bacteria 858
81 Ga0105243_10197548 3300009148 Bacteria 1762
82 Ga0105243_11143225 3300009148 Unclassified 789
83 Ga0105241_10180074 3300009174 Bacteria 1752
84 Ga0105241_10388703 3300009174 Unclassified 1221
85 Ga0105248_10030602 3300009177 Bacteria 6012
86 Ga0105248_10387005 3300009177 Bacteria 1574
87 Ga0105248_11309300 3300009177 Bacteria 820
88 Ga0105237_10003124 3300009545 Bacteria 19932
89 Ga0105237_10122301 3300009545 Bacteria 2597
90 Ga0105238_10661207 3300009551 Bacteria 1055
91 Ga0105239_10858272 3300010375 Unclassified 1041
92 Ga0105239_11720898 3300010375 Unclassified 726
93 Ga0105246_10031331 3300011119 Bacteria 3519
94 Ga0105246_10370350 3300011119 Unclassified 1180
95 Ga0157373_10002544 3300013100 Bacteria 13886
96 Ga0157375_10136737 3300013308 Bacteria 2575
97 Ga0163163_10002165 3300014325 Bacteria 16602
98 Ga0163163_10025050 3300014325 Bacteria 5683
99 Ga0163163_10176417 3300014325 Bacteria 2184
100 Ga0163163_10330893 3300014325 Bacteria 1578
101 Ga0157380_10482027 3300014326 Bacteria 1200
102 Ga0157380_10657570 3300014326 Bacteria 1046
103 Ga0157380_11067746 3300014326 Unclassified 845
104 Ga0157377_10028976 3300014745 Bacteria 2986
105 Ga0157377_10038621 3300014745 Bacteria 2637
106 Ga0157377_10321921 3300014745 Unclassified 1028
107 Ga0157379_10176512 3300014968 Bacteria 1929
108 Ga0157379_10385587 3300014968 Unclassified 1286
109 Ga0157379_10395765 3300014968 Bacteria 1269
110 Ga0207653_10006567 3300025885 Bacteria 3632
111 Ga0207647_10000445 3300025904 Bacteria 33611
112 Ga0207643_10001352 3300025908 Bacteria 14172
113 Ga0207684_10000533 3300025910 Bacteria 47088
114 Ga0207654_10312813 3300025911 Unclassified 1071
115 Ga0207707_10426854 3300025912 Unclassified 1136
116 Ga0207681_10067955 3300025923 Bacteria 2473
117 Ga0207650_10000112 3300025925 Bacteria 106714
118 Ga0207650_10230757 3300025925 Unclassified 1493
119 Ga0207650_10282084 3300025925 Bacteria 1353
120 Ga0207650_10696351 3300025925 Bacteria 858
121 Ga0207690_10166128 3300025932 Bacteria 1649
122 Ga0207670_10000957 3300025936 Bacteria 15223
123 Ga0207670_10538313 3300025936 Bacteria 953
124 Ga0207670_10732204 3300025936 Unclassified 820
125 Ga0207711_10080803 3300025941 Bacteria 2840
126 Ga0207711_10235888 3300025941 Bacteria 1676
127 Ga0207689_10510984 3300025942 Bacteria 1007
128 Ga0207651_10088117 3300025960 Bacteria 2262
129 Ga0207651_10595777 3300025960 Unclassified 966
130 Ga0207712_10114094 3300025961 Bacteria 2032
131 Ga0207712_11204346 3300025961 Unclassified 676
132 Ga0207640_10013276 3300025981 Unclassified 4717
133 Ga0207640_10170327 3300025981 Bacteria 1622
134 Ga0207703_10105626 3300026035 Unclassified 2394
135 Ga0207703_10141736 3300026035 Bacteria 2087
136 Ga0207708_10005201 3300026075 Bacteria 9594
137 Ga0207641_10174118 3300026088 Bacteria 1967
138 Ga0207641_11039361 3300026088 Bacteria 817
139 Ga0207641_11065018 3300026088 Bacteria 806
140 Ga0207676_10007751 3300026095 Bacteria 7635
141 Ga0207676_10067775 3300026095 Bacteria 2851
142 Ga0207676_10349165 3300026095 Bacteria 1367
143 Ga0207676_11263363 3300026095 Unclassified 733
144 Ga0207674_10382543 3300026116 Bacteria 1361
145 Ga0207674_10391715 3300026116 Bacteria 1343
146 Ga0207675_100025568 3300026118 Bacteria 5495
147 Ga0207675_100027423 3300026118 Bacteria 5305
148 Ga0207675_100313679 3300026118 Unclassified 1530
149 Ga0207675_100553847 3300026118 Unclassified 1149
150 Ga0207675_100776641 3300026118 Unclassified 970
151 Ga0207428_10137489 3300027907 Bacteria 1867
152 Ga0268265_10518509 3300028380 Bacteria 1126
153 Ga0268264_10930947 3300028381 Bacteria 873
154 Ga0307405_10029101 3300031731 Unclassified 3225
155 Ga0307406_10099412 3300031901 Bacteria 1978
156 Ga0307412_10003279 3300031911 Bacteria 8982
157 Ga0307416_100648276 3300032002 Unclassified 1140
158 Ga0307414_10019896 3300032004 Unclassified 4170
159 Ga0373940_0088845 3300035088 Unclassified 923
160 Ga0373951_0002939 3300035091 Bacteria 4230
161 Ga0395898_0219246 3300037466 Bacteria 1815
162 Ga0395901_0462111 3300038443 Bacteria 1297
163 Ga0439455_0018363 3300042012 Bacteria 1639
164 Ga0439458_0004994 3300042157 Bacteria 3002
165 Ga0451576_0838924 3300045051 Unclassified 965
166 Ga0496102_1002290 3300048905 Unclassified 756
167 Ga0496106_0029996 3300048909 Bacteria 4055
168 Ga0496107_0214747 3300048910 Unclassified 1431
169 Ga0496112_0124167 3300048915 Unclassified 2552
170 Ga0496112_0286101 3300048915 Bacteria 1595
171 Ga0501291_031904 3300049514 Unclassified 892
172 Ga0501216_074146 3300049660 Unclassified 709
173 Ga0501223_041100 3300049663 Unclassified 897
174 Ga0501235_023694 3300049669 Bacteria 1370
175 nmdc:mga05p37_351076_c1 3300050507 Bacteria 1737
176 nmdc:mga09592_753835_c1 3300050508 Unclassified 826
177 nmdc:mga0qj67_377072_c1 3300050509 Unclassified 1146
178 nmdc:mga06r32_379867_c1 3300050510 Bacteria 1396
179 nmdc:mga06r32_506527_c1 3300050510 Unclassified 1184
180 nmdc:mga06r32_658741_c1 3300050510 Bacteria 1015
181 nmdc:mga08y16_2372_c1 3300050511 Bacteria 19350
182 nmdc:mga0n895_101977_c1 3300050512 Unclassified 2880
183 nmdc:mga0n895_277023_c1 3300050512 Bacteria 1701
184 nmdc:mga0a205_282238_c1 3300050515 Bacteria 1536
185 nmdc:mga0a205_75667_c1 3300050515 Unclassified 3253
186 Ga0070692_10383193
187 SwRhRL2b_contig_159288
188 JGI24751J29686_10000023
189 JGI25406J46586_10005909
190 Ga0065704_10003238
191 Ga0065712_10067730
192 Ga0065712_10068957
193 Ga0065715_10097065
194 Ga0065707_10096997
195 Ga0065707_10605779
196 Ga0070670_100000324
197 Ga0070670_100068813
198 Ga0070670_100547617
199 Ga0068869_100118019
200 Ga0068869_100796989
201 Ga0068868_100548396
202 Ga0070689_100074801
203 Ga0070689_100384873
204 Ga0070692_10148356
205 Ga0070673_100194655
206 Ga0070673_100625687
207 Ga0070659_100302066
208 Ga0070705_100806715
209 Ga0070694_100005424
210 Ga0070694_100100374
211 Ga0070694_100513936
212 Ga0070681_10218015
213 Ga0070698_100448262
214 Ga0070697_100058435
215 Ga0070695_100314511
216 Ga0070696_100348932
217 Ga0070693_100072581
218 Ga0070665_101012422
219 Ga0070704_100455896
220 Ga0070664_100513458
221 Ga0068854_100218386
222 Ga0068854_100241692
223 Ga0068852_100318291
224 Ga0068859_100030391
225 Ga0068859_100041443
226 Ga0068859_100314937
227 Ga0068859_100521272
228 Ga0068859_100596639
229 Ga0068859_100948529
230 Ga0068864_100027005
231 Ga0068864_100249161
232 Ga0068861_100003940
233 Ga0068861_100644630
234 Ga0068870_10520763
235 Ga0068863_100273826
236 Ga0068858_100143429
237 Ga0068858_100279451
238 Ga0068860_100005046
239 Ga0068860_100057618
240 Ga0068860_100066484
241 Ga0068860_100077916
242 Ga0068862_100362355
243 Ga0081539_10000395
244 Ga0097621_100297087
245 Ga0068871_100002555
246 Ga0075430_100034828
247 Ga0075431_100091859
248 Ga0075431_100143511
249 Ga0075433_10579479
250 Ga0075434_100141534
251 Ga0075434_100556495
252 Ga0075434_100762155
253 Ga0075429_100279620
254 Ga0097620_100030389
255 Ga0097620_100041442
256 Ga0097620_100097791
257 Ga0097620_100314937
258 Ga0097620_100521300
259 Ga0097620_100596681
260 Ga0097620_100948512
261 Ga0097620_100960269
262 Ga0111539_10022163
263 Ga0105247_10389416
264 Ga0114129_10053441
265 Ga0114129_11413903
266 Ga0105243_10197548
267 Ga0105243_11143225
268 Ga0105241_10180074
269 Ga0105241_10388703
270 Ga0105248_10030602
271 Ga0105248_10387005
272 Ga0105248_11309300
273 Ga0105237_10003124
274 Ga0105237_10122301
275 Ga0105238_10661207
276 Ga0105239_10858272
277 Ga0105239_11720898
278 Ga0105246_10031331
279 Ga0105246_10370350
280 Ga0157373_10002544
281 Ga0157375_10136737
282 Ga0163163_10002165
283 Ga0163163_10025050
284 Ga0163163_10176417
285 Ga0163163_10330893
286 Ga0157380_10482027
287 Ga0157380_10657570
288 Ga0157380_11067746
289 Ga0157377_10028976
290 Ga0157377_10038621
291 Ga0157377_10321921
292 Ga0157379_10176512
293 Ga0157379_10385587
294 Ga0157379_10395765
295 Ga0207653_10006567
296 Ga0207647_10000445
297 Ga0207643_10001352
298 Ga0207684_10000533
299 Ga0207654_10312813
300 Ga0207707_10426854
301 Ga0207681_10067955
302 Ga0207650_10000112
303 Ga0207650_10230757
304 Ga0207650_10282084
305 Ga0207650_10696351
306 Ga0207690_10166128
307 Ga0207670_10000957
308 Ga0207670_10538313
309 Ga0207670_10732204
310 Ga0207711_10080803
311 Ga0207711_10235888
312 Ga0207689_10510984
313 Ga0207651_10088117
314 Ga0207651_10595777
315 Ga0207712_10114094
316 Ga0207712_11204346
317 Ga0207640_10013276
318 Ga0207640_10170327
319 Ga0207703_10105626
320 Ga0207703_10141736
321 Ga0207708_10005201
322 Ga0207641_10174118
323 Ga0207641_11039361
324 Ga0207641_11065018
325 Ga0207676_10007751
326 Ga0207676_10067775
327 Ga0207676_10349165
328 Ga0207676_11263363
329 Ga0207674_10382543
330 Ga0207674_10391715
331 Ga0207675_100025568
332 Ga0207675_100027423
333 Ga0207675_100313679
334 Ga0207675_100553847
335 Ga0207675_100776641
336 Ga0207428_10137489
337 Ga0268265_10518509
338 Ga0268264_10930947
339 Ga0307405_10029101
340 Ga0307406_10099412
341 Ga0307412_10003279
342 Ga0307416_100648276
343 Ga0307414_10019896
344 Ga0373940_0088845
345 Ga0373951_0002939
346 Ga0395898_0219246
347 Ga0395901_0462111
348 Ga0439455_0018363
349 Ga0439458_0004994
350 Ga0451576_0838924
351 Ga0496102_1002290
352 Ga0496106_0029996
353 Ga0496107_0214747
354 Ga0496112_0124167
355 Ga0496112_0286101
356 Ga0501291_031904
357 Ga0501216_074146
358 Ga0501223_041100
359 Ga0501235_023694
360 nmdc:mga05p37_351076_c1
361 nmdc:mga09592_753835_c1
362 nmdc:mga0qj67_377072_c1
363 nmdc:mga06r32_379867_c1
364 nmdc:mga06r32_506527_c1
365 nmdc:mga06r32_658741_c1
366 nmdc:mga08y16_2372_c1
367 nmdc:mga0n895_101977_c1
368 nmdc:mga0n895_277023_c1
369 nmdc:mga0a205_282238_c1
370 nmdc:mga0a205_75667_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02834

LigT_PEase

LigT like Phosphoesterase

50

132

0.91

PF02834

LigT_PEase

LigT like Phosphoesterase

133

207

0.86

PF13563

2_5_RNA_ligase2

2'-5' RNA ligase superfamily

53

202

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vgj-assembly1.cif.gz_A crystal structure of 2'-5' rna ligase from pyrococcus horikoshii 0.8727 6 178
1vgj-assembly1.cif.gz_A crystal structure of 2'-5' rna ligase from pyrococcus horikoshii 0.8456 6 178
2d4g-assembly1.cif.gz_B structure of yjcg protein, a putative 2'-5' rna ligase from bacillus subtilis 0.8054 6 176
5ldj-assembly3.cif.gz_C crystal structure of e.coli ligt complexed with phosphate 0.8031 4 178
5ldo-assembly3.cif.gz_C crystal structure of e.coli ligt complexed with 3'-amp 0.8007 5 178
ID Description Score Start End Superfamily
1vgjA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8259 6 178 3.90.1140.10
af_Q58963_1_173_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8062 6 173 3.90.1140.10
1vgjA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8005 6 178 3.90.1140.10
2d4gB00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.7977 7 176 3.90.1140.10
2d4gB00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.7846 7 176 3.90.1140.10
ID Description Score Start End GO Terms
AF-A0A317I1J3-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9676 1 177 GO:0004113
GO:0008664
AF-A0A2V8Q7X0-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9672 1 176 GO:0004113
GO:0008664
AF-A0A7W1RA37-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9587 1 177 GO:0004113
GO:0008664
AF-A0A317I1J3-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9571 1 177 GO:0004113
GO:0008664
AF-A0A358AF24-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase 0.9561 2 177 GO:0004113
GO:0008664

Map