F283303

General Info

Members Datasets Scaffolds Average Seq Length
184 116 172 257

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0086385|Ga0501047_0086385_1678_2553
Length 291
Sequence MMAPPVQYNKAIQLPDKQGTAMIRSALQTRDFSVRRLALSAAEDAQIQRAVPIEAPVAIEICGVSYAVMMATPSDLLDYARGFVLSEGLADRSDPLDEIGIHEVGGGWIIRIQLPPEKAAAAVRRIRKRTAESSCGLXXMANIDEILRPLPPIATRIATSRSAIARALSSLGDHQPLSRETGAAHAAAFCAPDGRIVCVREDVGRHNALDKLIGALMSAGIEAASGFVLLTARCSYELVEKTVRAGCPLLVTISAPTSLAVERAIDAGLSLVTLARPDSAIVVCDTLKNIA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
6 2643221736 Bosea sp. Root483D1 Isolate Unclassified
7 2841760612 Bosea sp. Tri-49 Isolate Nodule
8 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
9 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
10 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
11 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
12 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
72 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
76 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
77 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
78 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
79 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
80 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
81 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
82 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
83 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
84 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
89 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
90 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
91 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
92 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
93 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
110 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
111 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
112 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
113 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
114 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
115 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere
116 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.39
Metatranscriptomes 1.09
Isolates 6.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.65
Nodule 1.63
Rhizoplane 4.35
Rhizosphere 63.04
Stem 0
Stem Tuber 0
Unclassified 10.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2739740 2162886006 Bacteria 1193
2 SwRhRL2b_contig_2770192 2162886007 Bacteria 20530
3 JGI25151J46595_10000015 3300003187 Bacteria 250420
4 JGI25151J46595_10000303 3300003187 Bacteria 53941
5 rootH1_10222670 3300003323 Bacteria 1847
6 Ga0006562J51391_1031033 3300003578 Bacteria 3725
7 Ga0006562J51391_1031034 3300003578 Bacteria 2570
8 Ga0055526_1000652 3300003771 Bacteria 26801
9 Ga0055526_1000700 3300003771 Bacteria 25408
10 Ga0055526_1000830 3300003771 Bacteria 23088
11 Ga0055524_1000051 3300003775 Bacteria 146215
12 Ga0055524_1034980 3300003775 Bacteria 1378
13 Ga0055536_1000943 3300003781 Bacteria 18711
14 Ga0055536_1001481 3300003781 Bacteria 14130
15 Ga0055536_1005438 3300003781 Bacteria 6226
16 Ga0055530_10000092 3300003791 Bacteria 77982
17 Ga0055531_10002266 3300003794 Bacteria 13019
18 Ga0055531_10003124 3300003794 Bacteria 10691
19 Ga0065704_10070556 3300005289 Bacteria 20704
20 Ga0065707_10000576 3300005295 Bacteria 23548
21 Ga0065707_10082736 3300005295 Bacteria 12392
22 Ga0070666_10038381 3300005335 Bacteria 3186
23 Ga0070669_100000094 3300005353 Bacteria 87053
24 Ga0070671_100000031 3300005355 Bacteria 108269
25 Ga0070671_100073615 3300005355 Bacteria 2853
26 Ga0068855_100001874 3300005563 Bacteria 26157
27 Ga0068855_100025017 3300005563 Bacteria 7146
28 Ga0068857_100248513 3300005577 Bacteria 1630
29 Ga0068859_100423643 3300005617 Bacteria 1427
30 Ga0068860_100003562 3300005843 Bacteria 16013
31 Ga0068860_100019070 3300005843 Bacteria 6660
32 Ga0068860_100046118 3300005843 Bacteria 4156
33 Ga0081539_10009283 3300005985 Bacteria 8266
34 Ga0105240_10006336 3300009093 Bacteria 17420
35 Ga0105240_10207744 3300009093 Unclassified 2290
36 Ga0105240_10378481 3300009093 Bacteria 1599
37 Ga0105247_10022002 3300009101 Bacteria 3837
38 Ga0105241_10076467 3300009174 Bacteria 2611
39 Ga0105248_10499166 3300009177 Bacteria 1372
40 Ga0105237_10002226 3300009545 Bacteria 24262
41 Ga0105238_10004103 3300009551 Bacteria 14453
42 Ga0105238_10070928 3300009551 Bacteria 3482
43 Ga0105249_10000079 3300009553 Bacteria 139904
44 Ga0105249_10060741 3300009553 Bacteria 3468
45 Ga0105239_10003033 3300010375 Bacteria 20894
46 Ga0105239_10292266 3300010375 Bacteria 1835
47 Ga0157372_10785635 3300013307 Bacteria 1106
48 Ga0157380_10000084 3300014326 Bacteria 52067
49 Ga0157380_10266834 3300014326 Bacteria 1558
50 Ga0213875_10000101 3300021388 Bacteria 96957
51 Ga0209673_1035638 3300025273 Bacteria 1487
52 Ga0209675_1000366 3300025291 Bacteria 38418
53 Ga0209675_1003185 3300025291 Bacteria 7963
54 Ga0209676_1000081 3300025292 Bacteria 285297
55 Ga0209676_1000133 3300025292 Bacteria 184430
56 Ga0209676_1000187 3300025292 Bacteria 141338
57 Ga0209025_1000010 3300025294 Bacteria 986612
58 Ga0209025_1007910 3300025294 Bacteria 7787
59 Ga0209025_1022070 3300025294 Bacteria 3396
60 Ga0209564_1000048 3300025295 Bacteria 364806
61 Ga0209564_1000074 3300025295 Bacteria 286043
62 Ga0209050_1000067 3300025298 Bacteria 304206
63 Ga0209050_1002482 3300025298 Bacteria 15635
64 Ga0209256_1000041 3300025299 Bacteria 364827
65 Ga0209256_1001113 3300025299 Bacteria 30755
66 Ga0209257_1000132 3300025304 Bacteria 210870
67 Ga0209257_1000359 3300025304 Bacteria 93026
68 Ga0209257_1002933 3300025304 Bacteria 15716
69 Ga0209257_1046264 3300025304 Bacteria 1257
70 Ga0207710_10009234 3300025900 Bacteria 4146
71 Ga0207680_10038843 3300025903 Bacteria 2758
72 Ga0207695_10033257 3300025913 Bacteria 5627
73 Ga0207695_10356974 3300025913 Bacteria 1348
74 Ga0207671_10073423 3300025914 Bacteria 2555
75 Ga0207681_10000995 3300025923 Bacteria 18525
76 Ga0207644_10000018 3300025931 Bacteria 174861
77 Ga0207667_10030856 3300025949 Bacteria 5793
78 Ga0207667_10043105 3300025949 Bacteria 4790
79 Ga0207712_10000030 3300025961 Bacteria 216514
80 Ga0207658_10446772 3300025986 Bacteria 1144
81 Ga0207641_10060712 3300026088 Bacteria 3223
82 Ga0209974_10008858 3300027876 Bacteria 3428
83 Ga0268264_10007290 3300028381 Bacteria 9253
84 Ga0268264_10041410 3300028381 Bacteria 3810
85 Ga0307406_10029153 3300031901 Bacteria 3341
86 Ga0307412_10204114 3300031911 Bacteria 1503
87 Ga0307412_10571947 3300031911 Bacteria 952
88 Ga0307414_10002020 3300032004 Bacteria 10542
89 Ga0395899_0067347 3300037312 Bacteria 2627
90 Ga0395899_0088903 3300037312 Bacteria 2241
91 Ga0395899_0089539 3300037312 Bacteria 2232
92 Ga0395900_0001466 3300037418 Bacteria 28150
93 Ga0395900_0021680 3300037418 Bacteria 6568
94 Ga0395900_0100803 3300037418 Bacteria 2966
95 Ga0395900_0369541 3300037418 Bacteria 1404
96 Ga0395898_0045414 3300037466 Bacteria 4318
97 Ga0395898_0281596 3300037466 Bacteria 1586
98 Ga0395905_0003607 3300037471 Bacteria 16456
99 Ga0395905_0016056 3300037471 Bacteria 7117
100 Ga0395905_0033069 3300037471 Bacteria 4862
101 Ga0395905_0044425 3300037471 Bacteria 4170
102 Ga0395905_0136085 3300037471 Bacteria 2311
103 Ga0395905_0463858 3300037471 Bacteria 1165
104 Ga0395905_0480271 3300037471 Bacteria 1142
105 Ga0436364_0308475 3300037853 Bacteria 1704
106 Ga0395901_0019272 3300038443 Bacteria 6974
107 Ga0395901_0025265 3300038443 Bacteria 6098
108 Ga0395901_0030310 3300038443 Bacteria 5573
109 Ga0395901_0115125 3300038443 Bacteria 2824
110 Ga0439448_0013243 3300042005 Bacteria 2476
111 Ga0439455_0001642 3300042012 Bacteria 3831
112 Ga0466965_0154405 3300044683 Bacteria 1201
113 Ga0466971_0160485 3300044719 Bacteria 1052
114 Ga0495596_0000042 3300046500 Bacteria 90746
115 Ga0495607_0026125 3300046501 Bacteria 3625
116 Ga0495583_0000001 3300046506 Bacteria 811973
117 Ga0495583_0023240 3300046506 Bacteria 3141
118 Ga0495606_0014699 3300046507 Bacteria 6087
119 Ga0495610_0002861 3300046512 Bacteria 14020
120 Ga0495610_0044236 3300046512 Bacteria 2212
121 Ga0495643_0000054 3300046522 Bacteria 198757
122 Ga0495643_0007024 3300046522 Bacteria 7314
123 Ga0495643_0039350 3300046522 Bacteria 2586
124 Ga0495643_0065153 3300046522 Bacteria 1924
125 Ga0495668_0000002 3300046616 Bacteria 763179
126 Ga0495668_0142377 3300046616 Bacteria 1312
127 Ga0495625_0000430 3300046660 Bacteria 63143
128 Ga0495625_0006666 3300046660 Bacteria 10243
129 Ga0495625_0438482 3300046660 Bacteria 809
130 Ga0495615_0000195 3300048090 Bacteria 14497
131 Ga0496101_0522109 3300048904 Bacteria 938
132 Ga0496102_0611297 3300048905 Bacteria 1013
133 Ga0496104_0024516 3300048907 Bacteria 5549
134 Ga0496105_0022048 3300048908 Bacteria 5156
135 Ga0496106_0010090 3300048909 Bacteria 6976
136 Ga0496107_0008637 3300048910 Bacteria 7057
137 Ga0496112_0065920 3300048915 Bacteria 3573
138 Ga0496113_0000143 3300048916 Bacteria 30955
139 Ga0496116_0108313 3300048919 Bacteria 1641
140 Ga0496122_0005598 3300048925 Bacteria 14868
141 Ga0496122_0015099 3300048925 Bacteria 7408
142 Ga0496122_0060015 3300048925 Bacteria 2804
143 Ga0496123_0004527 3300048926 Bacteria 14525
144 Ga0496123_0005341 3300048926 Bacteria 12986
145 Ga0496123_0034462 3300048926 Bacteria 3626
146 Ga0496124_0010809 3300048927 Bacteria 9195
147 Ga0501031_0155547 3300049568 Bacteria 1494
148 Ga0501032_0005241 3300049569 Bacteria 9647
149 Ga0501033_0012025 3300049570 Bacteria 6609
150 Ga0501034_0000162 3300049571 Bacteria 125834
151 Ga0501034_0036069 3300049571 Bacteria 5013
152 Ga0501034_0235779 3300049571 Bacteria 1777
153 Ga0501036_0007192 3300049572 Bacteria 9067
154 Ga0501036_0506876 3300049572 Bacteria 1004
155 Ga0501037_0059438 3300049573 Bacteria 2788
156 Ga0501038_0115188 3300049574 Bacteria 2222
157 Ga0501043_0257637 3300049579 Bacteria 1342
158 Ga0501046_0002168 3300049580 Bacteria 18541
159 Ga0501046_0429105 3300049580 Bacteria 952
160 Ga0501047_0038761 3300049581 Bacteria 4610
161 Ga0501047_0086385 3300049581 Bacteria 3014
162 Ga0501047_0428175 3300049581 Bacteria 1154
163 Ga0501035_0003766 3300049822 Bacteria 14450
164 Ga0501044_0011466 3300049823 Bacteria 9603
165 Ga0501044_0234010 3300049823 Bacteria 1783
166 nmdc:mga0rr50_541608_c1 3300050513 Bacteria 991
167 Ga0500592_037529 3300053116 Bacteria 783
168 Ga0500597_000875 3300053120 Bacteria 6967
169 Ga0500616_0089096 3300053153 Bacteria 1532
170 Ga0500624_000032 3300053157 Bacteria 104403
171 Ga0500627_0149363 3300053158 Bacteria 1055
172 Ga0500637_0000019 3300053178 Bacteria 65170

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0014699 Ga0495606_0014699_2208_2948 216
2 3300046522 Ga0495643_0039350 Ga0495643_0039350_308_1048 216
3 3300046660 Ga0495625_0438482 Ga0495625_0438482_11_748 228
4 3300053116 Ga0500592_037529 Ga0500592_037529_14_751 228
5 3300025291 Ga0209675_1000366 Ga0209675_100036623 229
6 3300025294 Ga0209025_1007910 Ga0209025_10079107 229
7 3300031901 Ga0307406_10029153 Ga0307406_100291534 234
8 3300031911 Ga0307412_10571947 Ga0307412_105719471 234
9 3300046616 Ga0495668_0000002 Ga0495668_0000002_612096_612917 234
10 3300005563 Ga0068855_100025017 Ga0068855_1000250174 235
11 3300025949 Ga0207667_10043105 Ga0207667_100431052 235
12 3300050513 nmdc:mga0rr50_541608_c1 nmdc:mga0rr50_541608_c1_72_785 235
13 3300003187 JGI25151J46595_10000015 JGI25151J46595_10000015201 237
14 3300003187 JGI25151J46595_10000303 JGI25151J46595_1000030347 237
15 3300003578 Ga0006562J51391_1031033 Ga0006562J51391_10310332 237
16 3300003578 Ga0006562J51391_1031034 Ga0006562J51391_10310343 237
17 3300003771 Ga0055526_1000652 Ga0055526_10006528 237
18 3300003771 Ga0055526_1000830 Ga0055526_100083022 237
19 3300003781 Ga0055536_1005438 Ga0055536_10054381 237
20 3300003791 Ga0055530_10000092 Ga0055530_1000009228 237
21 3300003794 Ga0055531_10002266 Ga0055531_100022663 237
22 3300003794 Ga0055531_10003124 Ga0055531_100031242 237
23 3300025292 Ga0209676_1000133 Ga0209676_1000133169 237
24 3300025294 Ga0209025_1000010 Ga0209025_1000010659 237
25 3300025295 Ga0209564_1000074 Ga0209564_100007479 237
26 3300025298 Ga0209050_1000067 Ga0209050_1000067163 237
27 3300025304 Ga0209257_1000132 Ga0209257_100013218 237
28 3300025304 Ga0209257_1046264 Ga0209257_10462642 237
29 3300046512 Ga0495610_0002861 Ga0495610_0002861_8771_9637 237
30 3300048919 Ga0496116_0108313 Ga0496116_0108313_671_1513 237
31 3300048925 Ga0496122_0005598 Ga0496122_0005598_13378_14220 237
32 3300048925 Ga0496122_0060015 Ga0496122_0060015_117_959 237
33 3300048926 Ga0496123_0005341 Ga0496123_0005341_2364_3206 237
34 3300048926 Ga0496123_0034462 Ga0496123_0034462_1949_2791 237
35 3300046660 Ga0495625_0000430 Ga0495625_0000430_22216_23040 238
36 3300003771 Ga0055526_1000700 Ga0055526_10007002 239
37 3300003775 Ga0055524_1000051 Ga0055524_10000512 239
38 3300025273 Ga0209673_1035638 Ga0209673_10356382 239
39 3300025291 Ga0209675_1003185 Ga0209675_10031855 239
40 3300025295 Ga0209564_1000048 Ga0209564_1000048261 239
41 3300025298 Ga0209050_1002482 Ga0209050_10024827 239
42 3300025299 Ga0209256_1000041 Ga0209256_1000041261 239
43 3300037312 Ga0395899_0067347 Ga0395899_0067347_895_1752 239
44 3300037418 Ga0395900_0100803 Ga0395900_0100803_1395_2252 239
45 3300038443 Ga0395901_0019272 Ga0395901_0019272_5372_6229 239
46 3300048090 Ga0495615_0000195 Ga0495615_0000195_2684_3556 240
47 3300048925 Ga0496122_0015099 Ga0496122_0015099_2142_3014 240
48 3300048926 Ga0496123_0004527 Ga0496123_0004527_2623_3495 240
49 3300048927 Ga0496124_0010809 Ga0496124_0010809_460_1332 240
50 3300042012 Ga0439455_0001642 Ga0439455_0001642_3090_3815 241
51 3300046512 Ga0495610_0044236 Ga0495610_0044236_466_1263 241
52 3300005335 Ga0070666_10038381 Ga0070666_100383811 242
53 3300005353 Ga0070669_100000094 Ga0070669_10000009451 242
54 3300005355 Ga0070671_100000031 Ga0070671_10000003137 242
55 3300005843 Ga0068860_100019070 Ga0068860_1000190705 242
56 3300009093 Ga0105240_10378481 Ga0105240_103784812 242
57 3300009177 Ga0105248_10499166 Ga0105248_104991662 242
58 3300009551 Ga0105238_10070928 Ga0105238_100709283 242
59 3300009553 Ga0105249_10060741 Ga0105249_100607414 242
60 3300025913 Ga0207695_10356974 Ga0207695_103569742 242
61 3300025923 Ga0207681_10000995 Ga0207681_100009957 242
62 3300025931 Ga0207644_10000018 Ga0207644_1000001855 242
63 3300025986 Ga0207658_10446772 Ga0207658_104467721 242
64 3300026088 Ga0207641_10060712 Ga0207641_100607122 242
65 3300028381 Ga0268264_10041410 Ga0268264_100414102 242
66 3300044683 Ga0466965_0154405 Ga0466965_0154405_152_928 242
67 3300044719 Ga0466971_0160485 Ga0466971_0160485_123_899 242
68 3300048905 Ga0496102_0611297 Ga0496102_0611297_64_864 242
69 3300048907 Ga0496104_0024516 Ga0496104_0024516_2188_2988 242
70 3300048908 Ga0496105_0022048 Ga0496105_0022048_2629_3429 242
71 3300048909 Ga0496106_0010090 Ga0496106_0010090_1637_2437 242
72 3300048910 Ga0496107_0008637 Ga0496107_0008637_3874_4674 242
73 3300048915 Ga0496112_0065920 Ga0496112_0065920_1918_2718 242
74 3300048916 Ga0496113_0000143 Ga0496113_0000143_4248_5048 242
75 3300031911 Ga0307412_10204114 Ga0307412_102041142 243
76 3300046522 Ga0495643_0000054 Ga0495643_0000054_172794_173702 244
77 3300049568 Ga0501031_0155547 Ga0501031_0155547_361_1185 244
78 3300049569 Ga0501032_0005241 Ga0501032_0005241_7071_7895 244
79 3300049570 Ga0501033_0012025 Ga0501033_0012025_2257_3081 244
80 3300049571 Ga0501034_0235779 Ga0501034_0235779_665_1489 244
81 3300049572 Ga0501036_0007192 Ga0501036_0007192_5113_5937 244
82 3300049573 Ga0501037_0059438 Ga0501037_0059438_241_1065 244
83 3300049574 Ga0501038_0115188 Ga0501038_0115188_316_1140 244
84 3300049579 Ga0501043_0257637 Ga0501043_0257637_196_1020 244
85 3300049581 Ga0501047_0038761 Ga0501047_0038761_3309_4133 244
86 3300049822 Ga0501035_0003766 Ga0501035_0003766_7703_8527 244
87 3300049823 Ga0501044_0011466 Ga0501044_0011466_4369_5193 244
88 3300003775 Ga0055524_1034980 Ga0055524_10349802 246
89 3300025294 Ga0209025_1022070 Ga0209025_10220703 246
90 3300025299 Ga0209256_1001113 Ga0209256_100111321 246
91 3300025304 Ga0209257_1002933 Ga0209257_100293313 247
92 3300053120 Ga0500597_000875 Ga0500597_000875_1540_2316 247
93 3300053157 Ga0500624_000032 Ga0500624_000032_47457_48233 247
94 3300053178 Ga0500637_0000019 Ga0500637_0000019_8222_8998 247
95 3300048904 Ga0496101_0522109 Ga0496101_0522109_70_927 249
96 2162886007 SwRhRL2b_contig_2770192 SwRhRL2b_0210.00007520 251
97 3300003323 rootH1_10222670 rootH1_102226702 251
98 3300005289 Ga0065704_10070556 Ga0065704_1007055615 251
99 3300037312 Ga0395899_0089539 Ga0395899_0089539_30_848 251
100 3300037418 Ga0395900_0001466 Ga0395900_0001466_6168_6986 251
101 3300037466 Ga0395898_0045414 Ga0395898_0045414_130_948 251
102 3300037471 Ga0395905_0003607 Ga0395905_0003607_13802_14620 251
103 3300038443 Ga0395901_0115125 Ga0395901_0115125_479_1297 251
104 3300003781 Ga0055536_1001481 Ga0055536_100148111 252
105 3300046500 Ga0495596_0000042 Ga0495596_0000042_2017_2877 252
106 3300046506 Ga0495583_0023240 Ga0495583_0023240_1660_2520 252
107 3300046522 Ga0495643_0065153 Ga0495643_0065153_729_1571 252
108 3300049571 Ga0501034_0036069 Ga0501034_0036069_263_1087 253
109 3300049823 Ga0501044_0234010 Ga0501044_0234010_894_1730 253
110 3300009093 Ga0105240_10207744 Ga0105240_102077442 254
111 3300025292 Ga0209676_1000187 Ga0209676_100018715 255
112 3300049572 Ga0501036_0506876 Ga0501036_0506876_199_972 255
113 3300053153 Ga0500616_0089096 Ga0500616_0089096_89_907 255
114 3300005843 Ga0068860_100003562 Ga0068860_10000356215 257
115 3300009101 Ga0105247_10022002 Ga0105247_100220022 257
116 3300009553 Ga0105249_10000079 Ga0105249_1000007953 257
117 3300025900 Ga0207710_10009234 Ga0207710_100092342 257
118 3300025961 Ga0207712_10000030 Ga0207712_10000030122 257
119 3300037853 Ga0436364_0308475 Ga0436364_0308475_511_1341 257
120 3300037471 Ga0395905_0033069 Ga0395905_0033069_1568_2410 258
121 3300037471 Ga0395905_0136085 Ga0395905_0136085_1105_1881 258
122 3300042005 Ga0439448_0013243 Ga0439448_0013243_894_1670 258
123 3300025304 Ga0209257_1000359 Ga0209257_100035950 261
124 3300049580 Ga0501046_0429105 Ga0501046_0429105_29_838 261
125 3300005295 Ga0065707_10082736 Ga0065707_100827366 262
126 3300005843 Ga0068860_100046118 Ga0068860_1000461184 262
127 3300014326 Ga0157380_10266834 Ga0157380_102668342 262
128 3300028381 Ga0268264_10007290 Ga0268264_100072904 262
129 3300032004 Ga0307414_10002020 Ga0307414_100020206 262
130 3300046501 Ga0495607_0026125 Ga0495607_0026125_1315_2175 262
131 3300046522 Ga0495643_0007024 Ga0495643_0007024_763_1623 262
132 3300046616 Ga0495668_0142377 Ga0495668_0142377_29_889 262
133 3300046660 Ga0495625_0006666 Ga0495625_0006666_2964_3824 262
134 3300053158 Ga0500627_0149363 Ga0500627_0149363_139_930 263
135 iso_pu_bacteria 2852680915 2852684159 263
136 iso_pu_bacteria 2903748898 2903751691 263
137 iso_pu_bacteria 2906635258 2906637548 263
138 iso_pu_bacteria 2906660503 2906661146 263
139 3300021388 Ga0213875_10000101 Ga0213875_1000010172 264
140 iso_pu_bacteria 2643221560 2643822232 264
141 3300013307 Ga0157372_10785635 Ga0157372_107856351 265
142 3300037312 Ga0395899_0088903 Ga0395899_0088903_1326_2168 265
143 3300037418 Ga0395900_0021680 Ga0395900_0021680_4330_5127 265
144 3300037466 Ga0395898_0281596 Ga0395898_0281596_306_1103 265
145 3300037471 Ga0395905_0016056 Ga0395905_0016056_3927_4724 265
146 3300037471 Ga0395905_0044425 Ga0395905_0044425_1126_1923 265
147 3300037471 Ga0395905_0480271 Ga0395905_0480271_329_1126 265
148 3300046506 Ga0495583_0000001 Ga0495583_0000001_636549_637364 265
149 3300027876 Ga0209974_10008858 Ga0209974_100088582 266
150 3300038443 Ga0395901_0030310 Ga0395901_0030310_2679_3479 266
151 iso_pu_bacteria 8057101203 8057102237 266
152 3300037418 Ga0395900_0369541 Ga0395900_0369541_433_1242 268
153 3300037471 Ga0395905_0463858 Ga0395905_0463858_229_1038 268
154 3300038443 Ga0395901_0025265 Ga0395901_0025265_2117_2926 268
155 iso_pu_bacteria 2643221563 2643833038 269
156 iso_pu_bacteria 2643221608 2644053167 269
157 iso_pu_bacteria 2852653556 2852654211 269
158 3300003781 Ga0055536_1000943 Ga0055536_100094322 270
159 3300005355 Ga0070671_100073615 Ga0070671_1000736152 270
160 3300005563 Ga0068855_100001874 Ga0068855_10000187416 270
161 3300005577 Ga0068857_100248513 Ga0068857_1002485132 270
162 3300005617 Ga0068859_100423643 Ga0068859_1004236432 270
163 3300005985 Ga0081539_10009283 Ga0081539_100092833 270
164 3300009093 Ga0105240_10006336 Ga0105240_100063369 270
165 3300009174 Ga0105241_10076467 Ga0105241_100764672 270
166 3300009545 Ga0105237_10002226 Ga0105237_1000222616 270
167 3300009551 Ga0105238_10004103 Ga0105238_1000410314 270
168 3300010375 Ga0105239_10003033 Ga0105239_100030339 270
169 3300010375 Ga0105239_10292266 Ga0105239_102922662 270
170 3300025292 Ga0209676_1000081 Ga0209676_1000081239 270
171 3300025903 Ga0207680_10038843 Ga0207680_100388433 270
172 3300025913 Ga0207695_10033257 Ga0207695_100332577 270
173 3300025914 Ga0207671_10073423 Ga0207671_100734232 270
174 3300025949 Ga0207667_10030856 Ga0207667_100308562 270
175 3300049571 Ga0501034_0000162 Ga0501034_0000162_35863_36681 270
176 3300049580 Ga0501046_0002168 Ga0501046_0002168_12678_13493 270
177 3300049581 Ga0501047_0428175 Ga0501047_0428175_172_1014 270
178 2162886006 SwRhRL3b_contig_2739740 SwRhRL3b_0171.00001410 271
179 3300005295 Ga0065707_10000576 Ga0065707_1000057623 271
180 3300014326 Ga0157380_10000084 Ga0157380_100000842 271
181 3300049581 Ga0501047_0086385 Ga0501047_0086385_1678_2553 271
182 iso_pu_bacteria 2643221736 2644744359 271
183 iso_pu_bacteria 2841760612 2841765358 271
184 iso_pu_bacteria 8057529695 8057532468 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02634

FdhD-NarQ

FdhD/NarQ family

52

288

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pde-assembly1.cif.gz_A-2 crystal structure of fdhd in complex with gdp 0.9199 11 271
2pw9-assembly2.cif.gz_C crystal structure of a putative formate dehydrogenase accessory protein from desulfotalea psychrophila 0.9076 9 271
8sff-assembly1.cif.gz_A cct g beta 5 complex closed state 0 0.9034 219 257
4pde-assembly1.cif.gz_A-2 crystal structure of fdhd in complex with gdp 0.9019 11 271
2pw9-assembly2.cif.gz_C crystal structure of a putative formate dehydrogenase accessory protein from desulfotalea psychrophila 0.8959 9 271
ID Description Score Start End Superfamily
af_P9WNF1_130_276_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9597 137 271 3.40.140.10
af_P32177_133_277_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.95 127 271 3.40.140.10
af_P32177_133_277_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9374 127 271 3.40.140.10
af_Q57743_81_227_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9233 134 271 3.40.140.10
af_Q2FVX3_117_265_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9206 130 266 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A1U9LDW5-F1-model_v4 Formate dehydrogenase family accessory protein FdhD 0.9906 164 264 GO:0005737
GO:0006777
GO:0016783
AF-A0A7L4PM98-F1-model_v4 Sulfurtransferase FdhD 0.9806 164 265 GO:0005737
GO:0006777
GO:0016783
AF-A0A6L3N6V3-F1-model_v4 Sulfurtransferase FdhD 0.9781 149 266 GO:0005737
GO:0006777
GO:0016783
AF-A0A1I7G9P9-F1-model_v4 deleted 0.9767 177 265
AF-A0A438LXR7-F1-model_v4 Formate dehydrogenase accessory protein FdhD 0.9737 209 264 GO:0003954
GO:0016020
GO:0016783
GO:0022904

Feature Viewer

pLDDT pTM Quality
88.73 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map