F283213

General Info

Members Datasets Scaffolds Average Seq Length
184 144 368 86

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0788697|Ga0496104_0788697_319_615
Length 98
Sequence MRACIRESYLVYPVAMADLAQQFADAQARIKPVTVPSATMLELYALFKQATFGDATGERPGILDVRGRAKYDAWAHKKGTTKDAAMQAYIALVAKLAP

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
65 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
71 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
76 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
86 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
87 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
88 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
89 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
90 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
91 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
92 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
110 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
111 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
112 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
113 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
124 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
125 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
126 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
127 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
128 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
129 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
130 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
131 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
132 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
133 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
138 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 5.98
Rhizosphere 81.52
Stem 0
Stem Tuber 0
Unclassified 16.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0788697 3300048907 Bacteria 856
2 rootH2_10084132 3300003320 Bacteria 1444
3 rootH2_10184794 3300003320 Bacteria 1533
4 rootH1_10125741 3300003323 Bacteria 7185
5 rootH1_10132525 3300003323 Bacteria 1338
6 Ga0070683_100150701 3300005329 Bacteria 2205
7 Ga0070683_101620630 3300005329 Unclassified 622
8 Ga0070683_101724715 3300005329 Unclassified 602
9 Ga0070690_100748796 3300005330 Bacteria 754
10 Ga0070666_10758788 3300005335 Bacteria 713
11 Ga0070680_101956511 3300005336 Bacteria 508
12 Ga0070682_100426883 3300005337 Bacteria 1009
13 Ga0068868_101687972 3300005338 Bacteria 597
14 Ga0070689_100027787 3300005340 Bacteria 4268
15 Ga0070667_100432952 3300005367 Unclassified 1200
16 Ga0070678_101769407 3300005456 Bacteria 582
17 Ga0070706_100151124 3300005467 Bacteria 2167
18 Ga0070698_100000128 3300005471 Bacteria 65860
19 Ga0070679_100017168 3300005530 Bacteria 7000
20 Ga0070684_100014703 3300005535 Bacteria 6349
21 Ga0070695_100268618 3300005545 Bacteria 1249
22 Ga0070665_100002759 3300005548 Bacteria 19041
23 Ga0068855_100000030 3300005563 Bacteria 171124
24 Ga0068855_101579068 3300005563 Bacteria 672
25 Ga0068856_100189138 3300005614 Bacteria 2072
26 Ga0068852_100294237 3300005616 Bacteria 1570
27 Ga0068864_100601833 3300005618 Bacteria 1067
28 Ga0068864_101345503 3300005618 Bacteria 715
29 Ga0068864_101855736 3300005618 Bacteria 608
30 Ga0068866_10166071 3300005718 Bacteria 1292
31 Ga0068861_102212158 3300005719 Bacteria 551
32 Ga0068870_10984668 3300005840 Unclassified 600
33 Ga0068863_100130748 3300005841 Bacteria 2397
34 Ga0068863_100850509 3300005841 Bacteria 911
35 Ga0068863_101574985 3300005841 Unclassified 666
36 Ga0070717_10048246 3300006028 Bacteria 3492
37 Ga0070712_100535851 3300006175 Bacteria 985
38 Ga0097621_100433037 3300006237 Bacteria 1182
39 Ga0097621_100538885 3300006237 Bacteria 1061
40 Ga0068871_100106010 3300006358 Bacteria 2359
41 Ga0105240_11040442 3300009093 Unclassified 874
42 Ga0105240_11330858 3300009093 Bacteria 757
43 Ga0111539_11386188 3300009094 Bacteria 815
44 Ga0105241_10303612 3300009174 Bacteria 1371
45 Ga0105238_12175401 3300009551 Bacteria 589
46 Ga0105249_11356058 3300009553 Bacteria 783
47 Ga0105239_11488947 3300010375 Bacteria 782
48 Ga0157370_10137265 3300013104 Bacteria 2279
49 Ga0157374_12267233 3300013296 Unclassified 570
50 Ga0157372_11431445 3300013307 Bacteria 797
51 Ga0163163_12472205 3300014325 Unclassified 577
52 Ga0157380_10773045 3300014326 Bacteria 974
53 Ga0157377_10495265 3300014745 Bacteria 853
54 Ga0157376_10941212 3300014969 Bacteria 884
55 Ga0213876_10149153 3300021384 Bacteria 1244
56 Ga0209565_1049379 3300025263 Bacteria 760
57 Ga0207642_10349674 3300025899 Bacteria 872
58 Ga0207680_10625978 3300025903 Bacteria 770
59 Ga0207684_10375594 3300025910 Bacteria 1223
60 Ga0207695_10729347 3300025913 Unclassified 871
61 Ga0207652_10002311 3300025921 Bacteria 16155
62 Ga0207689_10422981 3300025942 Bacteria 1112
63 Ga0207689_10987815 3300025942 Bacteria 710
64 Ga0207661_10108913 3300025944 Bacteria 2340
65 Ga0207661_10893519 3300025944 Bacteria 818
66 Ga0207661_12096863 3300025944 Unclassified 511
67 Ga0207667_10000104 3300025949 Bacteria 134147
68 Ga0207712_11060827 3300025961 Bacteria 720
69 Ga0207677_10026600 3300026023 Bacteria 3632
70 Ga0207702_10588451 3300026078 Unclassified 1091
71 Ga0207702_10859071 3300026078 Archaea 898
72 Ga0207641_10102618 3300026088 Bacteria 2522
73 Ga0207641_11816435 3300026088 Unclassified 611
74 Ga0207674_10179991 3300026116 Bacteria 2065
75 Ga0268266_10020948 3300028379 Bacteria 5573
76 Ga0268266_11069749 3300028379 Bacteria 781
77 Ga0268265_10808963 3300028380 Bacteria 914
78 Ga0268264_11859121 3300028381 Bacteria 612
79 Ga0307515_10024945 3300028794 Bacteria 10376
80 Ga0265338_10106200 3300028800 Bacteria 2274
81 Ga0307512_10227536 3300030522 Bacteria 964
82 Ga0265328_10133620 3300031239 Bacteria 929
83 Ga0265316_11244125 3300031344 Bacteria 514
84 Ga0307513_10014963 3300031456 Bacteria 9423
85 Ga0307513_10049293 3300031456 Bacteria 4563
86 Ga0307509_10006736 3300031507 Bacteria 15307
87 Ga0307509_10122803 3300031507 Bacteria 2571
88 Ga0307408_100046025 3300031548 Bacteria 3119
89 Ga0307514_10005780 3300031649 Bacteria 10930
90 Ga0316575_10016086 3300031665 Bacteria 2826
91 Ga0316576_10000843 3300031727 Bacteria 15542
92 Ga0316576_10205167 3300031727 Bacteria 1484
93 Ga0316578_10349935 3300031728 Bacteria 879
94 Ga0307516_10002224 3300031730 Bacteria 26274
95 Ga0307516_10645964 3300031730 Bacteria 713
96 Ga0316585_10170105 3300032137 Bacteria 720
97 Ga0316580_10015749 3300032139 Bacteria 2314
98 Ga0307510_10194644 3300033180 Bacteria 1571
99 Ga0373943_0599618 3300035170 Bacteria 649
100 Ga0316574_0006567 3300035398 Bacteria 6297
101 Ga0316574_0160640 3300035398 Bacteria 1447
102 Ga0373937_1701288 3300036401 Unclassified 578
103 Ga0316582_0263680 3300036647 Bacteria 1181
104 Ga0316582_1071848 3300036647 Unclassified 549
105 Ga0316584_0066204 3300036712 Bacteria 2707
106 Ga0395905_0436723 3300037471 Unclassified 1206
107 Ga0436365_0954026 3300039437 Bacteria 2326
108 Ga0436365_1133209 3300039437 Bacteria 1247
109 Ga0451793_0952761 3300041452 Bacteria 1564
110 Ga0451797_1104350 3300041453 Unclassified 710
111 Ga0451797_1301942 3300041453 Bacteria 5471
112 Ga0451807_0877251 3300041486 Bacteria 6658
113 Ga0451837_1287397 3300041494 Unclassified 605
114 Ga0451839_0877483 3300041496 Bacteria 647
115 Ga0451849_0594359 3300041505 Bacteria 571
116 Ga0451843_0760543 3300041509 Bacteria 792
117 Ga0439435_0161633 3300042436 Bacteria 723
118 Ga0451577_0289195 3300042876 Bacteria 1485
119 Ga0451577_0843743 3300042876 Unclassified 826
120 Ga0451577_1191293 3300042876 Bacteria 680
121 Ga0451577_1905775 3300042876 Unclassified 520
122 Ga0466965_0070874 3300044683 Bacteria 1753
123 Ga0453684_0493825 3300044712 Unclassified 1356
124 Ga0453684_0738978 3300044712 Unclassified 1066
125 Ga0466971_0201820 3300044719 Bacteria 939
126 Ga0466971_0452150 3300044719 Unclassified 630
127 Ga0466957_0428773 3300044842 Bacteria 908
128 Ga0466960_0026873 3300044901 Bacteria 2619
129 Ga0451576_0035074 3300045051 Bacteria 5324
130 Ga0495585_0018269 3300046492 Bacteria 4047
131 Ga0495583_0031915 3300046506 Bacteria 2547
132 Ga0495613_0096052 3300046689 Bacteria 2143
133 Ga0495581_0702372 3300047315 Bacteria 583
134 Ga0496105_0482296 3300048908 Bacteria 975
135 Ga0496110_0451957 3300048913 Bacteria 1171
136 Ga0496112_0534567 3300048915 Bacteria 1107
137 Ga0496114_0599465 3300048917 Bacteria 971
138 Ga0496114_0655054 3300048917 Bacteria 923
139 Ga0496115_0286269 3300048918 Unclassified 1352
140 Ga0496116_0284577 3300048919 Unclassified 798
141 Ga0501292_005792 3300049515 Bacteria 1735
142 Ga0501296_005932 3300049519 Bacteria 1374
143 Ga0501298_085303 3300049521 Bacteria 700
144 Ga0501299_004389 3300049522 Bacteria 2104
145 Ga0501034_0435924 3300049571 Bacteria 1230
146 Ga0501034_1205181 3300049571 Bacteria 636
147 Ga0501037_0446840 3300049573 Bacteria 882
148 Ga0501037_0825841 3300049573 Bacteria 611
149 Ga0501043_0177214 3300049579 Bacteria 1662
150 Ga0501047_0258025 3300049581 Bacteria 1591
151 Ga0501068_0225866 3300049584 Bacteria 1190
152 Ga0501069_0230361 3300049585 Bacteria 1078
153 Ga0501070_0015968 3300049586 Bacteria 6310
154 Ga0501070_0527895 3300049586 Bacteria 946
155 Ga0501073_0238174 3300049589 Bacteria 1257
156 Ga0501077_0809612 3300049593 Unclassified 602
157 Ga0501202_039013 3300049652 Unclassified 1019
158 Ga0501214_099081 3300049659 Bacteria 511
159 Ga0501217_027955 3300049661 Bacteria 1371
160 Ga0501217_247549 3300049661 Unclassified 573
161 Ga0501223_090499 3300049663 Bacteria 621
162 Ga0501224_021989 3300049664 Bacteria 951
163 Ga0501227_000708 3300049665 Bacteria 7270
164 Ga0501227_018757 3300049665 Bacteria 1573
165 Ga0501227_156743 3300049665 Bacteria 631
166 Ga0501227_235845 3300049665 Unclassified 521
167 Ga0501230_000164 3300049667 Bacteria 5553
168 Ga0501233_000626 3300049668 Bacteria 5768
169 Ga0501236_003590 3300049670 Bacteria 1811
170 Ga0501221_232497 3300049704 Bacteria 523
171 Ga0501225_0007194 3300049705 Bacteria 3231
172 Ga0501225_0036198 3300049705 Bacteria 1360
173 Ga0501080_0217123 3300049742 Bacteria 1751
174 Ga0501081_0297468 3300049743 Bacteria 1184
175 Ga0501044_0175390 3300049823 Bacteria 2113
176 Ga0501204_009262 3300049850 Bacteria 1135
177 Ga0501220_01403 3300049852 Bacteria 898
178 nmdc:mga08y16_1005836_c1 3300050511 Bacteria 813
179 Ga0495655_0077742 3300053083 Bacteria 942
180 Ga0495619_0659769 3300053085 Bacteria 713
181 Ga0501084_0243381 3300054114 Bacteria 1518
182 Ga0501082_0144026 3300060353 Bacteria 2068
183 Ga0466962_0068396 3300061719 Unclassified 1696
184 Ga0466962_0264794 3300061719 Unclassified 846
185 Ga0496104_0788697
186 rootH2_10084132
187 rootH2_10184794
188 rootH1_10125741
189 rootH1_10132525
190 Ga0070683_100150701
191 Ga0070683_101620630
192 Ga0070683_101724715
193 Ga0070690_100748796
194 Ga0070666_10758788
195 Ga0070680_101956511
196 Ga0070682_100426883
197 Ga0068868_101687972
198 Ga0070689_100027787
199 Ga0070667_100432952
200 Ga0070678_101769407
201 Ga0070706_100151124
202 Ga0070698_100000128
203 Ga0070679_100017168
204 Ga0070684_100014703
205 Ga0070695_100268618
206 Ga0070665_100002759
207 Ga0068855_100000030
208 Ga0068855_101579068
209 Ga0068856_100189138
210 Ga0068852_100294237
211 Ga0068864_100601833
212 Ga0068864_101345503
213 Ga0068864_101855736
214 Ga0068866_10166071
215 Ga0068861_102212158
216 Ga0068870_10984668
217 Ga0068863_100130748
218 Ga0068863_100850509
219 Ga0068863_101574985
220 Ga0070717_10048246
221 Ga0070712_100535851
222 Ga0097621_100433037
223 Ga0097621_100538885
224 Ga0068871_100106010
225 Ga0105240_11040442
226 Ga0105240_11330858
227 Ga0111539_11386188
228 Ga0105241_10303612
229 Ga0105238_12175401
230 Ga0105249_11356058
231 Ga0105239_11488947
232 Ga0157370_10137265
233 Ga0157374_12267233
234 Ga0157372_11431445
235 Ga0163163_12472205
236 Ga0157380_10773045
237 Ga0157377_10495265
238 Ga0157376_10941212
239 Ga0213876_10149153
240 Ga0209565_1049379
241 Ga0207642_10349674
242 Ga0207680_10625978
243 Ga0207684_10375594
244 Ga0207695_10729347
245 Ga0207652_10002311
246 Ga0207689_10422981
247 Ga0207689_10987815
248 Ga0207661_10108913
249 Ga0207661_10893519
250 Ga0207661_12096863
251 Ga0207667_10000104
252 Ga0207712_11060827
253 Ga0207677_10026600
254 Ga0207702_10588451
255 Ga0207702_10859071
256 Ga0207641_10102618
257 Ga0207641_11816435
258 Ga0207674_10179991
259 Ga0268266_10020948
260 Ga0268266_11069749
261 Ga0268265_10808963
262 Ga0268264_11859121
263 Ga0307515_10024945
264 Ga0265338_10106200
265 Ga0307512_10227536
266 Ga0265328_10133620
267 Ga0265316_11244125
268 Ga0307513_10014963
269 Ga0307513_10049293
270 Ga0307509_10006736
271 Ga0307509_10122803
272 Ga0307408_100046025
273 Ga0307514_10005780
274 Ga0316575_10016086
275 Ga0316576_10000843
276 Ga0316576_10205167
277 Ga0316578_10349935
278 Ga0307516_10002224
279 Ga0307516_10645964
280 Ga0316585_10170105
281 Ga0316580_10015749
282 Ga0307510_10194644
283 Ga0373943_0599618
284 Ga0316574_0006567
285 Ga0316574_0160640
286 Ga0373937_1701288
287 Ga0316582_0263680
288 Ga0316582_1071848
289 Ga0316584_0066204
290 Ga0395905_0436723
291 Ga0436365_0954026
292 Ga0436365_1133209
293 Ga0451793_0952761
294 Ga0451797_1104350
295 Ga0451797_1301942
296 Ga0451807_0877251
297 Ga0451837_1287397
298 Ga0451839_0877483
299 Ga0451849_0594359
300 Ga0451843_0760543
301 Ga0439435_0161633
302 Ga0451577_0289195
303 Ga0451577_0843743
304 Ga0451577_1191293
305 Ga0451577_1905775
306 Ga0466965_0070874
307 Ga0453684_0493825
308 Ga0453684_0738978
309 Ga0466971_0201820
310 Ga0466971_0452150
311 Ga0466957_0428773
312 Ga0466960_0026873
313 Ga0451576_0035074
314 Ga0495585_0018269
315 Ga0495583_0031915
316 Ga0495613_0096052
317 Ga0495581_0702372
318 Ga0496105_0482296
319 Ga0496110_0451957
320 Ga0496112_0534567
321 Ga0496114_0599465
322 Ga0496114_0655054
323 Ga0496115_0286269
324 Ga0496116_0284577
325 Ga0501292_005792
326 Ga0501296_005932
327 Ga0501298_085303
328 Ga0501299_004389
329 Ga0501034_0435924
330 Ga0501034_1205181
331 Ga0501037_0446840
332 Ga0501037_0825841
333 Ga0501043_0177214
334 Ga0501047_0258025
335 Ga0501068_0225866
336 Ga0501069_0230361
337 Ga0501070_0015968
338 Ga0501070_0527895
339 Ga0501073_0238174
340 Ga0501077_0809612
341 Ga0501202_039013
342 Ga0501214_099081
343 Ga0501217_027955
344 Ga0501217_247549
345 Ga0501223_090499
346 Ga0501224_021989
347 Ga0501227_000708
348 Ga0501227_018757
349 Ga0501227_156743
350 Ga0501227_235845
351 Ga0501230_000164
352 Ga0501233_000626
353 Ga0501236_003590
354 Ga0501221_232497
355 Ga0501225_0007194
356 Ga0501225_0036198
357 Ga0501080_0217123
358 Ga0501081_0297468
359 Ga0501044_0175390
360 Ga0501204_009262
361 Ga0501220_01403
362 nmdc:mga08y16_1005836_c1
363 Ga0495655_0077742
364 Ga0495619_0659769
365 Ga0501084_0243381
366 Ga0501082_0144026
367 Ga0466962_0068396
368 Ga0466962_0264794

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00887

ACBP

Acyl CoA binding protein

20

93

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hb6-assembly1.cif.gz_A structure of bovine acyl-coa binding protein in orthorhombic crystal form 0.9933 4 87
2fj9-assembly1.cif.gz_A high resolution crystal structure of the unliganded human acbp 0.989 4 87
2fdq-assembly3.cif.gz_C crystal structure of acbp from armadillo harderian gland 0.9857 4 87
5h3i-assembly3.cif.gz_C crystal structure of oryza sativa acyl-coa-binding protein 2 0.9713 1 85
1hb6-assembly1.cif.gz_A structure of bovine acyl-coa binding protein in orthorhombic crystal form 0.9593 4 87
ID Description Score Start End Superfamily
af_P42281_1_86_1.20.80.10 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 1.005 6 87 1.20.80.10
af_P56702_1_86_1.20.80.10 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 0.995 6 87 1.20.80.10
af_D3ZB36_1_88_1.20.80.10 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 0.9941 1 87 1.20.80.10
af_Q09603_17_117_1.20.80.10 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 0.9897 2 86 1.20.80.10
af_O75521_34_126_1.20.80.10 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 0.9889 5 84 1.20.80.10
ID Description Score Start End GO Terms
AF-A0A3B0WBA1-F1-model_v4 Acyl-CoA-binding protein 1.007 2 83 GO:0000062
GO:0006631
AF-A0A7I4XWA7-F1-model_v4 Acyl-CoA-binding protein domain containing protein 1.006 7 87 GO:0000062
GO:0006631
AF-A0A0K0E466-F1-model_v4 ACB domain-containing protein 1.006 6 87 GO:0000062
GO:0006631
AF-A0A6H5HV35-F1-model_v4 ACB domain-containing protein 1.005 2 87 GO:0000062
GO:0006631
AF-A0A672MNB7-F1-model_v4 Acyl-CoA-binding protein 1.005 3 87 GO:0000062
GO:0006631

Map