F282412

General Info

Members Datasets Scaffolds Average Seq Length
184 89 368 159

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100524232|Ga0075429_1005242321
Length 185
Sequence MLYNILIINLGNSFALLTIHPYGRMPIMKIMTEPLVITSGDPILERLDFKPYRSKVQRRVVPFFPEPDEPQTMQIVTPWGTELTARKGDFLISELETPNDYWSIDPVIFEESYIIIRPGYCIKKAITLLAPLTDITGDPDRQVTVVTLEGDETVRAGDFFLAKGIKGEIWPYPTEKIDDVMMPAE

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
62 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
63 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
64 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
65 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
71 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
74 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
75 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
76 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
77 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
78 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
79 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
80 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
81 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
82 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
83 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
84 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
85 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
86 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
87 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
88 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
89 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 38.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100524232 3300006880 Unclassified 1038
2 SwRhRL3b_contig_4561775 2162886006 Bacteria 1434
3 SwRhRL2b_contig_179481 2162886007 Unclassified 1362
4 JGI25406J46586_10006111 3300003203 Bacteria 5561
5 Ga0065704_10071891 3300005289 Bacteria 9669
6 Ga0065704_10094923 3300005289 Bacteria 2517
7 Ga0065707_10033449 3300005295 Bacteria 1582
8 Ga0065707_10083373 3300005295 Bacteria 9406
9 Ga0065707_10086195 3300005295 Bacteria 5605
10 Ga0065707_10103790 3300005295 Bacteria 2683
11 Ga0065707_10479559 3300005295 Unclassified 775
12 Ga0070689_100735022 3300005340 Unclassified 864
13 Ga0070688_100876559 3300005365 Unclassified 707
14 Ga0070705_100737234 3300005440 Unclassified 778
15 Ga0070694_100058840 3300005444 Unclassified 2616
16 Ga0070662_100318668 3300005457 Bacteria 1267
17 Ga0070706_100621299 3300005467 Bacteria 1004
18 Ga0070706_100640102 3300005467 Unclassified 987
19 Ga0070707_100386276 3300005468 Bacteria 1360
20 Ga0070698_100017256 3300005471 Bacteria 7607
21 Ga0070698_100144791 3300005471 Unclassified 2326
22 Ga0070698_100433933 3300005471 Unclassified 1248
23 Ga0070698_100632927 3300005471 Unclassified 1011
24 Ga0070699_100003181 3300005518 Bacteria 14530
25 Ga0070699_100022809 3300005518 Bacteria 5394
26 Ga0070699_100060657 3300005518 Unclassified 3278
27 Ga0070699_100417228 3300005518 Unclassified 1215
28 Ga0070695_100053204 3300005545 Bacteria 2603
29 Ga0070696_100240518 3300005546 Unclassified 1365
30 Ga0070696_100459131 3300005546 Unclassified 1007
31 Ga0070704_100512135 3300005549 Bacteria 1043
32 Ga0068857_100191799 3300005577 Bacteria 1861
33 Ga0068857_100519459 3300005577 Bacteria 1119
34 Ga0068857_100997157 3300005577 Bacteria 806
35 Ga0068857_101229233 3300005577 Bacteria 726
36 Ga0070702_100257587 3300005615 Unclassified 1186
37 Ga0068859_101001613 3300005617 Bacteria 918
38 Ga0068864_100078923 3300005618 Bacteria 2882
39 Ga0068861_100467448 3300005719 Bacteria 1133
40 Ga0068858_100653437 3300005842 Unclassified 1022
41 Ga0068862_100060312 3300005844 Bacteria 3258
42 Ga0068862_102601358 3300005844 Unclassified 518
43 Ga0075427_10000170 3300006194 Bacteria 6329
44 Ga0075427_10034404 3300006194 Viruses 840
45 Ga0075427_10055519 3300006194 Bacteria 687
46 Ga0075428_100135502 3300006844 Bacteria 2678
47 Ga0075428_100198633 3300006844 Bacteria 2169
48 Ga0075428_100435538 3300006844 Viruses 1404
49 Ga0075430_100236207 3300006846 Bacteria 1515
50 Ga0075431_100023266 3300006847 Bacteria 6338
51 Ga0075431_100159384 3300006847 Bacteria 2321
52 Ga0075433_10077314 3300006852 Bacteria 2931
53 Ga0075434_100797637 3300006871 Bacteria 961
54 Ga0075429_100008772 3300006880 Bacteria 8791
55 Ga0075429_100017149 3300006880 Bacteria 6263
56 Ga0075429_100021462 3300006880 Bacteria 5599
57 Ga0075429_100080120 3300006880 Bacteria 2846
58 Ga0075429_100239764 3300006880 Unclassified 1588
59 Ga0075429_100803367 3300006880 Unclassified 824
60 Ga0097620_101001679 3300006931 Bacteria 918
61 Ga0114129_10005997 3300009147 Bacteria 17219
62 Ga0114129_10028800 3300009147 Bacteria 7869
63 Ga0114129_10096498 3300009147 Bacteria 4092
64 Ga0114129_10134168 3300009147 Bacteria 3398
65 Ga0114129_10509237 3300009147 Unclassified 1571
66 Ga0105243_10009746 3300009148 Bacteria 7314
67 Ga0105243_10289128 3300009148 Bacteria 1480
68 Ga0105241_10845560 3300009174 Unclassified 846
69 Ga0105242_10042955 3300009176 Unclassified 3654
70 Ga0105237_12481491 3300009545 Unclassified 529
71 Ga0105249_10106789 3300009553 Unclassified 2642
72 Ga0105249_10306578 3300009553 Bacteria 1595
73 Ga0105239_11470639 3300010375 Unclassified 787
74 Ga0105246_11048879 3300011119 Unclassified 741
75 Ga0157380_10694315 3300014326 Bacteria 1022
76 Ga0207684_10261249 3300025910 Bacteria 1494
77 Ga0207684_10683129 3300025910 Unclassified 873
78 Ga0207684_11146082 3300025910 Unclassified 646
79 Ga0207646_10361306 3300025922 Bacteria 1312
80 Ga0207646_10739415 3300025922 Bacteria 878
81 Ga0207706_10438403 3300025933 Bacteria 1131
82 Ga0207686_10035570 3300025934 Unclassified 2991
83 Ga0207709_10150066 3300025935 Bacteria 1613
84 Ga0207709_10159236 3300025935 Bacteria 1573
85 Ga0207709_10263556 3300025935 Unclassified 1265
86 Ga0207712_10191427 3300025961 Unclassified 1615
87 Ga0207712_10730711 3300025961 Bacteria 866
88 Ga0207703_10726237 3300026035 Unclassified 945
89 Ga0207641_11177483 3300026088 Unclassified 766
90 Ga0207676_10063666 3300026095 Bacteria 2930
91 Ga0207674_10215904 3300026116 Bacteria 1866
92 Ga0207674_10612133 3300026116 Bacteria 1052
93 Ga0268265_10091111 3300028380 Bacteria 2437
94 Ga0316579_10058929 3300031691 Bacteria 1805
95 Ga0316578_10070649 3300031728 Bacteria 2067
96 Ga0307405_10023863 3300031731 Bacteria 3484
97 Ga0307413_10673342 3300031824 Unclassified 856
98 Ga0307413_10995079 3300031824 Bacteria 718
99 Ga0307407_10299616 3300031903 Bacteria 1120
100 Ga0307409_100470952 3300031995 Bacteria 1217
101 Ga0307416_101487148 3300032002 Unclassified 783
102 Ga0307415_101142280 3300032126 Unclassified 731
103 Ga0373949_0024325 3300035090 Unclassified 1408
104 Ga0373952_0117795 3300035092 Unclassified 717
105 Ga0316582_0328560 3300036647 Unclassified 1052
106 Ga0316584_0030714 3300036712 Unclassified 3969
107 Ga0316584_0234363 3300036712 Bacteria 1345
108 Ga0242420_114341 3300038996 Unclassified 584
109 Ga0451577_0065791 3300042876 Bacteria 3233
110 Ga0451577_0114862 3300042876 Bacteria 2410
111 Ga0451577_0175489 3300042876 Unclassified 1932
112 Ga0451577_0303621 3300042876 Bacteria 1446
113 Ga0451577_0377583 3300042876 Unclassified 1286
114 Ga0451577_0440640 3300042876 Bacteria 1183
115 Ga0451577_0845700 3300042876 Bacteria 825
116 Ga0451577_0953917 3300042876 Unclassified 771
117 Ga0453683_0007924 3300044673 Bacteria 7165
118 Ga0453683_0012377 3300044673 Bacteria 5590
119 Ga0453683_0084483 3300044673 Bacteria 1989
120 Ga0453683_0195922 3300044673 Bacteria 1283
121 Ga0453683_0228754 3300044673 Bacteria 1183
122 Ga0453683_0536155 3300044673 Bacteria 761
123 Ga0453683_0667476 3300044673 Unclassified 680
124 Ga0453683_0772089 3300044673 Unclassified 632
125 Ga0453684_0000106 3300044712 Bacteria 364365
126 Ga0453684_0006343 3300044712 Bacteria 22561
127 Ga0453684_0055389 3300044712 Bacteria 5156
128 Ga0453684_0120085 3300044712 Unclassified 3175
129 Ga0453684_0151557 3300044712 Unclassified 2754
130 Ga0453684_0192940 3300044712 Bacteria 2381
131 Ga0453684_0199336 3300044712 Bacteria 2335
132 Ga0453684_0207343 3300044712 Bacteria 2280
133 Ga0453684_0234578 3300044712 Bacteria 2116
134 Ga0453684_0632362 3300044712 Unclassified 1170
135 Ga0453684_0665293 3300044712 Bacteria 1135
136 Ga0453684_0894115 3300044712 Bacteria 951
137 Ga0453684_1159384 3300044712 Bacteria 813
138 Ga0453684_1431201 3300044712 Unclassified 716
139 Ga0453684_1532258 3300044712 Bacteria 687
140 Ga0453684_1726568 3300044712 Unclassified 639
141 Ga0451576_0000311 3300045051 Bacteria 117825
142 Ga0451576_0013327 3300045051 Bacteria 9198
143 Ga0451576_0150116 3300045051 Unclassified 2430
144 Ga0451576_0175463 3300045051 Unclassified 2237
145 Ga0451576_0303076 3300045051 Bacteria 1671
146 Ga0451576_1213284 3300045051 Bacteria 788
147 Ga0501299_023851 3300049522 Bacteria 1138
148 Ga0501036_0621257 3300049572 Unclassified 896
149 Ga0501041_0438120 3300049577 Bacteria 829
150 Ga0501072_0471318 3300049588 Bacteria 994
151 Ga0501074_0122148 3300049590 Unclassified 1863
152 Ga0501075_0119050 3300049591 Bacteria 2009
153 Ga0501076_0060116 3300049592 Unclassified 3023
154 Ga0501076_0107604 3300049592 Bacteria 2252
155 Ga0501077_0313364 3300049593 Bacteria 1000
156 Ga0501080_0221765 3300049742 Unclassified 1730
157 Ga0501080_0509436 3300049742 Bacteria 1075
158 Ga0501081_0548256 3300049743 Unclassified 864
159 Ga0501081_0755549 3300049743 Bacteria 731
160 Ga0501045_0914086 3300049824 Unclassified 645
161 nmdc:mga05p37_108335_c1 3300050507 Bacteria 3418
162 nmdc:mga05p37_1571895_c1 3300050507 Unclassified 650
163 nmdc:mga05p37_434278_c1 3300050507 Bacteria 1525
164 nmdc:mga05p37_53640_c1 3300050507 Unclassified 4959
165 nmdc:mga05p37_84497_c1 3300050507 Bacteria 3911
166 nmdc:mga05p37_857572_c1 3300050507 Bacteria 985
167 nmdc:mga05p37_951_c1 3300050507 Bacteria 32730
168 nmdc:mga09592_390481_c1 3300050508 Unclassified 1203
169 nmdc:mga09592_50267_c1 3300050508 Bacteria 3517
170 nmdc:mga09592_58364_c1 3300050508 Bacteria 3263
171 nmdc:mga09592_7423_c1 3300050508 Bacteria 8911
172 nmdc:mga09592_784816_c1 3300050508 Unclassified 806
173 nmdc:mga09592_83502_c1 3300050508 Bacteria 2723
174 nmdc:mga0qj67_40576_c1 3300050509 Bacteria 3658
175 nmdc:mga06r32_132583_c1 3300050510 Bacteria 2465
176 nmdc:mga06r32_495221_c1 3300050510 Unclassified 1199
177 nmdc:mga06r32_60676_c1 3300050510 Bacteria 3640
178 nmdc:mga0n895_527485_c1 3300050512 Unclassified 1188
179 nmdc:mga0a205_708070_c1 3300050515 Unclassified 857
180 nmdc:mga0a205_865614_c1 3300050515 Unclassified 751
181 Ga0501084_0482776 3300054114 Bacteria 1047
182 Ga0501082_0796199 3300060353 Unclassified 827
183 Ga0530510_0169528 3300061734 Unclassified 1617
184 Ga0530510_0786749 3300061734 Unclassified 726
185 Ga0075429_100524232
186 SwRhRL3b_contig_4561775
187 SwRhRL2b_contig_179481
188 JGI25406J46586_10006111
189 Ga0065704_10071891
190 Ga0065704_10094923
191 Ga0065707_10033449
192 Ga0065707_10083373
193 Ga0065707_10086195
194 Ga0065707_10103790
195 Ga0065707_10479559
196 Ga0070689_100735022
197 Ga0070688_100876559
198 Ga0070705_100737234
199 Ga0070694_100058840
200 Ga0070662_100318668
201 Ga0070706_100621299
202 Ga0070706_100640102
203 Ga0070707_100386276
204 Ga0070698_100017256
205 Ga0070698_100144791
206 Ga0070698_100433933
207 Ga0070698_100632927
208 Ga0070699_100003181
209 Ga0070699_100022809
210 Ga0070699_100060657
211 Ga0070699_100417228
212 Ga0070695_100053204
213 Ga0070696_100240518
214 Ga0070696_100459131
215 Ga0070704_100512135
216 Ga0068857_100191799
217 Ga0068857_100519459
218 Ga0068857_100997157
219 Ga0068857_101229233
220 Ga0070702_100257587
221 Ga0068859_101001613
222 Ga0068864_100078923
223 Ga0068861_100467448
224 Ga0068858_100653437
225 Ga0068862_100060312
226 Ga0068862_102601358
227 Ga0075427_10000170
228 Ga0075427_10034404
229 Ga0075427_10055519
230 Ga0075428_100135502
231 Ga0075428_100198633
232 Ga0075428_100435538
233 Ga0075430_100236207
234 Ga0075431_100023266
235 Ga0075431_100159384
236 Ga0075433_10077314
237 Ga0075434_100797637
238 Ga0075429_100008772
239 Ga0075429_100017149
240 Ga0075429_100021462
241 Ga0075429_100080120
242 Ga0075429_100239764
243 Ga0075429_100803367
244 Ga0097620_101001679
245 Ga0114129_10005997
246 Ga0114129_10028800
247 Ga0114129_10096498
248 Ga0114129_10134168
249 Ga0114129_10509237
250 Ga0105243_10009746
251 Ga0105243_10289128
252 Ga0105241_10845560
253 Ga0105242_10042955
254 Ga0105237_12481491
255 Ga0105249_10106789
256 Ga0105249_10306578
257 Ga0105239_11470639
258 Ga0105246_11048879
259 Ga0157380_10694315
260 Ga0207684_10261249
261 Ga0207684_10683129
262 Ga0207684_11146082
263 Ga0207646_10361306
264 Ga0207646_10739415
265 Ga0207706_10438403
266 Ga0207686_10035570
267 Ga0207709_10150066
268 Ga0207709_10159236
269 Ga0207709_10263556
270 Ga0207712_10191427
271 Ga0207712_10730711
272 Ga0207703_10726237
273 Ga0207641_11177483
274 Ga0207676_10063666
275 Ga0207674_10215904
276 Ga0207674_10612133
277 Ga0268265_10091111
278 Ga0316579_10058929
279 Ga0316578_10070649
280 Ga0307405_10023863
281 Ga0307413_10673342
282 Ga0307413_10995079
283 Ga0307407_10299616
284 Ga0307409_100470952
285 Ga0307416_101487148
286 Ga0307415_101142280
287 Ga0373949_0024325
288 Ga0373952_0117795
289 Ga0316582_0328560
290 Ga0316584_0030714
291 Ga0316584_0234363
292 Ga0242420_114341
293 Ga0451577_0065791
294 Ga0451577_0114862
295 Ga0451577_0175489
296 Ga0451577_0303621
297 Ga0451577_0377583
298 Ga0451577_0440640
299 Ga0451577_0845700
300 Ga0451577_0953917
301 Ga0453683_0007924
302 Ga0453683_0012377
303 Ga0453683_0084483
304 Ga0453683_0195922
305 Ga0453683_0228754
306 Ga0453683_0536155
307 Ga0453683_0667476
308 Ga0453683_0772089
309 Ga0453684_0000106
310 Ga0453684_0006343
311 Ga0453684_0055389
312 Ga0453684_0120085
313 Ga0453684_0151557
314 Ga0453684_0192940
315 Ga0453684_0199336
316 Ga0453684_0207343
317 Ga0453684_0234578
318 Ga0453684_0632362
319 Ga0453684_0665293
320 Ga0453684_0894115
321 Ga0453684_1159384
322 Ga0453684_1431201
323 Ga0453684_1532258
324 Ga0453684_1726568
325 Ga0451576_0000311
326 Ga0451576_0013327
327 Ga0451576_0150116
328 Ga0451576_0175463
329 Ga0451576_0303076
330 Ga0451576_1213284
331 Ga0501299_023851
332 Ga0501036_0621257
333 Ga0501041_0438120
334 Ga0501072_0471318
335 Ga0501074_0122148
336 Ga0501075_0119050
337 Ga0501076_0060116
338 Ga0501076_0107604
339 Ga0501077_0313364
340 Ga0501080_0221765
341 Ga0501080_0509436
342 Ga0501081_0548256
343 Ga0501081_0755549
344 Ga0501045_0914086
345 nmdc:mga05p37_108335_c1
346 nmdc:mga05p37_1571895_c1
347 nmdc:mga05p37_434278_c1
348 nmdc:mga05p37_53640_c1
349 nmdc:mga05p37_84497_c1
350 nmdc:mga05p37_857572_c1
351 nmdc:mga05p37_951_c1
352 nmdc:mga09592_390481_c1
353 nmdc:mga09592_50267_c1
354 nmdc:mga09592_58364_c1
355 nmdc:mga09592_7423_c1
356 nmdc:mga09592_784816_c1
357 nmdc:mga09592_83502_c1
358 nmdc:mga0qj67_40576_c1
359 nmdc:mga06r32_132583_c1
360 nmdc:mga06r32_495221_c1
361 nmdc:mga06r32_60676_c1
362 nmdc:mga0n895_527485_c1
363 nmdc:mga0a205_708070_c1
364 nmdc:mga0a205_865614_c1
365 Ga0501084_0482776
366 Ga0501082_0796199
367 Ga0530510_0169528
368 Ga0530510_0786749

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c5q-assembly1.cif.gz_B crystal structure of yeast yer010cp 0.507 45 81
2js2-assembly1.cif.gz_A solution structure of first sh3 domain of adaptor nck 0.499 131 158
1n5z-assembly2.cif.gz_B complex structure of pex13p sh3 domain with a peptide of pex14p 0.4763 21 158
2i45-assembly4.cif.gz_H crystal structure of protein nmb1881 from neisseria meningitidis 0.4701 20 67
3cto-assembly1.cif.gz_C crystal structure of m. tuberculosis yefm antitoxin 0.4672 104 131
ID Description Score Start End Superfamily
af_P0AEB5_179_229_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.6146 120 157 2.30.30.60
af_B0S7K1_57_147_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.5875 96 148 2.30.30.40
af_O45110_151_229_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.5849 124 158 2.30.30.30
2eyqB05 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.5664 115 158 2.40.10.170
af_Q58543_201_249_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.5169 111 155 2.30.30.60
ID Description Score Start End GO Terms
AF-A0A350WLU2-F1-model_v4 Uncharacterized protein 0.9051 5 158
AF-A0A350WLU2-F1-model_v4 Uncharacterized protein 0.8891 5 158
AF-A0A0H1RTJ3-F1-model_v4 deleted 0.8525 114 158
AF-A0A7S1CQ98-F1-model_v4 Uncharacterized protein 0.8523 22 158 GO:0016020
AF-A0A842WS58-F1-model_v4 Uncharacterized protein 0.8325 111 152

Map