F281188

General Info

Members Datasets Scaffolds Average Seq Length
183 84 366 136

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0726430|Ga0436364_0726430_177_590
Length 137
Sequence LTAGGLETIAFEGAVLAYLARGGSTPGETRFLTPAECNVQVGHVVYPAGGEVLRHVHLPVVRHLVGTTEVLIVQRGRCEVDVYGPDPERRLVTTRQLCEGDILITLAGGHGFRMLEDTVLLEVKQGPYVAGGDKERF

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
65 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
73 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
74 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
75 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
76 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
77 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
78 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
79 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
80 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
81 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
82 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
83 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
84 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.55
Rhizosphere 92.9
Stem 0
Stem Tuber 0
Unclassified 39.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0726430 3300037853 Bacteria 644
2 SwRhRL3b_contig_2702078 2162886006 Unclassified 836
3 MRS1b_contig_2648940 2162886011 Unclassified 836
4 Ga0065704_10589737 3300005289 Unclassified 607
5 Ga0065712_10079234 3300005290 Unclassified 3242
6 Ga0065712_10294730 3300005290 Unclassified 871
7 Ga0065715_10121668 3300005293 Unclassified 2223
8 Ga0065707_10139545 3300005295 Bacteria 1777
9 Ga0065707_10455264 3300005295 Unclassified 796
10 Ga0070670_100306670 3300005331 Bacteria 1389
11 Ga0070682_100462593 3300005337 Bacteria 974
12 Ga0070689_100198183 3300005340 Unclassified 1638
13 Ga0070689_101142813 3300005340 Unclassified 697
14 Ga0070689_101381182 3300005340 Unclassified 636
15 Ga0070691_10001937 3300005341 Bacteria 9106
16 Ga0070675_100351547 3300005354 Unclassified 1307
17 Ga0070688_100031120 3300005365 Unclassified 3208
18 Ga0070710_10158826 3300005437 Bacteria 1400
19 Ga0070694_100132963 3300005444 Bacteria 1799
20 Ga0070681_10715453 3300005458 Bacteria 917
21 Ga0070685_10455027 3300005466 Bacteria 897
22 Ga0070706_100415444 3300005467 Unclassified 1252
23 Ga0070698_100209506 3300005471 Unclassified 1884
24 Ga0070699_100275061 3300005518 Bacteria 1508
25 Ga0070697_100052020 3300005536 Bacteria 3329
26 Ga0070693_100208597 3300005547 Bacteria 1273
27 Ga0070704_100024661 3300005549 Bacteria 3949
28 Ga0070704_100090297 3300005549 Bacteria 2281
29 Ga0070704_100102838 3300005549 Bacteria 2157
30 Ga0068859_100000034 3300005617 Bacteria 171376
31 Ga0068859_101294170 3300005617 Unclassified 803
32 Ga0068860_100429743 3300005843 Bacteria 1310
33 Ga0081455_10002690 3300005937 Bacteria 20995
34 Ga0081538_10003396 3300005981 Bacteria 15070
35 Ga0070716_100913051 3300006173 Unclassified 688
36 Ga0070716_101666697 3300006173 Unclassified 525
37 Ga0070712_100025407 3300006175 Bacteria 3937
38 Ga0075428_100107107 3300006844 Bacteria 3046
39 Ga0075428_100154411 3300006844 Bacteria 2494
40 Ga0075428_100213614 3300006844 Bacteria 2084
41 Ga0075428_100386791 3300006844 Bacteria 1500
42 Ga0075428_100564932 3300006844 Unclassified 1216
43 Ga0075428_100849299 3300006844 Bacteria 969
44 Ga0075428_101418323 3300006844 Unclassified 729
45 Ga0075430_100092811 3300006846 Bacteria 2523
46 Ga0075430_100409437 3300006846 Bacteria 1119
47 Ga0075430_100560451 3300006846 Bacteria 942
48 Ga0075431_100013498 3300006847 Bacteria 8251
49 Ga0075431_100018113 3300006847 Bacteria 7163
50 Ga0075431_100023058 3300006847 Bacteria 6364
51 Ga0075431_100132199 3300006847 Bacteria 2574
52 Ga0075431_101128298 3300006847 Unclassified 748
53 Ga0075433_10083190 3300006852 Unclassified 2824
54 Ga0075433_10117118 3300006852 Bacteria 2364
55 Ga0075433_10179765 3300006852 Bacteria 1882
56 Ga0075433_10200449 3300006852 Bacteria 1774
57 Ga0075433_10428880 3300006852 Unclassified 1166
58 Ga0075434_100001928 3300006871 Bacteria 17990
59 Ga0075434_100224145 3300006871 Bacteria 1900
60 Ga0075434_101974559 3300006871 Bacteria 589
61 Ga0075429_100119393 3300006880 Bacteria 2304
62 Ga0075429_100159403 3300006880 Bacteria 1976
63 Ga0075429_101360129 3300006880 Unclassified 619
64 Ga0075436_100095745 3300006914 Bacteria 2065
65 Ga0097620_100000034 3300006931 Bacteria 171376
66 Ga0097620_101293932 3300006931 Unclassified 803
67 Ga0075435_100036826 3300007076 Bacteria 3891
68 Ga0075435_100301615 3300007076 Unclassified 1370
69 Ga0075435_100445305 3300007076 Unclassified 1117
70 Ga0075435_100471820 3300007076 Bacteria 1083
71 Ga0075435_100597218 3300007076 Unclassified 957
72 Ga0111539_10196635 3300009094 Bacteria 2352
73 Ga0111539_10404611 3300009094 Unclassified 1590
74 Ga0111539_10465652 3300009094 Unclassified 1472
75 Ga0111539_11936954 3300009094 Unclassified 683
76 Ga0105245_11093880 3300009098 Unclassified 843
77 Ga0105245_11135633 3300009098 Unclassified 828
78 Ga0114129_10006272 3300009147 Bacteria 16850
79 Ga0114129_10022119 3300009147 Bacteria 9024
80 Ga0114129_10033647 3300009147 Bacteria 7242
81 Ga0114129_10068109 3300009147 Unclassified 4964
82 Ga0114129_10068545 3300009147 Unclassified 4946
83 Ga0114129_10086658 3300009147 Bacteria 4343
84 Ga0114129_10128617 3300009147 Bacteria 3481
85 Ga0114129_10130484 3300009147 Bacteria 3452
86 Ga0114129_10295307 3300009147 Unclassified 2161
87 Ga0114129_10324275 3300009147 Bacteria 2047
88 Ga0114129_10431330 3300009147 Bacteria 1732
89 Ga0114129_10510945 3300009147 Unclassified 1568
90 Ga0114129_10636709 3300009147 Bacteria 1378
91 Ga0114129_10740405 3300009147 Unclassified 1259
92 Ga0114129_12063608 3300009147 Unclassified 688
93 Ga0114129_12067262 3300009147 Unclassified 688
94 Ga0114129_12597478 3300009147 Unclassified 604
95 Ga0105249_10267409 3300009553 Bacteria 1702
96 Ga0157344_1028340 3300012476 Unclassified 524
97 Ga0163162_10298552 3300013306 Bacteria 1743
98 Ga0163162_10886060 3300013306 Unclassified 1006
99 Ga0157372_10599905 3300013307 Bacteria 1283
100 Ga0157375_10803958 3300013308 Unclassified 1089
101 Ga0182005_1009075 3300015265 Unclassified 2910
102 Ga0213876_10001541 3300021384 Bacteria 14216
103 Ga0213876_10030123 3300021384 Bacteria 2861
104 Ga0213876_10526217 3300021384 Unclassified 629
105 Ga0213875_10042534 3300021388 Bacteria 2134
106 Ga0207684_10377873 3300025910 Unclassified 1219
107 Ga0207693_10015312 3300025915 Bacteria 6155
108 Ga0207663_10087666 3300025916 Unclassified 2056
109 Ga0207650_10542087 3300025925 Unclassified 975
110 Ga0207659_10166560 3300025926 Unclassified 1735
111 Ga0207665_10442139 3300025939 Bacteria 996
112 Ga0207679_10234476 3300025945 Unclassified 1551
113 Ga0207708_10701646 3300026075 Bacteria 865
114 Ga0265337_1059942 3300028556 Viruses 1056
115 Ga0265336_10034556 3300028666 Bacteria 1562
116 Ga0307416_102054431 3300032002 Unclassified 674
117 Ga0373935_0064345 3300035692 Bacteria 2352
118 Ga0373937_0678425 3300036401 Unclassified 976
119 Ga0436364_0593307 3300037853 Bacteria 37185
120 Ga0436365_0145074 3300039437 Bacteria 40110
121 Ga0436365_0852836 3300039437 Bacteria 6605
122 Ga0436365_1567025 3300039437 Bacteria 7401
123 Ga0436365_1934461 3300039437 Bacteria 1524
124 Ga0436363_0238006 3300039450 Bacteria 1028
125 Ga0436363_1705967 3300039450 Bacteria 1333
126 Ga0436362_1236789 3300039453 Bacteria 796
127 Ga0451577_0765256 3300042876 Unclassified 873
128 Ga0451577_1186832 3300042876 Unclassified 681
129 Ga0453683_0000218 3300044673 Bacteria 76321
130 Ga0453684_0073835 3300044712 Unclassified 4298
131 Ga0453684_0323205 3300044712 Bacteria 1746
132 Ga0466960_0007408 3300044901 Bacteria 4456
133 Ga0451576_0006602 3300045051 Bacteria 14183
134 Ga0466967_0047300 3300045976 Bacteria 3750
135 Ga0495665_0429373 3300046531 Bacteria 669
136 Ga0495613_0111857 3300046689 Bacteria 1967
137 Ga0495600_0091346 3300046809 Bacteria 1986
138 Ga0495674_0260204 3300047319 Unclassified 1426
139 Ga0496110_0511544 3300048913 Unclassified 1093
140 nmdc:mga05p37_101561_c1 3300050507 Unclassified 3541
141 nmdc:mga05p37_103639_c1 3300050507 Unclassified 3501
142 nmdc:mga05p37_13566_c1 3300050507 Bacteria 9770
143 nmdc:mga05p37_200128_c1 3300050507 Unclassified 2420
144 nmdc:mga05p37_217618_c1 3300050507 Bacteria 2306
145 nmdc:mga05p37_2272907_c1 3300050507 Bacteria 500
146 nmdc:mga05p37_26675_c1 3300050507 Bacteria 7026
147 nmdc:mga05p37_442090_c1 3300050507 Bacteria 1508
148 nmdc:mga05p37_57383_c1 3300050507 Viruses 4795
149 nmdc:mga05p37_5815_c1 3300050507 Bacteria 14499
150 nmdc:mga05p37_5863_c1 3300050507 Bacteria 14447
151 nmdc:mga05p37_63893_c1 3300050507 Unclassified 4531
152 nmdc:mga05p37_678024_c1 3300050507 Bacteria 1149
153 nmdc:mga05p37_680440_c1 3300050507 Unclassified 1147
154 nmdc:mga05p37_78352_c1 3300050507 Unclassified 4069
155 nmdc:mga05p37_90000_c1 3300050507 Unclassified 3782
156 nmdc:mga09592_1112751_c1 3300050508 Unclassified 656
157 nmdc:mga09592_16091_c1 3300050508 Bacteria 6113
158 nmdc:mga09592_454963_c1 3300050508 Bacteria 1104
159 nmdc:mga09592_630214_c1 3300050508 Unclassified 917
160 nmdc:mga0qj67_236567_c1 3300050509 Bacteria 1482
161 nmdc:mga06r32_1000972_c1 3300050510 Unclassified 788
162 nmdc:mga06r32_153327_c1 3300050510 Bacteria 2284
163 nmdc:mga06r32_254526_c1 3300050510 Unclassified 1744
164 nmdc:mga06r32_27049_c1 3300050510 Bacteria 5354
165 nmdc:mga06r32_36542_c1 3300050510 Bacteria 2195
166 nmdc:mga06r32_86272_c1 3300050510 Bacteria 3061
167 nmdc:mga06r32_864239_c1 3300050510 Bacteria 862
168 nmdc:mga08y16_53586_c1 3300050511 Bacteria 4217
169 nmdc:mga0n895_202544_c1 3300050512 Unclassified 2015
170 nmdc:mga0n895_212003_c1 3300050512 Bacteria 1967
171 nmdc:mga0n895_385708_c1 3300050512 Bacteria 1417
172 nmdc:mga0n895_57462_c1 3300050512 Bacteria 3835
173 nmdc:mga0rr50_1024502_c1 3300050513 Unclassified 703
174 nmdc:mga0rr50_1752429_c1 3300050513 Unclassified 523
175 nmdc:mga0rr50_271894_c1 3300050513 Unclassified 1412
176 nmdc:mga0rr50_4370_c1 3300050513 Bacteria 2615
177 nmdc:mga0a205_11987_c1 3300050515 Bacteria 8007
178 nmdc:mga0a205_133072_c1 3300050515 Bacteria 2387
179 nmdc:mga0a205_197170_c1 3300050515 Bacteria 1904
180 nmdc:mga0a205_2226_c1 3300050515 Bacteria 16238
181 nmdc:mga0a205_303706_c1 3300050515 Unclassified 1468
182 nmdc:mga0a205_382357_c1 3300050515 Bacteria 1273
183 nmdc:mga0a205_6822_c1 3300050515 Bacteria 10328
184 Ga0436364_0726430
185 SwRhRL3b_contig_2702078
186 MRS1b_contig_2648940
187 Ga0065704_10589737
188 Ga0065712_10079234
189 Ga0065712_10294730
190 Ga0065715_10121668
191 Ga0065707_10139545
192 Ga0065707_10455264
193 Ga0070670_100306670
194 Ga0070682_100462593
195 Ga0070689_100198183
196 Ga0070689_101142813
197 Ga0070689_101381182
198 Ga0070691_10001937
199 Ga0070675_100351547
200 Ga0070688_100031120
201 Ga0070710_10158826
202 Ga0070694_100132963
203 Ga0070681_10715453
204 Ga0070685_10455027
205 Ga0070706_100415444
206 Ga0070698_100209506
207 Ga0070699_100275061
208 Ga0070697_100052020
209 Ga0070693_100208597
210 Ga0070704_100024661
211 Ga0070704_100090297
212 Ga0070704_100102838
213 Ga0068859_100000034
214 Ga0068859_101294170
215 Ga0068860_100429743
216 Ga0081455_10002690
217 Ga0081538_10003396
218 Ga0070716_100913051
219 Ga0070716_101666697
220 Ga0070712_100025407
221 Ga0075428_100107107
222 Ga0075428_100154411
223 Ga0075428_100213614
224 Ga0075428_100386791
225 Ga0075428_100564932
226 Ga0075428_100849299
227 Ga0075428_101418323
228 Ga0075430_100092811
229 Ga0075430_100409437
230 Ga0075430_100560451
231 Ga0075431_100013498
232 Ga0075431_100018113
233 Ga0075431_100023058
234 Ga0075431_100132199
235 Ga0075431_101128298
236 Ga0075433_10083190
237 Ga0075433_10117118
238 Ga0075433_10179765
239 Ga0075433_10200449
240 Ga0075433_10428880
241 Ga0075434_100001928
242 Ga0075434_100224145
243 Ga0075434_101974559
244 Ga0075429_100119393
245 Ga0075429_100159403
246 Ga0075429_101360129
247 Ga0075436_100095745
248 Ga0097620_100000034
249 Ga0097620_101293932
250 Ga0075435_100036826
251 Ga0075435_100301615
252 Ga0075435_100445305
253 Ga0075435_100471820
254 Ga0075435_100597218
255 Ga0111539_10196635
256 Ga0111539_10404611
257 Ga0111539_10465652
258 Ga0111539_11936954
259 Ga0105245_11093880
260 Ga0105245_11135633
261 Ga0114129_10006272
262 Ga0114129_10022119
263 Ga0114129_10033647
264 Ga0114129_10068109
265 Ga0114129_10068545
266 Ga0114129_10086658
267 Ga0114129_10128617
268 Ga0114129_10130484
269 Ga0114129_10295307
270 Ga0114129_10324275
271 Ga0114129_10431330
272 Ga0114129_10510945
273 Ga0114129_10636709
274 Ga0114129_10740405
275 Ga0114129_12063608
276 Ga0114129_12067262
277 Ga0114129_12597478
278 Ga0105249_10267409
279 Ga0157344_1028340
280 Ga0163162_10298552
281 Ga0163162_10886060
282 Ga0157372_10599905
283 Ga0157375_10803958
284 Ga0182005_1009075
285 Ga0213876_10001541
286 Ga0213876_10030123
287 Ga0213876_10526217
288 Ga0213875_10042534
289 Ga0207684_10377873
290 Ga0207693_10015312
291 Ga0207663_10087666
292 Ga0207650_10542087
293 Ga0207659_10166560
294 Ga0207665_10442139
295 Ga0207679_10234476
296 Ga0207708_10701646
297 Ga0265337_1059942
298 Ga0265336_10034556
299 Ga0307416_102054431
300 Ga0373935_0064345
301 Ga0373937_0678425
302 Ga0436364_0593307
303 Ga0436365_0145074
304 Ga0436365_0852836
305 Ga0436365_1567025
306 Ga0436365_1934461
307 Ga0436363_0238006
308 Ga0436363_1705967
309 Ga0436362_1236789
310 Ga0451577_0765256
311 Ga0451577_1186832
312 Ga0453683_0000218
313 Ga0453684_0073835
314 Ga0453684_0323205
315 Ga0466960_0007408
316 Ga0451576_0006602
317 Ga0466967_0047300
318 Ga0495665_0429373
319 Ga0495613_0111857
320 Ga0495600_0091346
321 Ga0495674_0260204
322 Ga0496110_0511544
323 nmdc:mga05p37_101561_c1
324 nmdc:mga05p37_103639_c1
325 nmdc:mga05p37_13566_c1
326 nmdc:mga05p37_200128_c1
327 nmdc:mga05p37_217618_c1
328 nmdc:mga05p37_2272907_c1
329 nmdc:mga05p37_26675_c1
330 nmdc:mga05p37_442090_c1
331 nmdc:mga05p37_57383_c1
332 nmdc:mga05p37_5815_c1
333 nmdc:mga05p37_5863_c1
334 nmdc:mga05p37_63893_c1
335 nmdc:mga05p37_678024_c1
336 nmdc:mga05p37_680440_c1
337 nmdc:mga05p37_78352_c1
338 nmdc:mga05p37_90000_c1
339 nmdc:mga09592_1112751_c1
340 nmdc:mga09592_16091_c1
341 nmdc:mga09592_454963_c1
342 nmdc:mga09592_630214_c1
343 nmdc:mga0qj67_236567_c1
344 nmdc:mga06r32_1000972_c1
345 nmdc:mga06r32_153327_c1
346 nmdc:mga06r32_254526_c1
347 nmdc:mga06r32_27049_c1
348 nmdc:mga06r32_36542_c1
349 nmdc:mga06r32_86272_c1
350 nmdc:mga06r32_864239_c1
351 nmdc:mga08y16_53586_c1
352 nmdc:mga0n895_202544_c1
353 nmdc:mga0n895_212003_c1
354 nmdc:mga0n895_385708_c1
355 nmdc:mga0n895_57462_c1
356 nmdc:mga0rr50_1024502_c1
357 nmdc:mga0rr50_1752429_c1
358 nmdc:mga0rr50_271894_c1
359 nmdc:mga0rr50_4370_c1
360 nmdc:mga0a205_11987_c1
361 nmdc:mga0a205_133072_c1
362 nmdc:mga0a205_197170_c1
363 nmdc:mga0a205_2226_c1
364 nmdc:mga0a205_303706_c1
365 nmdc:mga0a205_382357_c1
366 nmdc:mga0a205_6822_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nst-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans 0.9005 65 118
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.8942 65 118
2d40-assembly1.cif.gz_D crystal structure of z3393 from escherichia coli o157:h7 0.8875 65 118
2d40-assembly1.cif.gz_B crystal structure of z3393 from escherichia coli o157:h7 0.8846 65 118
7dyw-assembly1.cif.gz_A human jmjd5 in complex with mn and 5-((2-methoxybenzyl)amino)pyridine-2,4-dicarboxylic acid. 0.8824 65 118
ID Description Score Start End Superfamily
6f4nB00 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8832 65 118 2.60.120.650
2d40B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8831 65 120 2.60.120.10
af_A0A1D6FJ77_3_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8677 65 121 2.60.120.10
af_A0A0P0V3U4_1_196_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8601 65 120 2.60.120.650
af_Q2G1P7_1_117_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8593 65 120 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1F8SQF5-F1-model_v4 Sugar 3,4-ketoisomerase QdtA cupin domain-containing protein 0.9548 4 133
AF-B3EBP6-F1-model_v4 Conserved hypothetical cytosolic protein 0.9539 3 133
AF-A0A1G1GFD6-F1-model_v4 Sugar 3,4-ketoisomerase QdtA cupin domain-containing protein 0.9524 4 133
AF-A0A1F8P3I7-F1-model_v4 Sugar 3,4-ketoisomerase QdtA cupin domain-containing protein 0.9512 5 133
AF-A0A3N5R2A9-F1-model_v4 Sugar 3,4-ketoisomerase QdtA cupin domain-containing protein 0.9502 2 133

Map