F280521

General Info

Members Datasets Scaffolds Average Seq Length
183 70 182 320

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100032830|Ga0070695_1000328301
Length 363
Sequence MAGKDLDVTARSCKVATKQSPIRQGISLDEIHRYNRRLLRKGDSMFRKLALIMLGMALALSACASPNSTNEAGELTRIRLPMGYIPNIQFAPFYVAIEKGYFQDAGIEIEFDYKFETDGVALVGAGELPFAIASGEQVLLARAQGLPIVYVAAWYQQYPVSVVAKSELGILIPQDLKGRKIGLPGLFGANYVGLRALLHEAGLEESDVTLDAIGFNQVELMAAGQQDIIVGYAANEPIQLRAQGIPVTEIRVADYVQLASNGLAEEPELVRAFVGAFMKGLEDTIANPDESFAISKSYIPNFADLDADVQKQVLETSIEQWKAERLGYSDPQAWENMQNVLLDMGLITEKMDLNKAFTNEFVP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
28 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
29 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
30 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
31 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
32 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
33 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
34 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
35 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
36 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
37 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
38 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
40 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
41 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
42 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
43 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
44 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
45 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
46 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
47 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
48 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
49 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
50 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
51 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
52 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
53 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
54 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
55 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
56 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
57 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
60 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
61 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
62 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
63 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
64 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
65 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
66 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
67 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
68 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
69 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
70 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 1.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.55
Rhizosphere 97.27
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1154756 2162886007 Bacteria 3194
2 JGI25406J46586_10016725 3300003203 Bacteria 3051
3 Ga0065704_10070714 3300005289 Bacteria 17199
4 Ga0065704_10104973 3300005289 Bacteria 2124
5 Ga0065707_10082780 3300005295 Bacteria 12177
6 Ga0065707_10192886 3300005295 Unclassified 1351
7 Ga0070680_100204139 3300005336 Bacteria 1667
8 Ga0070689_100208397 3300005340 Bacteria 1599
9 Ga0070689_100251930 3300005340 Unclassified 1457
10 Ga0070708_100413014 3300005445 Bacteria 1273
11 Ga0070706_100087453 3300005467 Bacteria 2889
12 Ga0070706_100095535 3300005467 Bacteria 2759
13 Ga0070706_100457946 3300005467 Unclassified 1187
14 Ga0070698_100227054 3300005471 Bacteria 1800
15 Ga0070699_100004948 3300005518 Bacteria 11755
16 Ga0070699_100086971 3300005518 Bacteria 2728
17 Ga0070699_100149052 3300005518 Bacteria 2068
18 Ga0070695_100032830 3300005545 Bacteria 3246
19 Ga0070695_100388666 3300005545 Bacteria 1055
20 Ga0068852_100370349 3300005616 Bacteria 1403
21 Ga0068862_100024750 3300005844 Bacteria 5037
22 Ga0081539_10013075 3300005985 Bacteria 6294
23 Ga0081539_10024588 3300005985 Bacteria 3902
24 Ga0075428_100054609 3300006844 Bacteria 4377
25 Ga0075428_100057422 3300006844 Bacteria 4260
26 Ga0075428_100474622 3300006844 Unclassified 1339
27 Ga0075430_100315243 3300006846 Bacteria 1293
28 Ga0075431_100136092 3300006847 Bacteria 2533
29 Ga0075431_100231072 3300006847 Unclassified 1884
30 Ga0075431_100383827 3300006847 Bacteria 1408
31 Ga0075433_10118510 3300006852 Bacteria 2350
32 Ga0075429_100007165 3300006880 Bacteria 9677
33 Ga0075429_100014118 3300006880 Bacteria 6920
34 Ga0075429_100052474 3300006880 Bacteria 3548
35 Ga0075429_100109046 3300006880 Bacteria 2420
36 Ga0075429_100158419 3300006880 Unclassified 1982
37 Ga0075429_100261730 3300006880 Unclassified 1514
38 Ga0111539_10038505 3300009094 Bacteria 5767
39 Ga0114129_10030607 3300009147 Bacteria 7615
40 Ga0114129_10174484 3300009147 Bacteria 2928
41 Ga0114129_10409350 3300009147 Bacteria 1786
42 Ga0114129_10570177 3300009147 Bacteria 1470
43 Ga0105242_10295695 3300009176 Bacteria 1476
44 Ga0105246_10149605 3300011119 Bacteria 1766
45 Ga0157370_10188655 3300013104 Bacteria 1914
46 Ga0207684_10070876 3300025910 Bacteria 2962
47 Ga0207684_10359941 3300025910 Bacteria 1252
48 Ga0207660_10215273 3300025917 Bacteria 1506
49 Ga0265327_10084797 3300031251 Bacteria 1556
50 Ga0316575_10009174 3300031665 Bacteria 3620
51 Ga0316575_10012669 3300031665 Bacteria 3141
52 Ga0316575_10035496 3300031665 Bacteria 1960
53 Ga0316579_10000080 3300031691 Bacteria 24796
54 Ga0316579_10019368 3300031691 Unclassified 3006
55 Ga0316576_10052077 3300031727 Bacteria 2981
56 Ga0316576_10054064 3300031727 Bacteria 2928
57 Ga0316576_10242977 3300031727 Bacteria 1352
58 Ga0316578_10047396 3300031728 Bacteria 2507
59 Ga0316578_10050831 3300031728 Unclassified 2426
60 Ga0316578_10098292 3300031728 Bacteria 1753
61 Ga0316577_10002172 3300031733 Bacteria 9618
62 Ga0316577_10016759 3300031733 Bacteria 4043
63 Ga0316577_10026166 3300031733 Bacteria 3248
64 Ga0316577_10087586 3300031733 Bacteria 1742
65 Ga0307406_10153312 3300031901 Bacteria 1647
66 Ga0307407_10099408 3300031903 Bacteria 1802
67 Ga0307416_100082164 3300032002 Bacteria 2728
68 Ga0307415_100239302 3300032126 Bacteria 1467
69 Ga0316580_10046615 3300032139 Bacteria 1336
70 Ga0316593_10006531 3300032168 Unclassified 3153
71 Ga0316593_10011383 3300032168 Bacteria 2583
72 Ga0316593_10040873 3300032168 Bacteria 1542
73 Ga0316574_0001206 3300035398 Bacteria 12008
74 Ga0316574_0003399 3300035398 Bacteria 8198
75 Ga0316574_0021390 3300035398 Bacteria 3840
76 Ga0316574_0044976 3300035398 Bacteria 2732
77 Ga0373933_0053643 3300035724 Bacteria 2415
78 Ga0373937_0207067 3300036401 Bacteria 1845
79 Ga0316582_0000668 3300036647 Bacteria 13462
80 Ga0316582_0002124 3300036647 Bacteria 9161
81 Ga0316582_0007291 3300036647 Bacteria 5880
82 Ga0316582_0009783 3300036647 Bacteria 5217
83 Ga0316582_0030257 3300036647 Bacteria 3297
84 Ga0316582_0048415 3300036647 Bacteria 2687
85 Ga0316582_0073969 3300036647 Bacteria 2212
86 Ga0316584_0000233 3300036712 Bacteria 27526
87 Ga0316584_0003462 3300036712 Bacteria 10256
88 Ga0316584_0031780 3300036712 Bacteria 3903
89 Ga0316581_0000933 3300037588 Bacteria 6212
90 Ga0316581_0016663 3300037588 Bacteria 2112
91 Ga0436364_0602196 3300037853 Bacteria 2597
92 Ga0400488_43867 3300038741 Bacteria 1203
93 Ga0400489_28568 3300039093 Bacteria 71526
94 Ga0436365_1765427 3300039437 Bacteria 2149
95 Ga0436362_0361262 3300039453 Unclassified 1884
96 Ga0451577_0002086 3300042876 Bacteria 24596
97 Ga0451577_0010793 3300042876 Bacteria 8688
98 Ga0451577_0012873 3300042876 Bacteria 7851
99 Ga0451577_0027383 3300042876 Bacteria 5160
100 Ga0451577_0036897 3300042876 Bacteria 4401
101 Ga0451577_0062920 3300042876 Bacteria 3309
102 Ga0451577_0480429 3300042876 Bacteria 1128
103 Ga0453683_0000596 3300044673 Bacteria 39938
104 Ga0453683_0004343 3300044673 Bacteria 10089
105 Ga0453683_0010928 3300044673 Bacteria 6002
106 Ga0453683_0028289 3300044673 Bacteria 3550
107 Ga0453683_0123236 3300044673 Bacteria 1632
108 Ga0453683_0147998 3300044673 Unclassified 1483
109 Ga0453683_0171002 3300044673 Bacteria 1376
110 Ga0453684_0000056 3300044712 Bacteria 513389
111 Ga0453684_0000214 3300044712 Bacteria 251406
112 Ga0453684_0000269 3300044712 Bacteria 223826
113 Ga0453684_0000894 3300044712 Bacteria 99515
114 Ga0453684_0001638 3300044712 Bacteria 60803
115 Ga0453684_0001993 3300044712 Bacteria 52373
116 Ga0453684_0002198 3300044712 Bacteria 48526
117 Ga0453684_0007295 3300044712 Bacteria 20455
118 Ga0453684_0011569 3300044712 Bacteria 14752
119 Ga0453684_0013978 3300044712 Bacteria 12933
120 Ga0453684_0023022 3300044712 Bacteria 9206
121 Ga0453684_0045149 3300044712 Bacteria 5882
122 Ga0453684_0047479 3300044712 Bacteria 5694
123 Ga0453684_0052364 3300044712 Bacteria 5339
124 Ga0453684_0062215 3300044712 Bacteria 4783
125 Ga0453684_0077582 3300044712 Bacteria 4162
126 Ga0453684_0097064 3300044712 Bacteria 3618
127 Ga0453684_0107510 3300044712 Bacteria 3396
128 Ga0453684_0120128 3300044712 Bacteria 3175
129 Ga0453684_0146593 3300044712 Bacteria 2810
130 Ga0453684_0150104 3300044712 Bacteria 2771
131 Ga0453684_0160028 3300044712 Bacteria 2664
132 Ga0453684_0201230 3300044712 Bacteria 2321
133 Ga0453684_0220497 3300044712 Bacteria 2197
134 Ga0453684_0248164 3300044712 Bacteria 2045
135 Ga0453684_0251711 3300044712 Unclassified 2028
136 Ga0453684_0273456 3300044712 Bacteria 1929
137 Ga0453684_0453346 3300044712 Bacteria 1427
138 Ga0453684_0488161 3300044712 Bacteria 1366
139 Ga0453684_0642614 3300044712 Bacteria 1158
140 Ga0453684_0642902 3300044712 Bacteria 1158
141 Ga0451576_0000152 3300045051 Bacteria 176305
142 Ga0451576_0009557 3300045051 Bacteria 11230
143 Ga0451576_0010168 3300045051 Bacteria 10825
144 Ga0451576_0041652 3300045051 Bacteria 4854
145 Ga0451576_0105532 3300045051 Bacteria 2931
146 Ga0451576_0124358 3300045051 Bacteria 2687
147 Ga0451576_0178463 3300045051 Bacteria 2217
148 Ga0451576_0240660 3300045051 Bacteria 1890
149 Ga0451576_0396123 3300045051 Bacteria 1448
150 Ga0451576_0484414 3300045051 Unclassified 1299
151 Ga0496108_0110839 3300048911 Bacteria 2347
152 Ga0501299_029711 3300049522 Bacteria 1048
153 Ga0501036_0204009 3300049572 Bacteria 1663
154 Ga0501037_0272163 3300049573 Bacteria 1182
155 Ga0501046_0309621 3300049580 Bacteria 1152
156 Ga0501073_0021026 3300049589 Bacteria 4708
157 Ga0501073_0171014 3300049589 Bacteria 1504
158 Ga0501074_0046925 3300049590 Bacteria 3123
159 Ga0501075_0003300 3300049591 Bacteria 10801
160 Ga0501076_0010929 3300049592 Bacteria 6752
161 Ga0501079_0015098 3300049741 Bacteria 5889
162 Ga0501080_0042239 3300049742 Bacteria 4247
163 Ga0501080_0050757 3300049742 Bacteria 3860
164 Ga0501080_0106859 3300049742 Unclassified 2594
165 Ga0501045_0060753 3300049824 Bacteria 2771
166 nmdc:mga05p37_114661_c1 3300050507 Bacteria 3313
167 nmdc:mga05p37_148966_c1 3300050507 Bacteria 2864
168 nmdc:mga05p37_283536_c1 3300050507 Unclassified 1975
169 nmdc:mga05p37_37667_c1 3300050507 Bacteria 5931
170 nmdc:mga09592_10797_c1 3300050508 Bacteria 7428
171 nmdc:mga09592_23955_c1 3300050508 Bacteria 5046
172 nmdc:mga09592_288662_c1 3300050508 Bacteria 1422
173 nmdc:mga09592_458272_c1 3300050508 Bacteria 1100
174 nmdc:mga09592_47742_c1 3300050508 Bacteria 3609
175 nmdc:mga09592_55534_c1 3300050508 Bacteria 3346
176 nmdc:mga09592_60246_c1 3300050508 Bacteria 3209
177 nmdc:mga06r32_21660_c1 3300050510 Bacteria 5935
178 nmdc:mga06r32_275758_c1 3300050510 Bacteria 1669
179 nmdc:mga06r32_282375_c1 3300050510 Bacteria 1647
180 nmdc:mga06r32_478589_c1 3300050510 Unclassified 1223
181 Ga0501084_0014148 3300054114 Bacteria 6607
182 Ga0501082_0095018 3300060353 Bacteria 2576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0003399 Ga0316574_0003399_563_1393 276
2 3300036647 Ga0316582_0002124 Ga0316582_0002124_5823_6653 276
3 3300036712 Ga0316584_0000233 Ga0316584_0000233_1317_2147 276
4 3300037588 Ga0316581_0000933 Ga0316581_0000933_2636_3466 276
5 3300036712 Ga0316584_0003462 Ga0316584_0003462_6961_7842 288
6 3300009094 Ga0111539_10038505 Ga0111539_100385055 289
7 3300045051 Ga0451576_0240660 Ga0451576_0240660_43_921 289
8 3300049580 Ga0501046_0309621 Ga0501046_0309621_75_944 289
9 3300050510 nmdc:mga06r32_282375_c1 nmdc:mga06r32_282375_c1_90_959 289
10 3300036647 Ga0316582_0009783 Ga0316582_0009783_792_1766 291
11 3300031733 Ga0316577_10016759 Ga0316577_100167592 294
12 3300044712 Ga0453684_0000056 Ga0453684_0000056_41560_42450 295
13 3300044712 Ga0453684_0107510 Ga0453684_0107510_174_1172 296
14 3300049522 Ga0501299_029711 Ga0501299_029711_129_1019 296
15 3300005471 Ga0070698_100227054 Ga0070698_1002270542 297
16 3300042876 Ga0451577_0480429 Ga0451577_0480429_13_981 297
17 3300044712 Ga0453684_0013978 Ga0453684_0013978_3793_4761 297
18 3300042876 Ga0451577_0010793 Ga0451577_0010793_1522_2496 299
19 3300044712 Ga0453684_0011569 Ga0453684_0011569_3966_4946 300
20 3300031901 Ga0307406_10153312 Ga0307406_101533121 301
21 3300031903 Ga0307407_10099408 Ga0307407_100994082 301
22 3300032002 Ga0307416_100082164 Ga0307416_1000821644 301
23 3300032168 Ga0316593_10040873 Ga0316593_100408731 301
24 3300003203 JGI25406J46586_10016725 JGI25406J46586_100167251 302
25 3300005336 Ga0070680_100204139 Ga0070680_1002041392 302
26 3300005518 Ga0070699_100004948 Ga0070699_1000049485 302
27 3300005985 Ga0081539_10013075 Ga0081539_100130755 302
28 3300025917 Ga0207660_10215273 Ga0207660_102152732 302
29 3300044712 Ga0453684_0000894 Ga0453684_0000894_74645_75643 302
30 3300044673 Ga0453683_0000596 Ga0453683_0000596_14200_15174 303
31 3300044673 Ga0453683_0010928 Ga0453683_0010928_4828_5802 303
32 3300045051 Ga0451576_0010168 Ga0451576_0010168_4187_5161 303
33 3300045051 Ga0451576_0484414 Ga0451576_0484414_171_1145 303
34 3300037588 Ga0316581_0016663 Ga0316581_0016663_732_1703 304
35 3300005518 Ga0070699_100086971 Ga0070699_1000869713 305
36 3300039453 Ga0436362_0361262 Ga0436362_0361262_711_1841 305
37 3300050508 nmdc:mga09592_458272_c1 nmdc:mga09592_458272_c1_122_1072 305
38 3300035724 Ga0373933_0053643 Ga0373933_0053643_1335_2354 306
39 3300036401 Ga0373937_0207067 Ga0373937_0207067_726_1745 306
40 3300044712 Ga0453684_0220497 Ga0453684_0220497_170_1126 306
41 3300044712 Ga0453684_0488161 Ga0453684_0488161_159_1154 306
42 3300044712 Ga0453684_0077582 Ga0453684_0077582_2772_3752 307
43 3300031728 Ga0316578_10050831 Ga0316578_100508312 309
44 3300042876 Ga0451577_0012873 Ga0451577_0012873_3101_4081 309
45 3300044712 Ga0453684_0273456 Ga0453684_0273456_90_1070 309
46 3300045051 Ga0451576_0000152 Ga0451576_0000152_107962_108954 309
47 3300049572 Ga0501036_0204009 Ga0501036_0204009_593_1573 309
48 3300050510 nmdc:mga06r32_21660_c1 nmdc:mga06r32_21660_c1_133_1068 310
49 3300005545 Ga0070695_100388666 Ga0070695_1003886661 312
50 3300006847 Ga0075431_100136092 Ga0075431_1001360923 312
51 3300006847 Ga0075431_100383827 Ga0075431_1003838271 313
52 3300044712 Ga0453684_0251711 Ga0453684_0251711_108_1076 313
53 3300031665 Ga0316575_10035496 Ga0316575_100354962 315
54 3300031691 Ga0316579_10000080 Ga0316579_1000008020 315
55 3300031727 Ga0316576_10052077 Ga0316576_100520773 315
56 3300031733 Ga0316577_10002172 Ga0316577_100021724 315
57 3300044712 Ga0453684_0001638 Ga0453684_0001638_40032_41045 316
58 3300044712 Ga0453684_0001993 Ga0453684_0001993_22224_23177 316
59 3300044712 Ga0453684_0097064 Ga0453684_0097064_866_1876 316
60 3300044712 Ga0453684_0642614 Ga0453684_0642614_59_1012 316
61 3300045051 Ga0451576_0105532 Ga0451576_0105532_1116_2102 316
62 3300049742 Ga0501080_0106859 Ga0501080_0106859_257_1237 316
63 3300050508 nmdc:mga09592_288662_c1 nmdc:mga09592_288662_c1_10_960 316
64 3300009176 Ga0105242_10295695 Ga0105242_102956951 319
65 3300044673 Ga0453683_0004343 Ga0453683_0004343_8268_9296 319
66 3300044673 Ga0453683_0028289 Ga0453683_0028289_1192_2247 319
67 3300044712 Ga0453684_0045149 Ga0453684_0045149_1039_2067 319
68 3300044712 Ga0453684_0062215 Ga0453684_0062215_3592_4578 319
69 3300045051 Ga0451576_0178463 Ga0451576_0178463_1169_2197 319
70 3300031691 Ga0316579_10019368 Ga0316579_100193682 320
71 3300032168 Ga0316593_10006531 Ga0316593_100065312 320
72 3300031733 Ga0316577_10026166 Ga0316577_100261663 321
73 3300032168 Ga0316593_10011383 Ga0316593_100113833 321
74 3300036647 Ga0316582_0073969 Ga0316582_0073969_647_1633 322
75 3300037853 Ga0436364_0602196 Ga0436364_0602196_758_1738 322
76 3300049573 Ga0501037_0272163 Ga0501037_0272163_164_1141 322
77 3300049589 Ga0501073_0021026 Ga0501073_0021026_2262_3239 322
78 3300049589 Ga0501073_0171014 Ga0501073_0171014_364_1341 322
79 3300049742 Ga0501080_0050757 Ga0501080_0050757_565_1542 322
80 3300044712 Ga0453684_0000269 Ga0453684_0000269_165516_166487 323
81 3300044712 Ga0453684_0453346 Ga0453684_0453346_308_1288 323
82 3300045051 Ga0451576_0396123 Ga0451576_0396123_421_1392 323
83 3300054114 Ga0501084_0014148 Ga0501084_0014148_4427_5407 323
84 3300005295 Ga0065707_10192886 Ga0065707_101928862 324
85 3300006844 Ga0075428_100054609 Ga0075428_1000546094 324
86 3300006844 Ga0075428_100057422 Ga0075428_1000574222 324
87 3300006846 Ga0075430_100315243 Ga0075430_1003152432 324
88 3300006847 Ga0075431_100231072 Ga0075431_1002310722 324
89 3300006880 Ga0075429_100007165 Ga0075429_1000071658 324
90 3300006880 Ga0075429_100014118 Ga0075429_1000141182 324
91 3300006880 Ga0075429_100109046 Ga0075429_1001090462 324
92 3300006880 Ga0075429_100158419 Ga0075429_1001584192 324
93 3300009147 Ga0114129_10409350 Ga0114129_104093501 324
94 3300009147 Ga0114129_10570177 Ga0114129_105701772 324
95 3300032126 Ga0307415_100239302 Ga0307415_1002393021 324
96 3300042876 Ga0451577_0036897 Ga0451577_0036897_1070_2044 324
97 3300044712 Ga0453684_0000214 Ga0453684_0000214_26085_27059 324
98 3300044712 Ga0453684_0047479 Ga0453684_0047479_871_1845 324
99 3300044712 Ga0453684_0120128 Ga0453684_0120128_216_1301 324
100 3300044712 Ga0453684_0248164 Ga0453684_0248164_858_1832 324
101 3300050507 nmdc:mga05p37_148966_c1 nmdc:mga05p37_148966_c1_383_1357 324
102 3300050507 nmdc:mga05p37_283536_c1 nmdc:mga05p37_283536_c1_387_1361 324
103 3300050508 nmdc:mga09592_10797_c1 nmdc:mga09592_10797_c1_3392_4366 324
104 3300050508 nmdc:mga09592_23955_c1 nmdc:mga09592_23955_c1_598_1572 324
105 3300050508 nmdc:mga09592_55534_c1 nmdc:mga09592_55534_c1_1090_2064 324
106 3300050510 nmdc:mga06r32_275758_c1 nmdc:mga06r32_275758_c1_474_1448 324
107 3300050510 nmdc:mga06r32_478589_c1 nmdc:mga06r32_478589_c1_71_1045 324
108 3300005616 Ga0068852_100370349 Ga0068852_1003703492 325
109 3300013104 Ga0157370_10188655 Ga0157370_101886552 325
110 3300031251 Ga0265327_10084797 Ga0265327_100847972 325
111 3300031727 Ga0316576_10242977 Ga0316576_102429772 325
112 3300035398 Ga0316574_0021390 Ga0316574_0021390_2504_3499 325
113 3300035398 Ga0316574_0044976 Ga0316574_0044976_631_1626 325
114 3300036647 Ga0316582_0000668 Ga0316582_0000668_5517_6506 325
115 3300036647 Ga0316582_0048415 Ga0316582_0048415_816_1799 325
116 3300044712 Ga0453684_0146593 Ga0453684_0146593_893_1873 325
117 3300005289 Ga0065704_10070714 Ga0065704_100707145 326
118 3300005289 Ga0065704_10104973 Ga0065704_101049732 326
119 3300005295 Ga0065707_10082780 Ga0065707_100827806 326
120 3300005340 Ga0070689_100208397 Ga0070689_1002083972 326
121 3300005340 Ga0070689_100251930 Ga0070689_1002519302 326
122 3300005467 Ga0070706_100087453 Ga0070706_1000874533 326
123 3300005467 Ga0070706_100095535 Ga0070706_1000955352 326
124 3300005467 Ga0070706_100457946 Ga0070706_1004579462 326
125 3300005518 Ga0070699_100149052 Ga0070699_1001490522 326
126 3300005844 Ga0068862_100024750 Ga0068862_1000247504 326
127 3300005985 Ga0081539_10024588 Ga0081539_100245882 326
128 3300006844 Ga0075428_100474622 Ga0075428_1004746222 326
129 3300006852 Ga0075433_10118510 Ga0075433_101185101 326
130 3300006880 Ga0075429_100052474 Ga0075429_1000524744 326
131 3300006880 Ga0075429_100261730 Ga0075429_1002617302 326
132 3300009147 Ga0114129_10030607 Ga0114129_100306074 326
133 3300009147 Ga0114129_10174484 Ga0114129_101744843 326
134 3300011119 Ga0105246_10149605 Ga0105246_101496051 326
135 3300025910 Ga0207684_10070876 Ga0207684_100708763 326
136 3300025910 Ga0207684_10359941 Ga0207684_103599411 326
137 3300031727 Ga0316576_10054064 Ga0316576_100540642 326
138 3300031728 Ga0316578_10047396 Ga0316578_100473962 326
139 3300031728 Ga0316578_10098292 Ga0316578_100982922 326
140 3300032139 Ga0316580_10046615 Ga0316580_100466152 326
141 3300036647 Ga0316582_0007291 Ga0316582_0007291_862_1845 326
142 3300036712 Ga0316584_0031780 Ga0316584_0031780_386_1369 326
143 3300038741 Ga0400488_43867 Ga0400488_43867_103_1098 326
144 3300039437 Ga0436365_1765427 Ga0436365_1765427_45_1145 326
145 3300042876 Ga0451577_0027383 Ga0451577_0027383_1588_2568 326
146 3300042876 Ga0451577_0062920 Ga0451577_0062920_2182_3171 326
147 3300044673 Ga0453683_0123236 Ga0453683_0123236_414_1394 326
148 3300044673 Ga0453683_0147998 Ga0453683_0147998_263_1252 326
149 3300044673 Ga0453683_0171002 Ga0453683_0171002_116_1096 326
150 3300044712 Ga0453684_0002198 Ga0453684_0002198_34978_35958 326
151 3300044712 Ga0453684_0023022 Ga0453684_0023022_1700_2680 326
152 3300044712 Ga0453684_0150104 Ga0453684_0150104_712_1692 326
153 3300044712 Ga0453684_0201230 Ga0453684_0201230_275_1255 326
154 3300044712 Ga0453684_0642902 Ga0453684_0642902_142_1122 326
155 3300045051 Ga0451576_0009557 Ga0451576_0009557_1950_2930 326
156 3300045051 Ga0451576_0041652 Ga0451576_0041652_521_1501 326
157 3300045051 Ga0451576_0124358 Ga0451576_0124358_531_1511 326
158 3300048911 Ga0496108_0110839 Ga0496108_0110839_552_1532 326
159 3300049590 Ga0501074_0046925 Ga0501074_0046925_1736_2716 326
160 3300049591 Ga0501075_0003300 Ga0501075_0003300_3147_4127 326
161 3300049592 Ga0501076_0010929 Ga0501076_0010929_1926_2906 326
162 3300049741 Ga0501079_0015098 Ga0501079_0015098_2429_3409 326
163 3300049742 Ga0501080_0042239 Ga0501080_0042239_3035_4015 326
164 3300049824 Ga0501045_0060753 Ga0501045_0060753_439_1419 326
165 3300050507 nmdc:mga05p37_114661_c1 nmdc:mga05p37_114661_c1_1025_2005 326
166 3300050507 nmdc:mga05p37_37667_c1 nmdc:mga05p37_37667_c1_4138_5118 326
167 3300050508 nmdc:mga09592_47742_c1 nmdc:mga09592_47742_c1_279_1259 326
168 3300050508 nmdc:mga09592_60246_c1 nmdc:mga09592_60246_c1_228_1208 326
169 3300060353 Ga0501082_0095018 Ga0501082_0095018_1258_2238 326
170 3300036647 Ga0316582_0030257 Ga0316582_0030257_1004_2002 327
171 3300005445 Ga0070708_100413014 Ga0070708_1004130142 328
172 3300044712 Ga0453684_0160028 Ga0453684_0160028_575_1570 329
173 3300031733 Ga0316577_10087586 Ga0316577_100875862 332
174 3300039093 Ga0400489_28568 Ga0400489_28568_66492_67508 332
175 3300031665 Ga0316575_10012669 Ga0316575_100126691 333
176 3300042876 Ga0451577_0002086 Ga0451577_0002086_20749_21774 334
177 3300044712 Ga0453684_0007295 Ga0453684_0007295_11794_12819 334
178 3300036647 Ga0316582_0000668 Ga0316582_0000668_4373_5419 335
179 3300031665 Ga0316575_10009174 Ga0316575_100091743 337
180 3300035398 Ga0316574_0001206 Ga0316574_0001206_504_1571 337
181 3300005545 Ga0070695_100032830 Ga0070695_1000328301 341
182 3300044712 Ga0453684_0052364 Ga0453684_0052364_3615_4709 343
183 2162886007 SwRhRL2b_contig_1154756 SwRhRL2b_0985.00004870 350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

87

291

0.93

PF13379

NMT1_2

NMT1-like family

72

280

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ix1-assembly1.cif.gz_A periplasmic n-formyl-4-amino-5-aminomethyl-2-methylpyrimidine binding protein from bacillus halodurans 0.8471 54 346
4nmy-assembly2.cif.gz_B crystal structure of the thiamin-bound form of substrate-binding protein of abc transporter from clostridium difficile 0.8421 56 350
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8387 56 343
4nmy-assembly2.cif.gz_B crystal structure of the thiamin-bound form of substrate-binding protein of abc transporter from clostridium difficile 0.8294 56 350
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8249 52 343
ID Description Score Start End Superfamily
3ix1B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9016 54 346 3.40.190.10
3ix1B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8886 54 346 3.40.190.10
4nmyB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8859 56 350 3.40.190.10
4nmyB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.873 56 350 3.40.190.10
3ix1B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8719 139 235 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A353N9D8-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9424 115 350 GO:0009228
AF-A0A353N9D8-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9199 115 350 GO:0009228
AF-A0A2G6Q350-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9146 46 350 GO:0009228
AF-L1PFN9-F1-model_v4 deleted 0.9134 127 350
AF-A0A7K2AXT1-F1-model_v4 Thiamine pyrimidine synthase 0.9054 56 350 GO:0009228
GO:0016740
GO:0046872

Feature Viewer

pLDDT pTM Quality
88.08 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map