F278704

General Info

Members Datasets Scaffolds Average Seq Length
182 137 364 462

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100109821|Ga0070663_1001098212
Length 502
Sequence VGTPPRLCHYAVLVDTFTKPAELGSALERFFKIAERGSTVGREVRGGVVTFFTMAYIIALNPIILGFAQDKDGKFLGGGAAPNTVAIAAGTALVAGLVTILMGVVANYPLALATGLGLNAFVAFTIAKQMTWADAMGLIVIEGIIILVLVLTGFRTAVFHAVPAQLKIAISVGIGLFIALIGFVDAGFVRRTGAGPVPVELGIGGELAGWPVLVFAFGLALVITLWVRQVKGAILIAIVVTTXXXIVVEAIGNFGPSVDAKGDYHAKAWNLVVPQWPDKIIDKPHFDTVFHFSLFGSFADAGAVTALLLIFTLMLADFFDTMGTMTAIGAEAGLLDEEGVPPNTERILVVDSIAAAAGGVAGVSSNTSYIESASGVGEGARTGLASVVTGALFLLAILFTPLVKIIPSEAAVPALVLVGFLMMQQVKGIDWDDLEIAIPAFLTIVLMPFTYSITVGIGAGFLAYTLIKVVLGKASQIHPLLWVVSGLFVLYFAIDPLTRWLT

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
42 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
44 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
48 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
49 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
50 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
51 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
52 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
53 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
54 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
57 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
58 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
59 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
62 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
63 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
64 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
65 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
66 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
67 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
68 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
69 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
70 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
71 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
72 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
78 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
79 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
80 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
81 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
82 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
83 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
84 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
85 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
86 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
87 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
88 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
91 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
92 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
93 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
94 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
95 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
96 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
99 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
100 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
101 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
104 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
105 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
106 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
107 2643221561 Nocardioides sp. Root151 Isolate Unclassified
108 2643221641 Nocardioides sp. Root122 Isolate Unclassified
109 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
110 2643221696 Nocardioides sp. Root140 Isolate Unclassified
111 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
112 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
113 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
114 2738541278 Niastella sp. CF465 Isolate Unclassified
115 2739367898 Nocardioides sp. CF479 Isolate Unclassified
116 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
117 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
118 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
119 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
120 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
121 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
122 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
123 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
124 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
125 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
126 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
127 2891562705 Microbispora tritici MT50 Isolate Unclassified
128 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
129 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
130 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
131 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
132 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
133 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
134 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
135 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
136 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
137 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 81.32
Metatranscriptomes 0.55
Isolates 18.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.33
Nodule 0.55
Rhizoplane 4.95
Rhizosphere 56.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100109821 3300005455 Bacteria 2071
2 rootH1_10052321 3300003316 Bacteria 5124
3 rootL2_10061846 3300003322 Bacteria 5978
4 rootH1_10001184 3300003323 Bacteria 17919
5 Ga0070658_10075616 3300005327 Bacteria 2762
6 Ga0070683_100086109 3300005329 Bacteria 2946
7 Ga0070683_100112307 3300005329 Bacteria 2571
8 Ga0070659_100027160 3300005366 Bacteria 4408
9 Ga0070698_100003647 3300005471 Bacteria 16904
10 Ga0070698_100219781 3300005471 Bacteria 1834
11 Ga0070684_100088674 3300005535 Bacteria 2748
12 Ga0068855_100018723 3300005563 Bacteria 8325
13 Ga0068855_100048327 3300005563 Bacteria 5022
14 Ga0070664_100062522 3300005564 Bacteria 3174
15 Ga0068857_100021506 3300005577 Bacteria 5677
16 Ga0068864_100149401 3300005618 Bacteria 2115
17 Ga0068860_100001392 3300005843 Bacteria 26214
18 Ga0081455_10000172 3300005937 Bacteria 80655
19 Ga0081455_10075202 3300005937 Bacteria 2787
20 Ga0075365_10001912 3300006038 Bacteria 9819
21 Ga0075365_10014294 3300006038 Bacteria 4773
22 Ga0075365_10030407 3300006038 Bacteria 3459
23 Ga0075365_10085987 3300006038 Bacteria 2137
24 Ga0075368_10000624 3300006042 Bacteria 10700
25 Ga0075368_10018232 3300006042 Bacteria 2636
26 Ga0075363_100038530 3300006048 Bacteria 2514
27 Ga0075363_100050788 3300006048 Bacteria 2210
28 Ga0075364_10005373 3300006051 Bacteria 7437
29 Ga0075364_10011762 3300006051 Bacteria 5328
30 Ga0075364_10039984 3300006051 Bacteria 3041
31 Ga0075362_10006470 3300006177 Bacteria 4370
32 Ga0075367_10056234 3300006178 Bacteria 2337
33 Ga0075370_10002207 3300006353 Bacteria 8946
34 Ga0075370_10006714 3300006353 Bacteria 5804
35 Ga0075370_10061626 3300006353 Bacteria 2137
36 Ga0075431_100156836 3300006847 Bacteria 2342
37 Ga0105240_10237801 3300009093 Bacteria 2113
38 Ga0114129_10010677 3300009147 Bacteria 13098
39 Ga0105237_10012312 3300009545 Bacteria 9012
40 Ga0105237_10079614 3300009545 Bacteria 3267
41 Ga0105249_10147741 3300009553 Bacteria 2260
42 Ga0105239_10047640 3300010375 Bacteria 4697
43 Ga0105246_10084541 3300011119 Bacteria 2270
44 Ga0105246_10130029 3300011119 Bacteria 1879
45 Ga0163162_10024688 3300013306 Bacteria 5937
46 Ga0206353_11793231 3300020082 Bacteria 3366
47 Ga0207647_10015191 3300025904 Bacteria 5288
48 Ga0207647_10030098 3300025904 Bacteria 3506
49 Ga0207705_10031499 3300025909 Bacteria 3787
50 Ga0207657_10001578 3300025919 Bacteria 24478
51 Ga0207679_10044515 3300025945 Bacteria 3203
52 Ga0207667_10049784 3300025949 Bacteria 4423
53 Ga0207658_10012201 3300025986 Bacteria 5864
54 Ga0207678_10099165 3300026067 Bacteria 2488
55 Ga0207674_10044118 3300026116 Bacteria 4595
56 Ga0207674_10196817 3300026116 Bacteria 1965
57 Ga0207683_10023589 3300026121 Bacteria 5292
58 Ga0209813_10002710 3300027866 Bacteria 4079
59 Ga0268264_10000560 3300028381 Bacteria 45822
60 Ga0307513_10108922 3300031456 Bacteria 2769
61 Ga0307509_10070161 3300031507 Bacteria 3661
62 Ga0307410_10007814 3300031852 Bacteria 5883
63 Ga0307409_100007935 3300031995 Bacteria 6395
64 Ga0395901_0027707 3300038443 Bacteria 5825
65 Ga0242420_003832 3300038996 Bacteria 2243
66 Ga0451833_0272607 3300041491 Bacteria 7616
67 Ga0439442_010348 3300042002 Bacteria 1891
68 Ga0466972_0000011 3300044658 Bacteria 249697
69 Ga0466965_0001975 3300044683 Bacteria 8582
70 Ga0466966_0042641 3300044684 Bacteria 2911
71 Ga0466966_0118149 3300044684 Bacteria 1631
72 Ga0466961_0017268 3300044693 Bacteria 4634
73 Ga0466970_0002426 3300044765 Bacteria 9007
74 Ga0466970_0054454 3300044765 Bacteria 2136
75 Ga0466957_0003036 3300044842 Bacteria 9123
76 Ga0466957_0005796 3300044842 Bacteria 6947
77 Ga0466957_0007953 3300044842 Bacteria 6016
78 Ga0466957_0029065 3300044842 Bacteria 3294
79 Ga0466957_0046912 3300044842 Bacteria 2624
80 Ga0466960_0013297 3300044901 Bacteria 3494
81 Ga0466960_0040352 3300044901 Bacteria 2207
82 Ga0466959_0065583 3300045049 Bacteria 2635
83 Ga0466958_0019075 3300045836 Bacteria 3989
84 Ga0466958_0052254 3300045836 Bacteria 2476
85 Ga0466967_0015088 3300045976 Bacteria 6045
86 Ga0466967_0024142 3300045976 Bacteria 4994
87 Ga0466967_0083083 3300045976 Bacteria 2895
88 Ga0496102_0000958 3300048905 Bacteria 27169
89 Ga0496102_0092112 3300048905 Bacteria 2806
90 Ga0496106_0052037 3300048909 Bacteria 3088
91 Ga0496106_0184070 3300048909 Bacteria 1659
92 Ga0496109_0132798 3300048912 Bacteria 2324
93 Ga0496110_0232525 3300048913 Bacteria 1677
94 Ga0496111_0072311 3300048914 Bacteria 2510
95 Ga0496113_0026682 3300048916 Bacteria 4133
96 Ga0496113_0112828 3300048916 Bacteria 2118
97 Ga0496117_0003588 3300048920 Bacteria 17903
98 Ga0496119_0096098 3300048922 Bacteria 1672
99 Ga0496122_0000243 3300048925 Bacteria 122429
100 Ga0496122_0077709 3300048925 Bacteria 2329
101 Ga0496123_0036293 3300048926 Bacteria 3498
102 Ga0496125_0000015 3300048928 Bacteria 516648
103 Ga0501031_0002139 3300049568 Bacteria 12461
104 Ga0501031_0090192 3300049568 Bacteria 1999
105 Ga0501039_0002088 3300049575 Bacteria 14808
106 Ga0501040_0002930 3300049576 Bacteria 11036
107 Ga0501042_0118871 3300049578 Bacteria 1902
108 Ga0501046_0008643 3300049580 Bacteria 8854
109 Ga0501067_0041878 3300049583 Bacteria 2543
110 Ga0501068_0004878 3300049584 Bacteria 7305
111 Ga0501070_0035462 3300049586 Bacteria 4168
112 Ga0501071_0007611 3300049587 Bacteria 7134
113 Ga0501072_0087663 3300049588 Bacteria 2470
114 Ga0501073_0031405 3300049589 Bacteria 3790
115 Ga0501074_0022723 3300049590 Bacteria 4559
116 Ga0501076_0003946 3300049592 Bacteria 10469
117 Ga0501225_0000116 3300049705 Bacteria 24815
118 Ga0501079_0001018 3300049741 Bacteria 19459
119 Ga0501081_0006569 3300049743 Bacteria 7556
120 Ga0501035_0011092 3300049822 Bacteria 8345
121 Ga0501044_0053903 3300049823 Bacteria 4136
122 Ga0501044_0237879 3300049823 Bacteria 1766
123 Ga0501045_0010839 3300049824 Bacteria 6390
124 nmdc:mga03n38_11580_c1 3300050490 Bacteria 3292
125 nmdc:mga03n38_48112_c1 3300050490 Bacteria 1891
126 nmdc:mga00v17_46446_c1 3300050491 Bacteria 2627
127 nmdc:mga00v17_47672_c1 3300050491 Bacteria 2596
128 nmdc:mga00v17_57215_c1 3300050491 Bacteria 2385
129 nmdc:mga00v17_61382_c1 3300050491 Bacteria 2311
130 nmdc:mga0yw44_137665_c1 3300050492 Bacteria 1585
131 nmdc:mga0yw44_17207_c1 3300050492 Bacteria 3929
132 nmdc:mga0yw44_38227_c1 3300050492 Bacteria 2838
133 nmdc:mga0yw44_43504_c1 3300050492 Bacteria 2682
134 nmdc:mga0yw44_5328_c1 3300050492 Bacteria 6052
135 nmdc:mga0yw44_77409_c1 3300050492 Bacteria 2078
136 nmdc:mga0yw44_94833_c1 3300050492 Bacteria 1892
137 nmdc:mga06z11_12207_c1 3300050494 Bacteria 3731
138 nmdc:mga04h51_1848_c1 3300050495 Bacteria 4947
139 nmdc:mga07m45_1443_c1 3300050496 Bacteria 10899
140 nmdc:mga07m45_5360_c1 3300050496 Bacteria 6387
141 nmdc:mga05p37_256663_c1 3300050507 Bacteria 2094
142 nmdc:mga05p37_86779_c1 3300050507 Bacteria 3857
143 nmdc:mga06r32_232314_c1 3300050510 Bacteria 1832
144 Ga0500644_0000276 3300053088 Bacteria 28535
145 Ga0500583_0000066 3300053092 Bacteria 65583
146 Ga0500641_0000953 3300053096 Bacteria 10327
147 Ga0501084_0005437 3300054114 Bacteria 10447
148 Ga0466962_0004693 3300061719 Bacteria 6563
149 Ga0530510_0019212 3300061734 Bacteria 4848
150 2515856240 2515154155 Bacteria 7985436
151 2554260547 2554235005 Bacteria 6457341
152 2643824255 2643221561 Bacteria 4984412
153 2644229385 2643221641 Bacteria 4490190
154 2644458292 2643221681 Bacteria 3707866
155 2644533559 2643221696 Bacteria 5431823
156 2645725409 2643221962 Bacteria 3874254
157 2676478774 2675903058 Bacteria 6822861
158 2676495896 2675903060 Bacteria 10051191
159 2738727458 2738541278 Bacteria 9755573
160 2740168085 2739367898 Bacteria 4367674
161 2784471381 2784132109 Bacteria 3141763
162 2799185749 2799112218 Bacteria 4315149
163 2812362522 2811994880 Bacteria 4147780
164 2827628655 2827628540 Bacteria 6858585
165 2848552210 2848551377 Bacteria 3720646
166 2856744614 2856741275 Bacteria 8096094
167 2862707630 2862705112 Bacteria 6563286
168 2866554128 2866552031 Bacteria 5824618
169 2873316389 2873314349 Bacteria 8512634
170 2891398920 2891395885 Bacteria 9251614
171 2891559128 2891554331 Bacteria 8812224
172 2891569304 2891562705 Bacteria 8039471
173 2895432070 2895427314 Bacteria 13147766
174 2919448149 2919446982 Bacteria 3994487
175 2990044686 2990044586 Bacteria 6603797
176 8008489750 8008485437 Bacteria 7198341
177 8025479988 8025478263 Bacteria 8209203
178 8025528674 8025524527 Bacteria 7197316
179 8054163030 8054160619 Bacteria 7783213
180 8054613710 8054609563 Bacteria 5170090
181 8055072802 8055066027 Bacteria 9479577
182 8055173903 8055172936 Bacteria 9305943
183 Ga0070663_100109821
184 rootH1_10052321
185 rootL2_10061846
186 rootH1_10001184
187 Ga0070658_10075616
188 Ga0070683_100086109
189 Ga0070683_100112307
190 Ga0070659_100027160
191 Ga0070698_100003647
192 Ga0070698_100219781
193 Ga0070684_100088674
194 Ga0068855_100018723
195 Ga0068855_100048327
196 Ga0070664_100062522
197 Ga0068857_100021506
198 Ga0068864_100149401
199 Ga0068860_100001392
200 Ga0081455_10000172
201 Ga0081455_10075202
202 Ga0075365_10001912
203 Ga0075365_10014294
204 Ga0075365_10030407
205 Ga0075365_10085987
206 Ga0075368_10000624
207 Ga0075368_10018232
208 Ga0075363_100038530
209 Ga0075363_100050788
210 Ga0075364_10005373
211 Ga0075364_10011762
212 Ga0075364_10039984
213 Ga0075362_10006470
214 Ga0075367_10056234
215 Ga0075370_10002207
216 Ga0075370_10006714
217 Ga0075370_10061626
218 Ga0075431_100156836
219 Ga0105240_10237801
220 Ga0114129_10010677
221 Ga0105237_10012312
222 Ga0105237_10079614
223 Ga0105249_10147741
224 Ga0105239_10047640
225 Ga0105246_10084541
226 Ga0105246_10130029
227 Ga0163162_10024688
228 Ga0206353_11793231
229 Ga0207647_10015191
230 Ga0207647_10030098
231 Ga0207705_10031499
232 Ga0207657_10001578
233 Ga0207679_10044515
234 Ga0207667_10049784
235 Ga0207658_10012201
236 Ga0207678_10099165
237 Ga0207674_10044118
238 Ga0207674_10196817
239 Ga0207683_10023589
240 Ga0209813_10002710
241 Ga0268264_10000560
242 Ga0307513_10108922
243 Ga0307509_10070161
244 Ga0307410_10007814
245 Ga0307409_100007935
246 Ga0395901_0027707
247 Ga0242420_003832
248 Ga0451833_0272607
249 Ga0439442_010348
250 Ga0466972_0000011
251 Ga0466965_0001975
252 Ga0466966_0042641
253 Ga0466966_0118149
254 Ga0466961_0017268
255 Ga0466970_0002426
256 Ga0466970_0054454
257 Ga0466957_0003036
258 Ga0466957_0005796
259 Ga0466957_0007953
260 Ga0466957_0029065
261 Ga0466957_0046912
262 Ga0466960_0013297
263 Ga0466960_0040352
264 Ga0466959_0065583
265 Ga0466958_0019075
266 Ga0466958_0052254
267 Ga0466967_0015088
268 Ga0466967_0024142
269 Ga0466967_0083083
270 Ga0496102_0000958
271 Ga0496102_0092112
272 Ga0496106_0052037
273 Ga0496106_0184070
274 Ga0496109_0132798
275 Ga0496110_0232525
276 Ga0496111_0072311
277 Ga0496113_0026682
278 Ga0496113_0112828
279 Ga0496117_0003588
280 Ga0496119_0096098
281 Ga0496122_0000243
282 Ga0496122_0077709
283 Ga0496123_0036293
284 Ga0496125_0000015
285 Ga0501031_0002139
286 Ga0501031_0090192
287 Ga0501039_0002088
288 Ga0501040_0002930
289 Ga0501042_0118871
290 Ga0501046_0008643
291 Ga0501067_0041878
292 Ga0501068_0004878
293 Ga0501070_0035462
294 Ga0501071_0007611
295 Ga0501072_0087663
296 Ga0501073_0031405
297 Ga0501074_0022723
298 Ga0501076_0003946
299 Ga0501225_0000116
300 Ga0501079_0001018
301 Ga0501081_0006569
302 Ga0501035_0011092
303 Ga0501044_0053903
304 Ga0501044_0237879
305 Ga0501045_0010839
306 nmdc:mga03n38_11580_c1
307 nmdc:mga03n38_48112_c1
308 nmdc:mga00v17_46446_c1
309 nmdc:mga00v17_47672_c1
310 nmdc:mga00v17_57215_c1
311 nmdc:mga00v17_61382_c1
312 nmdc:mga0yw44_137665_c1
313 nmdc:mga0yw44_17207_c1
314 nmdc:mga0yw44_38227_c1
315 nmdc:mga0yw44_43504_c1
316 nmdc:mga0yw44_5328_c1
317 nmdc:mga0yw44_77409_c1
318 nmdc:mga0yw44_94833_c1
319 nmdc:mga06z11_12207_c1
320 nmdc:mga04h51_1848_c1
321 nmdc:mga07m45_1443_c1
322 nmdc:mga07m45_5360_c1
323 nmdc:mga05p37_256663_c1
324 nmdc:mga05p37_86779_c1
325 nmdc:mga06r32_232314_c1
326 Ga0500644_0000276
327 Ga0500583_0000066
328 Ga0500641_0000953
329 Ga0501084_0005437
330 Ga0466962_0004693
331 Ga0530510_0019212
332 2515856240
333 2554260547
334 2643824255
335 2644229385
336 2644458292
337 2644533559
338 2645725409
339 2676478774
340 2676495896
341 2738727458
342 2740168085
343 2784471381
344 2799185749
345 2812362522
346 2827628655
347 2848552210
348 2856744614
349 2862707630
350 2866554128
351 2873316389
352 2891398920
353 2891559128
354 2891569304
355 2895432070
356 2919448149
357 2990044686
358 8008489750
359 8025479988
360 8025528674
361 8054163030
362 8054613710
363 8055072802
364 8055173903

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00860

Xan_ur_permease

Permease family

41

459

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xls-assembly1.cif.gz_A-2 crystal structure of uraa in occluded conformation 0.686 9 381
8uc1-assembly1.cif.gz_B cryo-em structure of dolphin prestin in low cl buffer 0.6538 9 374
5xls-assembly1.cif.gz_A-2 crystal structure of uraa in occluded conformation 0.6363 9 381
7xuj-assembly1.cif.gz_B human slc26a3 in complex with uk5099 0.6303 8 377
7v75-assembly1.cif.gz_A thermostabilized human prestin in complex with salicylate 0.6247 15 380
ID Description Score Start End Superfamily
af_Q57772_21_432_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.816 19 403 1.20.1740.10
af_Q57772_21_432_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7759 19 403 1.20.1740.10
af_Q6ZIE6_46_504_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.5861 29 380 1.20.1730.10
af_Q6ZIE6_46_504_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.5147 29 380 1.20.1730.10
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.4893 12 376 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A482RVI1-F1-model_v4 deleted 0.9058 2 296
AF-A0A836ZIQ9-F1-model_v4 deleted 0.9043 52 323
AF-A0A340YCZ0-F1-model_v4 deleted 0.9024 63 294
AF-A0A377YVX8-F1-model_v4 Xanthine/uracil/thiamine/ascorbate permease family protein 0.897 51 317 GO:0005886
GO:0012505
GO:0015207
AF-A0A340YCZ0-F1-model_v4 deleted 0.8949 63 294

Map