F278608

General Info

Members Datasets Scaffolds Average Seq Length
182 131 364 193

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100335101|Ga0070675_1003351012
Length 229
Sequence MPFAVPKVDRDRLVVLLGPPGAGKGTQAKRLAQRYGIPQLSTGDMLRDARAKGSELGKRVAAVMDAGHLVSDDIVIALIEEKLADGSTKGGAIFDGFPRTVAQAEALDAMLTRHGRHVDRAVLMYVPDDEVVRRNSGRRMCSKCQRTYHVEFSPPKVADVCDACGGELIQRADDRPEKIRARLEVYHREAPLVGYYEGKKLLRRVDGIGLLDDVYDRLARAVDGNGDDR

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
57 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
58 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
69 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
70 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
85 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
86 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
87 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
88 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
89 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
90 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
128 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
129 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
130 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.85
Nodule 0
Rhizoplane 3.85
Rhizosphere 87.36
Stem 0
Stem Tuber 0
Unclassified 1.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100335101 3300005354 Bacteria 1339
2 Ga0065715_10103029 3300005293 Bacteria 3065
3 Ga0070658_10099669 3300005327 Bacteria 2400
4 Ga0070689_100139336 3300005340 Bacteria 1950
5 Ga0070691_10000386 3300005341 Bacteria 16019
6 Ga0070661_100000364 3300005344 Bacteria 35776
7 Ga0070673_100173332 3300005364 Bacteria 1842
8 Ga0070711_100300490 3300005439 Bacteria 1276
9 Ga0070708_100015208 3300005445 Bacteria 6347
10 Ga0070681_10041239 3300005458 Bacteria 4625
11 Ga0070706_100002429 3300005467 Bacteria 18770
12 Ga0070707_100014113 3300005468 Bacteria 7485
13 Ga0070707_100015588 3300005468 Bacteria 7133
14 Ga0070707_100146672 3300005468 Bacteria 2297
15 Ga0070698_100130352 3300005471 Bacteria 2470
16 Ga0070693_100011656 3300005547 Bacteria 4431
17 Ga0068855_100019979 3300005563 Bacteria 8045
18 Ga0068856_100123710 3300005614 Bacteria 2589
19 Ga0068856_100131430 3300005614 Bacteria 2508
20 Ga0068856_100192241 3300005614 Bacteria 2055
21 Ga0068852_101098387 3300005616 Bacteria 815
22 Ga0068858_100062193 3300005842 Bacteria 3452
23 Ga0081455_10015866 3300005937 Bacteria 7294
24 Ga0081455_10134744 3300005937 Bacteria 1926
25 Ga0081539_10046287 3300005985 Bacteria 2494
26 Ga0070717_10001223 3300006028 Bacteria 17449
27 Ga0070712_100000821 3300006175 Bacteria 18441
28 Ga0075366_10211901 3300006195 Bacteria 1179
29 Ga0075370_10267402 3300006353 Bacteria 1015
30 Ga0068871_100117742 3300006358 Bacteria 2241
31 Ga0075433_10676963 3300006852 Bacteria 904
32 Ga0099795_10022724 3300007788 Bacteria 2073
33 Ga0105240_10025381 3300009093 Bacteria 7788
34 Ga0105240_10123918 3300009093 Bacteria 3109
35 Ga0111539_10077885 3300009094 Bacteria 3901
36 Ga0105242_10171280 3300009176 Bacteria 1908
37 Ga0157370_10410764 3300013104 Bacteria 1246
38 Ga0157369_10558122 3300013105 Bacteria 1183
39 Ga0157372_10037651 3300013307 Bacteria 5337
40 Ga0157372_10087159 3300013307 Bacteria 3542
41 Ga0157372_10196558 3300013307 Bacteria 2336
42 Ga0157379_10019718 3300014968 Bacteria 5958
43 Ga0157379_11447739 3300014968 Bacteria 667
44 Ga0213872_10114844 3300021361 Bacteria 1193
45 Ga0213875_10386079 3300021388 Bacteria 667
46 Ga0207705_10239331 3300025909 Bacteria 1382
47 Ga0207684_10000252 3300025910 Bacteria 79806
48 Ga0207707_10147418 3300025912 Bacteria 2057
49 Ga0207695_10002926 3300025913 Bacteria 24665
50 Ga0207695_10560211 3300025913 Bacteria 1024
51 Ga0207693_10001210 3300025915 Bacteria 23009
52 Ga0207663_10152521 3300025916 Bacteria 1622
53 Ga0207649_10000194 3300025920 Bacteria 50112
54 Ga0207646_10039882 3300025922 Bacteria 4225
55 Ga0207681_10145011 3300025923 Bacteria 1773
56 Ga0207659_10016365 3300025926 Bacteria 4824
57 Ga0207686_10093945 3300025934 Bacteria 1987
58 Ga0207670_10225418 3300025936 Bacteria 1437
59 Ga0207691_10072754 3300025940 Bacteria 3101
60 Ga0207667_10119201 3300025949 Bacteria 2720
61 Ga0207640_10099522 3300025981 Bacteria 2035
62 Ga0207702_10116229 3300026078 Bacteria 2387
63 Ga0207702_10360872 3300026078 Bacteria 1392
64 Ga0207702_10709516 3300026078 Bacteria 991
65 Ga0207698_10054652 3300026142 Bacteria 3073
66 Ga0265318_10000037 3300028577 Bacteria 138223
67 Ga0265338_10014341 3300028800 Bacteria 8827
68 Ga0307511_10056243 3300030521 Bacteria 3079
69 Ga0265325_10108077 3300031241 Bacteria 1355
70 Ga0265340_10023130 3300031247 Bacteria 3171
71 Ga0265331_10000186 3300031250 Bacteria 76149
72 Ga0265331_10003502 3300031250 Bacteria 10110
73 Ga0265327_10000392 3300031251 Bacteria 82296
74 Ga0265316_10549732 3300031344 Unclassified 822
75 Ga0307408_100539189 3300031548 Bacteria 1028
76 Ga0307508_10020177 3300031616 Bacteria 6053
77 Ga0265314_10025792 3300031711 Bacteria 4427
78 Ga0265342_10354733 3300031712 Bacteria 763
79 Ga0307407_10273589 3300031903 Bacteria 1167
80 Ga0307414_10100066 3300032004 Bacteria 2179
81 Ga0307414_10422735 3300032004 Bacteria 1162
82 Ga0373959_0054911 3300034820 Bacteria 869
83 Ga0373934_0083946 3300035086 Bacteria 1281
84 Ga0373957_0122157 3300035120 Bacteria 1055
85 Ga0373943_0007235 3300035170 Bacteria 4980
86 Ga0316574_0009048 3300035398 Bacteria 5565
87 Ga0373931_0049293 3300035691 Bacteria 2236
88 Ga0373935_0030799 3300035692 Bacteria 3326
89 Ga0373935_0060054 3300035692 Bacteria 2432
90 Ga0373927_0258943 3300035695 Bacteria 1144
91 Ga0373927_1098947 3300035695 Bacteria 524
92 Ga0373933_0116723 3300035724 Bacteria 1669
93 Ga0373933_0506422 3300035724 Bacteria 791
94 Ga0373947_0687606 3300035725 Bacteria 698
95 Ga0373937_0003527 3300036401 Bacteria 13164
96 Ga0373937_0378207 3300036401 Bacteria 1343
97 Ga0373937_0455167 3300036401 Bacteria 1215
98 Ga0316584_0085683 3300036712 Bacteria 2359
99 Ga0373925_0002514 3300037068 Bacteria 14651
100 Ga0373925_0043443 3300037068 Bacteria 3336
101 Ga0395900_0161372 3300037418 Bacteria 2286
102 Ga0436364_0066405 3300037853 Bacteria 1396
103 Ga0436364_1420880 3300037853 Bacteria 588
104 Ga0436361_0216520 3300039447 Bacteria 1570
105 Ga0436361_0554328 3300039447 Bacteria 710
106 Ga0436361_0903481 3300039447 Bacteria 2516
107 Ga0436362_0198091 3300039453 Bacteria 1149
108 Ga0436362_0517285 3300039453 Bacteria 2185
109 Ga0451795_0044846 3300041456 Bacteria 746
110 Ga0451795_1266664 3300041456 Bacteria 896
111 Ga0451795_1574351 3300041456 Bacteria 2098
112 Ga0451807_2153725 3300041486 Bacteria 777
113 Ga0451837_1126821 3300041494 Bacteria 1208
114 Ga0451855_0204420 3300041511 Unclassified 712
115 Ga0451855_1836452 3300041511 Bacteria 2249
116 Ga0451853_1137708 3300041512 Bacteria 685
117 Ga0451577_0704416 3300042876 Bacteria 914
118 Ga0453684_0000375 3300044712 Bacteria 183706
119 Ga0453684_0065347 3300044712 Bacteria 4640
120 Ga0495664_0182464 3300046477 Bacteria 1272
121 Ga0495585_0101012 3300046492 Bacteria 1543
122 Ga0495652_0296264 3300046529 Bacteria 1178
123 Ga0495665_0148070 3300046531 Bacteria 1226
124 Ga0495586_0050175 3300046535 Bacteria 2258
125 Ga0495669_0011577 3300046684 Bacteria 3749
126 Ga0495613_0000576 3300046689 Bacteria 29823
127 Ga0495674_0163341 3300047319 Bacteria 1862
128 Ga0496100_0433306 3300048903 Bacteria 1006
129 Ga0496106_0265102 3300048909 Bacteria 1375
130 Ga0496107_0147454 3300048910 Bacteria 1740
131 Ga0501031_0894762 3300049568 Bacteria 568
132 Ga0501032_0075622 3300049569 Bacteria 2243
133 Ga0501033_0012240 3300049570 Bacteria 6548
134 Ga0501033_0097267 3300049570 Bacteria 2151
135 Ga0501033_0225962 3300049570 Bacteria 1331
136 Ga0501033_0314891 3300049570 Bacteria 1100
137 Ga0501033_0440815 3300049570 Bacteria 905
138 Ga0501034_0027593 3300049571 Bacteria 5774
139 Ga0501034_0134126 3300049571 Bacteria 2458
140 Ga0501034_0606454 3300049571 Bacteria 1000
141 Ga0501036_0066873 3300049572 Bacteria 3041
142 Ga0501037_0032419 3300049573 Bacteria 3858
143 Ga0501038_0076553 3300049574 Bacteria 2826
144 Ga0501038_0414560 3300049574 Bacteria 1040
145 Ga0501040_0563256 3300049576 Bacteria 823
146 Ga0501043_0014584 3300049579 Bacteria 6152
147 Ga0501043_0062324 3300049579 Bacteria 2928
148 Ga0501043_0846860 3300049579 Bacteria 659
149 Ga0501046_0011762 3300049580 Bacteria 7472
150 Ga0501047_0030074 3300049581 Bacteria 5237
151 Ga0501047_0037637 3300049581 Bacteria 4678
152 Ga0501047_0164561 3300049581 Bacteria 2089
153 Ga0501068_0099795 3300049584 Bacteria 1799
154 Ga0501070_0029666 3300049586 Bacteria 4584
155 Ga0501070_0224938 3300049586 Bacteria 1538
156 Ga0501073_0077718 3300049589 Bacteria 2309
157 Ga0501077_0417977 3300049593 Bacteria 858
158 Ga0501079_0714628 3300049741 Bacteria 789
159 Ga0501080_0040487 3300049742 Bacteria 4346
160 Ga0501080_0074708 3300049742 Bacteria 3153
161 Ga0501080_0720663 3300049742 Bacteria 879
162 Ga0501080_0782798 3300049742 Bacteria 837
163 Ga0501083_0001752 3300049744 Bacteria 14807
164 Ga0501263_005422 3300049760 Bacteria 1439
165 Ga0501035_0050843 3300049822 Bacteria 3713
166 Ga0501035_0087599 3300049822 Bacteria 2744
167 Ga0501035_0095660 3300049822 Bacteria 2611
168 Ga0501035_0413573 3300049822 Bacteria 1120
169 Ga0501035_0519668 3300049822 Bacteria 978
170 Ga0501044_0013081 3300049823 Bacteria 8981
171 Ga0501044_0065191 3300049823 Bacteria 3715
172 Ga0501044_0345520 3300049823 Bacteria 1408
173 Ga0501044_1059037 3300049823 Bacteria 681
174 Ga0501044_1443239 3300049823 Bacteria 553
175 nmdc:mga07m45_148823_c1 3300050496 Bacteria 1357
176 nmdc:mga05p37_1145889_c1 3300050507 Unclassified 809
177 nmdc:mga08y16_112266_c1 3300050511 Bacteria 2837
178 Ga0500562_000976 3300053108 Bacteria 6991
179 Ga0500595_021169 3300053119 Bacteria 2326
180 Ga0500608_000084 3300053122 Bacteria 38834
181 Ga0500559_0099813 3300053136 Bacteria 1337
182 Ga0501084_0000175 3300054114 Bacteria 50123
183 Ga0070675_100335101
184 Ga0065715_10103029
185 Ga0070658_10099669
186 Ga0070689_100139336
187 Ga0070691_10000386
188 Ga0070661_100000364
189 Ga0070673_100173332
190 Ga0070711_100300490
191 Ga0070708_100015208
192 Ga0070681_10041239
193 Ga0070706_100002429
194 Ga0070707_100014113
195 Ga0070707_100015588
196 Ga0070707_100146672
197 Ga0070698_100130352
198 Ga0070693_100011656
199 Ga0068855_100019979
200 Ga0068856_100123710
201 Ga0068856_100131430
202 Ga0068856_100192241
203 Ga0068852_101098387
204 Ga0068858_100062193
205 Ga0081455_10015866
206 Ga0081455_10134744
207 Ga0081539_10046287
208 Ga0070717_10001223
209 Ga0070712_100000821
210 Ga0075366_10211901
211 Ga0075370_10267402
212 Ga0068871_100117742
213 Ga0075433_10676963
214 Ga0099795_10022724
215 Ga0105240_10025381
216 Ga0105240_10123918
217 Ga0111539_10077885
218 Ga0105242_10171280
219 Ga0157370_10410764
220 Ga0157369_10558122
221 Ga0157372_10037651
222 Ga0157372_10087159
223 Ga0157372_10196558
224 Ga0157379_10019718
225 Ga0157379_11447739
226 Ga0213872_10114844
227 Ga0213875_10386079
228 Ga0207705_10239331
229 Ga0207684_10000252
230 Ga0207707_10147418
231 Ga0207695_10002926
232 Ga0207695_10560211
233 Ga0207693_10001210
234 Ga0207663_10152521
235 Ga0207649_10000194
236 Ga0207646_10039882
237 Ga0207681_10145011
238 Ga0207659_10016365
239 Ga0207686_10093945
240 Ga0207670_10225418
241 Ga0207691_10072754
242 Ga0207667_10119201
243 Ga0207640_10099522
244 Ga0207702_10116229
245 Ga0207702_10360872
246 Ga0207702_10709516
247 Ga0207698_10054652
248 Ga0265318_10000037
249 Ga0265338_10014341
250 Ga0307511_10056243
251 Ga0265325_10108077
252 Ga0265340_10023130
253 Ga0265331_10000186
254 Ga0265331_10003502
255 Ga0265327_10000392
256 Ga0265316_10549732
257 Ga0307408_100539189
258 Ga0307508_10020177
259 Ga0265314_10025792
260 Ga0265342_10354733
261 Ga0307407_10273589
262 Ga0307414_10100066
263 Ga0307414_10422735
264 Ga0373959_0054911
265 Ga0373934_0083946
266 Ga0373957_0122157
267 Ga0373943_0007235
268 Ga0316574_0009048
269 Ga0373931_0049293
270 Ga0373935_0030799
271 Ga0373935_0060054
272 Ga0373927_0258943
273 Ga0373927_1098947
274 Ga0373933_0116723
275 Ga0373933_0506422
276 Ga0373947_0687606
277 Ga0373937_0003527
278 Ga0373937_0378207
279 Ga0373937_0455167
280 Ga0316584_0085683
281 Ga0373925_0002514
282 Ga0373925_0043443
283 Ga0395900_0161372
284 Ga0436364_0066405
285 Ga0436364_1420880
286 Ga0436361_0216520
287 Ga0436361_0554328
288 Ga0436361_0903481
289 Ga0436362_0198091
290 Ga0436362_0517285
291 Ga0451795_0044846
292 Ga0451795_1266664
293 Ga0451795_1574351
294 Ga0451807_2153725
295 Ga0451837_1126821
296 Ga0451855_0204420
297 Ga0451855_1836452
298 Ga0451853_1137708
299 Ga0451577_0704416
300 Ga0453684_0000375
301 Ga0453684_0065347
302 Ga0495664_0182464
303 Ga0495585_0101012
304 Ga0495652_0296264
305 Ga0495665_0148070
306 Ga0495586_0050175
307 Ga0495669_0011577
308 Ga0495613_0000576
309 Ga0495674_0163341
310 Ga0496100_0433306
311 Ga0496106_0265102
312 Ga0496107_0147454
313 Ga0501031_0894762
314 Ga0501032_0075622
315 Ga0501033_0012240
316 Ga0501033_0097267
317 Ga0501033_0225962
318 Ga0501033_0314891
319 Ga0501033_0440815
320 Ga0501034_0027593
321 Ga0501034_0134126
322 Ga0501034_0606454
323 Ga0501036_0066873
324 Ga0501037_0032419
325 Ga0501038_0076553
326 Ga0501038_0414560
327 Ga0501040_0563256
328 Ga0501043_0014584
329 Ga0501043_0062324
330 Ga0501043_0846860
331 Ga0501046_0011762
332 Ga0501047_0030074
333 Ga0501047_0037637
334 Ga0501047_0164561
335 Ga0501068_0099795
336 Ga0501070_0029666
337 Ga0501070_0224938
338 Ga0501073_0077718
339 Ga0501077_0417977
340 Ga0501079_0714628
341 Ga0501080_0040487
342 Ga0501080_0074708
343 Ga0501080_0720663
344 Ga0501080_0782798
345 Ga0501083_0001752
346 Ga0501263_005422
347 Ga0501035_0050843
348 Ga0501035_0087599
349 Ga0501035_0095660
350 Ga0501035_0413573
351 Ga0501035_0519668
352 Ga0501044_0013081
353 Ga0501044_0065191
354 Ga0501044_0345520
355 Ga0501044_1059037
356 Ga0501044_1443239
357 nmdc:mga07m45_148823_c1
358 nmdc:mga05p37_1145889_c1
359 nmdc:mga08y16_112266_c1
360 Ga0500562_000976
361 Ga0500595_021169
362 Ga0500608_000084
363 Ga0500559_0099813
364 Ga0501084_0000175

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00406

ADK

Adenylate kinase

16

201

0.98

PF05191

ADK_lid

Adenylate kinase, active site lid

138

173

0.98

PF13207

AAA_17

AAA domain

17

147

0.89

PF13671

AAA_33

AAA domain

13

148

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c9y-assembly1.cif.gz_A structure of human adenylate kinase 2 0.9263 1 213
2c9y-assembly1.cif.gz_A structure of human adenylate kinase 2 0.9181 1 213
2ak2-assembly1.cif.gz_A adenylate kinase isoenzyme-2 0.9114 1 213
2ak2-assembly1.cif.gz_A adenylate kinase isoenzyme-2 0.9034 1 213
1dvr-assembly1.cif.gz_B structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp 0.8924 1 212
ID Description Score Start End Superfamily
1ak2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.909 1 213 3.40.50.300
1ak2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.901 1 213 3.40.50.300
af_A0A1D6H6N6_28_186_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8783 2 151 3.40.50.300
af_Q32M07_57_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.873 2 214 3.40.50.300
3umfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8683 3 213 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3B8PCG3-F1-model_v4 deleted 0.9808 103 214
AF-A0A1H7DW34-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9801 58 212 GO:0004017
GO:0005524
GO:0005737
AF-A0A521KWS3-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9774 91 214 GO:0004017
GO:0005524
GO:0005737
AF-A0A4Q3CP80-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9764 66 214 GO:0004017
GO:0005524
GO:0005737
AF-A0A4U0YQY9-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9749 103 211 GO:0004017
GO:0005524
GO:0005737

Map