F278173

General Info

Members Datasets Scaffolds Average Seq Length
181 141 362 158

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_385451_c1|nmdc:mga0a205_385451_c1_150_707
Length 185
Sequence LPDCPKGDNSKRDNSGRNKQQSLKGEVMQKITPFLWFDDKAEEAANFYASIFKNSKVSRVVRYGEAGPGQPGTVMVAEFELEGQAFVGLNAGPRFKFTEAISFVVNCETQDEVDYFWERLSSDGGEESMCGWLKDKYGLSWQVVPTVLTEMMLDKDPEKARRVTEAMLQMQKLDIAKLKQAFENQ

Samples

Sample ID Description Type Environment
1 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
111 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
124 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
125 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
130 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
137 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 2751185800 Brucella pituitosa AA2 Isolate Unclassified
140 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
141 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 0
Isolates 1.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 2.21
Rhizosphere 90.61
Stem 0
Stem Tuber 0
Unclassified 7.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0a205_385451_c1 3300050515 Bacteria 1266
2 rootH1_10309902 3300003323 Unclassified 1224
3 Ga0065707_10248188 3300005295 Bacteria 1117
4 Ga0070670_100088456 3300005331 Bacteria 2663
5 Ga0070680_100005950 3300005336 Bacteria 9255
6 Ga0070680_100006777 3300005336 Bacteria 8728
7 Ga0068868_100006373 3300005338 Bacteria 8346
8 Ga0070689_100726895 3300005340 Bacteria 869
9 Ga0070691_10148190 3300005341 Bacteria 1201
10 Ga0070692_10340836 3300005345 Bacteria 928
11 Ga0070688_101180672 3300005365 Bacteria 614
12 Ga0070713_100019244 3300005436 Bacteria 5207
13 Ga0070711_100208578 3300005439 Bacteria 1512
14 Ga0070705_100172348 3300005440 Bacteria 1457
15 Ga0070694_100002079 3300005444 Bacteria 11889
16 Ga0070694_100106376 3300005444 Bacteria 1992
17 Ga0070708_100383310 3300005445 Bacteria 1326
18 Ga0070708_100493451 3300005445 Bacteria 1155
19 Ga0070707_100085444 3300005468 Unclassified 3050
20 Ga0070698_100006985 3300005471 Bacteria 12223
21 Ga0070698_100195205 3300005471 Bacteria 1961
22 Ga0070698_101051957 3300005471 Bacteria 762
23 Ga0070699_100112680 3300005518 Bacteria 2389
24 Ga0070697_100133436 3300005536 Unclassified 2084
25 Ga0070695_100071665 3300005545 Bacteria 2270
26 Ga0070695_100511867 3300005545 Bacteria 930
27 Ga0070696_100005235 3300005546 Bacteria 8669
28 Ga0070696_100050431 3300005546 Bacteria 2893
29 Ga0070704_100001656 3300005549 Bacteria 12071
30 Ga0070704_100004373 3300005549 Bacteria 8161
31 Ga0068852_101883454 3300005616 Bacteria 620
32 Ga0068859_101865565 3300005617 Bacteria 664
33 Ga0068861_100026108 3300005719 Bacteria 4244
34 Ga0068863_100018648 3300005841 Bacteria 6638
35 Ga0068863_101465012 3300005841 Bacteria 691
36 Ga0068858_101226545 3300005842 Unclassified 737
37 Ga0068860_100007714 3300005843 Bacteria 10762
38 Ga0070715_10460216 3300006163 Bacteria 720
39 Ga0070716_100000434 3300006173 Bacteria 17316
40 Ga0070712_100568053 3300006175 Bacteria 957
41 Ga0075428_100084273 3300006844 Bacteria 3469
42 Ga0075431_100522427 3300006847 Bacteria 1176
43 Ga0075431_101472064 3300006847 Unclassified 640
44 Ga0075433_10364947 3300006852 Bacteria 1275
45 Ga0075433_10464933 3300006852 Unclassified 1115
46 Ga0075433_10613119 3300006852 Bacteria 955
47 Ga0075434_100016876 3300006871 Bacteria 7023
48 Ga0075434_100139145 3300006871 Bacteria 2447
49 Ga0075434_100480442 3300006871 Unclassified 1264
50 Ga0075429_100360128 3300006880 Bacteria 1274
51 Ga0075429_100903604 3300006880 Bacteria 773
52 Ga0097620_101865585 3300006931 Bacteria 664
53 Ga0075435_100870055 3300007076 Unclassified 785
54 Ga0114129_10038543 3300009147 Bacteria 6740
55 Ga0114129_10041613 3300009147 Bacteria 6473
56 Ga0114129_11159691 3300009147 Bacteria 964
57 Ga0114129_11324402 3300009147 Bacteria 892
58 Ga0105242_10280096 3300009176 Bacteria 1514
59 Ga0105246_10186255 3300011119 Bacteria 1603
60 Ga0157378_10045174 3300013297 Bacteria 3914
61 Ga0157378_10180570 3300013297 Bacteria 1985
62 Ga0163162_10024965 3300013306 Bacteria 5904
63 Ga0163162_11697198 3300013306 Bacteria 721
64 Ga0157375_11421366 3300013308 Bacteria 817
65 Ga0163163_10871430 3300014325 Bacteria 964
66 Ga0157380_11325830 3300014326 Bacteria 768
67 Ga0157379_10242736 3300014968 Bacteria 1634
68 Ga0157376_10051302 3300014969 Bacteria 3426
69 Ga0157376_10338225 3300014969 Bacteria 1437
70 Ga0157376_10502594 3300014969 Unclassified 1192
71 Ga0182005_1121176 3300015265 Bacteria 745
72 Ga0163161_10015137 3300017792 Bacteria 5376
73 Ga0163161_10065456 3300017792 Bacteria 2652
74 Ga0207685_10159935 3300025905 Bacteria 1027
75 Ga0207684_10397674 3300025910 Unclassified 1185
76 Ga0207693_10066745 3300025915 Unclassified 2816
77 Ga0207660_10043844 3300025917 Bacteria 3145
78 Ga0207660_10327830 3300025917 Bacteria 1224
79 Ga0207646_10246232 3300025922 Bacteria 1615
80 Ga0207650_10494076 3300025925 Bacteria 1022
81 Ga0207700_10011076 3300025928 Bacteria 5734
82 Ga0207686_10038434 3300025934 Bacteria 2896
83 Ga0207670_10180319 3300025936 Bacteria 1590
84 Ga0207665_10002502 3300025939 Bacteria 12368
85 Ga0207689_10089584 3300025942 Bacteria 2527
86 Ga0207677_10006772 3300026023 Bacteria 6295
87 Ga0207708_10191456 3300026075 Bacteria 1628
88 Ga0207708_11268556 3300026075 Bacteria 645
89 Ga0207641_10092091 3300026088 Bacteria 2654
90 Ga0207674_11114956 3300026116 Bacteria 758
91 Ga0207675_101227726 3300026118 Bacteria 770
92 Ga0207683_10096555 3300026121 Bacteria 2635
93 Ga0207698_11752660 3300026142 Bacteria 636
94 Ga0268264_10247457 3300028381 Bacteria 1654
95 Ga0268264_10485721 3300028381 Bacteria 1202
96 Ga0307405_10084751 3300031731 Bacteria 2081
97 Ga0307413_10011933 3300031824 Bacteria 4299
98 Ga0307410_10007374 3300031852 Bacteria 6018
99 Ga0307406_10574840 3300031901 Bacteria 925
100 Ga0307407_10114413 3300031903 Bacteria 1699
101 Ga0307412_10102340 3300031911 Bacteria 2028
102 Ga0307409_100008401 3300031995 Bacteria 6264
103 Ga0307409_102011603 3300031995 Bacteria 607
104 Ga0307416_100028053 3300032002 Bacteria 4181
105 Ga0307414_10090601 3300032004 Bacteria 2270
106 Ga0307411_10017172 3300032005 Bacteria 4114
107 Ga0307415_100015586 3300032126 Bacteria 4506
108 Ga0373934_0065108 3300035086 Bacteria 1455
109 Ga0373954_0000006 3300035118 Bacteria 98573
110 Ga0373924_0012927 3300035410 Bacteria 3128
111 Ga0373931_0074487 3300035691 Bacteria 1860
112 Ga0373935_0048938 3300035692 Bacteria 2678
113 Ga0373927_0000771 3300035695 Bacteria 24536
114 Ga0373927_0756586 3300035695 Bacteria 642
115 Ga0373933_0025289 3300035724 Bacteria 3404
116 Ga0373933_0281375 3300035724 Bacteria 1075
117 Ga0373937_0000595 3300036401 Bacteria 32029
118 Ga0373925_0002827 3300037068 Bacteria 13695
119 Ga0453684_0015985 3300044712 Bacteria 11794
120 Ga0453684_0037506 3300044712 Bacteria 6651
121 Ga0466970_0032881 3300044765 Bacteria 2741
122 Ga0466960_0019661 3300044901 Bacteria 2979
123 Ga0451576_0059035 3300045051 Bacteria 4006
124 Ga0466958_0131041 3300045836 Unclassified 1575
125 Ga0495639_0027319 3300046475 Bacteria 2526
126 Ga0495664_0270917 3300046477 Bacteria 1026
127 Ga0495606_0204610 3300046507 Bacteria 1123
128 Ga0495608_0215942 3300046511 Bacteria 1205
129 Ga0495616_0095850 3300046513 Bacteria 1398
130 Ga0495643_0005192 3300046522 Bacteria 8883
131 Ga0495665_0074705 3300046531 Bacteria 1785
132 Ga0495586_0100226 3300046535 Bacteria 1607
133 Ga0495625_0039949 3300046660 Bacteria 3425
134 Ga0495659_0007068 3300046664 Bacteria 3552
135 Ga0495657_0111930 3300046675 Bacteria 1729
136 Ga0495581_0007562 3300047315 Bacteria 6285
137 Ga0496104_0362912 3300048907 Bacteria 1361
138 Ga0496114_0078094 3300048917 Bacteria 2793
139 Ga0496115_0053131 3300048918 Bacteria 3251
140 Ga0496115_0112911 3300048918 Bacteria 2232
141 Ga0496119_0065465 3300048922 Bacteria 2152
142 Ga0496120_0403855 3300048923 Bacteria 603
143 Ga0496122_0116294 3300048925 Bacteria 1739
144 Ga0496123_0215808 3300048926 Bacteria 971
145 Ga0496125_0000031 3300048928 Bacteria 365156
146 Ga0496125_0113258 3300048928 Bacteria 1957
147 Ga0496125_0484027 3300048928 Bacteria 700
148 Ga0496125_0545331 3300048928 Bacteria 643
149 Ga0496126_0029379 3300048929 Bacteria 5223
150 Ga0501070_0023935 3300049586 Bacteria 5118
151 Ga0501071_0016840 3300049587 Bacteria 5029
152 Ga0501072_1187765 3300049588 Bacteria 593
153 Ga0501073_0002770 3300049589 Bacteria 13128
154 Ga0501074_0163762 3300049590 Bacteria 1588
155 Ga0501076_1174937 3300049592 Bacteria 632
156 Ga0501077_0650297 3300049593 Bacteria 677
157 Ga0501243_019707 3300049675 Bacteria 1106
158 Ga0501219_000157 3300049703 Bacteria 12382
159 Ga0501225_0056285 3300049705 Bacteria 1101
160 Ga0501079_0077061 3300049741 Bacteria 2579
161 Ga0501080_0167616 3300049742 Bacteria 2026
162 Ga0501083_0001980 3300049744 Bacteria 14085
163 Ga0501083_1024890 3300049744 Unclassified 537
164 Ga0501241_001131 3300049758 Bacteria 5580
165 Ga0501284_00054 3300050005 Bacteria 42687
166 nmdc:mga05p37_1306256_c1 3300050507 Bacteria 739
167 nmdc:mga05p37_28804_c2 3300050507 Bacteria 6473
168 nmdc:mga09592_187420_c1 3300050508 Bacteria 1790
169 nmdc:mga06r32_482025_c1 3300050510 Bacteria 1218
170 nmdc:mga0n895_24034_c1 3300050512 Bacteria 5737
171 nmdc:mga0n895_809880_c1 3300050512 Bacteria 927
172 nmdc:mga0rr50_1042165_c1 3300050513 Bacteria 696
173 nmdc:mga0rr50_293402_c1 3300050513 Bacteria 1359
174 nmdc:mga0a205_181711_c2 3300050515 Bacteria 951
175 nmdc:mga0a205_436828_c1 3300050515 Unclassified 1170
176 Ga0500641_0037885 3300053096 Bacteria 1935
177 Ga0500622_0035034 3300053156 Bacteria 2628
178 Ga0501084_0003600 3300054114 Bacteria 12584
179 2753359049 2751185800 Bacteria 5467370
180 2758641288 2758568016 Bacteria 5645291
181 2883068645 2883068021 Bacteria 6192739
182 nmdc:mga0a205_385451_c1
183 rootH1_10309902
184 Ga0065707_10248188
185 Ga0070670_100088456
186 Ga0070680_100005950
187 Ga0070680_100006777
188 Ga0068868_100006373
189 Ga0070689_100726895
190 Ga0070691_10148190
191 Ga0070692_10340836
192 Ga0070688_101180672
193 Ga0070713_100019244
194 Ga0070711_100208578
195 Ga0070705_100172348
196 Ga0070694_100002079
197 Ga0070694_100106376
198 Ga0070708_100383310
199 Ga0070708_100493451
200 Ga0070707_100085444
201 Ga0070698_100006985
202 Ga0070698_100195205
203 Ga0070698_101051957
204 Ga0070699_100112680
205 Ga0070697_100133436
206 Ga0070695_100071665
207 Ga0070695_100511867
208 Ga0070696_100005235
209 Ga0070696_100050431
210 Ga0070704_100001656
211 Ga0070704_100004373
212 Ga0068852_101883454
213 Ga0068859_101865565
214 Ga0068861_100026108
215 Ga0068863_100018648
216 Ga0068863_101465012
217 Ga0068858_101226545
218 Ga0068860_100007714
219 Ga0070715_10460216
220 Ga0070716_100000434
221 Ga0070712_100568053
222 Ga0075428_100084273
223 Ga0075431_100522427
224 Ga0075431_101472064
225 Ga0075433_10364947
226 Ga0075433_10464933
227 Ga0075433_10613119
228 Ga0075434_100016876
229 Ga0075434_100139145
230 Ga0075434_100480442
231 Ga0075429_100360128
232 Ga0075429_100903604
233 Ga0097620_101865585
234 Ga0075435_100870055
235 Ga0114129_10038543
236 Ga0114129_10041613
237 Ga0114129_11159691
238 Ga0114129_11324402
239 Ga0105242_10280096
240 Ga0105246_10186255
241 Ga0157378_10045174
242 Ga0157378_10180570
243 Ga0163162_10024965
244 Ga0163162_11697198
245 Ga0157375_11421366
246 Ga0163163_10871430
247 Ga0157380_11325830
248 Ga0157379_10242736
249 Ga0157376_10051302
250 Ga0157376_10338225
251 Ga0157376_10502594
252 Ga0182005_1121176
253 Ga0163161_10015137
254 Ga0163161_10065456
255 Ga0207685_10159935
256 Ga0207684_10397674
257 Ga0207693_10066745
258 Ga0207660_10043844
259 Ga0207660_10327830
260 Ga0207646_10246232
261 Ga0207650_10494076
262 Ga0207700_10011076
263 Ga0207686_10038434
264 Ga0207670_10180319
265 Ga0207665_10002502
266 Ga0207689_10089584
267 Ga0207677_10006772
268 Ga0207708_10191456
269 Ga0207708_11268556
270 Ga0207641_10092091
271 Ga0207674_11114956
272 Ga0207675_101227726
273 Ga0207683_10096555
274 Ga0207698_11752660
275 Ga0268264_10247457
276 Ga0268264_10485721
277 Ga0307405_10084751
278 Ga0307413_10011933
279 Ga0307410_10007374
280 Ga0307406_10574840
281 Ga0307407_10114413
282 Ga0307412_10102340
283 Ga0307409_100008401
284 Ga0307409_102011603
285 Ga0307416_100028053
286 Ga0307414_10090601
287 Ga0307411_10017172
288 Ga0307415_100015586
289 Ga0373934_0065108
290 Ga0373954_0000006
291 Ga0373924_0012927
292 Ga0373931_0074487
293 Ga0373935_0048938
294 Ga0373927_0000771
295 Ga0373927_0756586
296 Ga0373933_0025289
297 Ga0373933_0281375
298 Ga0373937_0000595
299 Ga0373925_0002827
300 Ga0453684_0015985
301 Ga0453684_0037506
302 Ga0466970_0032881
303 Ga0466960_0019661
304 Ga0451576_0059035
305 Ga0466958_0131041
306 Ga0495639_0027319
307 Ga0495664_0270917
308 Ga0495606_0204610
309 Ga0495608_0215942
310 Ga0495616_0095850
311 Ga0495643_0005192
312 Ga0495665_0074705
313 Ga0495586_0100226
314 Ga0495625_0039949
315 Ga0495659_0007068
316 Ga0495657_0111930
317 Ga0495581_0007562
318 Ga0496104_0362912
319 Ga0496114_0078094
320 Ga0496115_0053131
321 Ga0496115_0112911
322 Ga0496119_0065465
323 Ga0496120_0403855
324 Ga0496122_0116294
325 Ga0496123_0215808
326 Ga0496125_0000031
327 Ga0496125_0113258
328 Ga0496125_0484027
329 Ga0496125_0545331
330 Ga0496126_0029379
331 Ga0501070_0023935
332 Ga0501071_0016840
333 Ga0501072_1187765
334 Ga0501073_0002770
335 Ga0501074_0163762
336 Ga0501076_1174937
337 Ga0501077_0650297
338 Ga0501243_019707
339 Ga0501219_000157
340 Ga0501225_0056285
341 Ga0501079_0077061
342 Ga0501080_0167616
343 Ga0501083_0001980
344 Ga0501083_1024890
345 Ga0501241_001131
346 Ga0501284_00054
347 nmdc:mga05p37_1306256_c1
348 nmdc:mga05p37_28804_c2
349 nmdc:mga09592_187420_c1
350 nmdc:mga06r32_482025_c1
351 nmdc:mga0n895_24034_c1
352 nmdc:mga0n895_809880_c1
353 nmdc:mga0rr50_1042165_c1
354 nmdc:mga0rr50_293402_c1
355 nmdc:mga0a205_181711_c2
356 nmdc:mga0a205_436828_c1
357 Ga0500641_0037885
358 Ga0500622_0035034
359 Ga0501084_0003600
360 2753359049
361 2758641288
362 2883068645

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

29

144

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9419 2 152
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9349 2 152
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9337 2 152
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9296 2 152
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9227 2 152
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9388 2 152 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9262 2 152 3.10.180.10
af_E7FBQ4_1_245_3.30.460.90 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.8118 28 60 3.30.460.90
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7819 10 111 3.10.180.10
af_A0A1D6L8D5_102_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.7674 28 57 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A1H7K5H5-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9943 84 152 GO:0008168
GO:0032259
AF-A0A258CU84-F1-model_v4 PhnB-like domain-containing protein 0.9921 46 154
AF-D6KGM1-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9913 61 155 GO:0008168
GO:0032259
AF-A0A2V7U7S1-F1-model_v4 PhnB-like domain-containing protein 0.9897 84 152
AF-A0A6I3HZ90-F1-model_v4 deleted 0.9879 66 152

Map