F278038

General Info

Members Datasets Scaffolds Average Seq Length
181 152 362 185

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0657626|Ga0496108_0657626_21_644
Length 207
Sequence MVRLTRIYTRTGDAGQTRLSDMSVADKHDVRVEAYGDVDEANSVLGIALASPGLPDNVAAVLKAIQNELFDLGADLSNPLRPVPEGRRAPLRITQAEIDRLEGWCDRFGDPLPDLTSFILPGGVPAAAHLHLARTVVRRAERAAWTAVQTYGTEEAADEDSPGGVNILAITYLNRLSDLLFILTRAVNGPDGDVLWVPGGQRLPASS

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
39 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
58 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
59 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
68 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
72 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
76 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
77 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
89 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
90 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
91 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
94 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
95 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
96 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
97 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
98 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
101 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
102 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
110 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
133 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
134 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
135 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
136 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
137 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
138 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
139 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
141 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
142 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
146 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
147 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
148 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
149 2818991467 Bosea vestrisii 3192 Isolate Unclassified
150 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
151 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
152 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.48
Metatranscriptomes 1.1
Isolates 4.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.84
Nodule 0.55
Rhizoplane 3.87
Rhizosphere 76.8
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0657626 3300048911 Bacteria 911
2 JGI24739J22299_10056605 3300001989 Bacteria 1250
3 rootH2_10119041 3300003320 Bacteria 4916
4 rootL2_10065139 3300003322 Bacteria 2350
5 Ga0055526_1000017 3300003771 Bacteria 210613
6 Ga0055524_1007164 3300003775 Bacteria 4773
7 Ga0070659_100090231 3300005366 Bacteria 2456
8 Ga0070714_100254103 3300005435 Bacteria 1626
9 Ga0070713_100320159 3300005436 Bacteria 1432
10 Ga0070711_100577127 3300005439 Bacteria 936
11 Ga0070711_100858246 3300005439 Bacteria 773
12 Ga0070662_100123941 3300005457 Bacteria 1983
13 Ga0070662_100181580 3300005457 Bacteria 1659
14 Ga0070681_10037851 3300005458 Bacteria 4838
15 Ga0068853_100496775 3300005539 Bacteria 1151
16 Ga0068855_100623962 3300005563 Bacteria 1160
17 Ga0068854_100146090 3300005578 Bacteria 1819
18 Ga0068854_100372577 3300005578 Bacteria 1174
19 Ga0068856_100584115 3300005614 Bacteria 1138
20 Ga0068852_100541516 3300005616 Bacteria 1163
21 Ga0081455_10046343 3300005937 Bacteria 3773
22 Ga0070712_100869677 3300006175 Bacteria 776
23 Ga0075430_100022633 3300006846 Bacteria 5347
24 Ga0075430_100331933 3300006846 Bacteria 1256
25 Ga0075431_100001586 3300006847 Bacteria 21155
26 Ga0075431_100146344 3300006847 Bacteria 2435
27 Ga0075434_100094193 3300006871 Bacteria 2999
28 Ga0079104_1006992 3300006946 Bacteria 4163
29 Ga0075435_100210647 3300007076 Bacteria 1649
30 Ga0099795_10066161 3300007788 Bacteria 1353
31 Ga0105240_10070266 3300009093 Bacteria 4332
32 Ga0105240_10140396 3300009093 Bacteria 2889
33 Ga0114129_10215107 3300009147 Bacteria 2596
34 Ga0105248_10427044 3300009177 Bacteria 1492
35 Ga0105237_10306541 3300009545 Bacteria 1591
36 Ga0105238_10010386 3300009551 Bacteria 9343
37 Ga0105239_10185859 3300010375 Bacteria 2325
38 Ga0105239_10324101 3300010375 Bacteria 1737
39 Ga0157373_10002228 3300013100 Bacteria 14673
40 Ga0157371_10100398 3300013102 Bacteria 2053
41 Ga0157370_10119712 3300013104 Bacteria 2458
42 Ga0157372_10031001 3300013307 Bacteria 5853
43 Ga0157372_10044766 3300013307 Bacteria 4905
44 Ga0206354_11213605 3300020081 Bacteria 1255
45 Ga0206353_10498485 3300020082 Bacteria 7917
46 Ga0213874_10010259 3300021377 Bacteria 2341
47 Ga0213874_10039322 3300021377 Bacteria 1408
48 Ga0209025_1045569 3300025294 Bacteria 1816
49 Ga0209564_1000031 3300025295 Bacteria 494703
50 Ga0209256_1000181 3300025299 Bacteria 123624
51 Ga0207688_10009345 3300025901 Bacteria 5344
52 Ga0207647_10001697 3300025904 Bacteria 16980
53 Ga0207695_10087516 3300025913 Bacteria 3138
54 Ga0207695_10452852 3300025913 Bacteria 1166
55 Ga0207693_10716236 3300025915 Bacteria 774
56 Ga0207663_10310282 3300025916 Bacteria 1182
57 Ga0207694_10028614 3300025924 Bacteria 4248
58 Ga0207690_10066124 3300025932 Bacteria 2475
59 Ga0207706_10173302 3300025933 Bacteria 1895
60 Ga0207665_10677056 3300025939 Bacteria 810
61 Ga0207711_10807932 3300025941 Bacteria 873
62 Ga0207661_10110192 3300025944 Bacteria 2327
63 Ga0207667_10030784 3300025949 Bacteria 5800
64 Ga0207640_10011118 3300025981 Bacteria 5087
65 Ga0207640_10177574 3300025981 Bacteria 1593
66 Ga0207639_10179564 3300026041 Bacteria 1799
67 Ga0207698_10251252 3300026142 Bacteria 1618
68 Ga0209371_1004385 3300027312 Bacteria 6186
69 Ga0268256_1004023 3300030500 Bacteria 6319
70 Ga0265330_10036272 3300031235 Bacteria 2198
71 Ga0265330_10064984 3300031235 Bacteria 1584
72 Ga0265316_10220396 3300031344 Bacteria 1400
73 Ga0307408_100768635 3300031548 Bacteria 872
74 Ga0307508_10268033 3300031616 Bacteria 1302
75 Ga0307406_10055484 3300031901 Bacteria 2533
76 Ga0307407_10186877 3300031903 Bacteria 1378
77 Ga0307409_101026345 3300031995 Bacteria 844
78 Ga0307414_10327202 3300032004 Bacteria 1307
79 Ga0373943_0034721 3300035170 Bacteria 2407
80 Ga0373946_0323988 3300035171 Bacteria 766
81 Ga0395899_0017806 3300037312 Bacteria 5409
82 Ga0395905_0000022 3300037471 Bacteria 321527
83 Ga0395905_0000872 3300037471 Bacteria 39336
84 Ga0395905_1125253 3300037471 Bacteria 688
85 Ga0400490_43208 3300038726 Bacteria 40847
86 Ga0400489_40036 3300039093 Unclassified 1019
87 Ga0436365_1350274 3300039437 Bacteria 2027
88 Ga0436365_1596063 3300039437 Bacteria 10598
89 Ga0436361_0568157 3300039447 Bacteria 2474
90 Ga0436363_1070704 3300039450 Bacteria 7327
91 Ga0436363_1549275 3300039450 Bacteria 16635
92 Ga0466969_0231866 3300044656 Bacteria 838
93 Ga0453683_0210828 3300044673 Bacteria 1234
94 Ga0466966_0047064 3300044684 Bacteria 2752
95 Ga0466966_0047269 3300044684 Bacteria 2745
96 Ga0453684_0010763 3300044712 Bacteria 15533
97 Ga0466971_0121227 3300044719 Bacteria 1210
98 Ga0466968_0043066 3300044735 Bacteria 1910
99 Ga0466970_0028399 3300044765 Bacteria 2939
100 Ga0466970_0418642 3300044765 Bacteria 766
101 Ga0466957_0023081 3300044842 Bacteria 3674
102 Ga0466959_0053803 3300045049 Bacteria 2942
103 Ga0466959_0055334 3300045049 Bacteria 2897
104 Ga0466959_0171883 3300045049 Bacteria 1520
105 Ga0451576_0003460 3300045051 Bacteria 21649
106 Ga0466958_0001560 3300045836 Bacteria 10986
107 Ga0495638_0000397 3300046460 Bacteria 53684
108 Ga0495580_0370631 3300046472 Bacteria 968
109 Ga0495605_0004542 3300046474 Bacteria 8129
110 Ga0495585_0011064 3300046492 Bacteria 5357
111 Ga0495607_0174097 3300046501 Bacteria 1084
112 Ga0495606_0076968 3300046507 Bacteria 2084
113 Ga0495620_0052198 3300046515 Bacteria 1737
114 Ga0495631_0007664 3300046518 Bacteria 5483
115 Ga0495632_0031746 3300046519 Bacteria 2727
116 Ga0495643_0109114 3300046522 Bacteria 1409
117 Ga0495654_0072789 3300046530 Bacteria 1626
118 Ga0495597_0047238 3300046542 Bacteria 1906
119 Ga0495625_0002547 3300046660 Bacteria 19601
120 Ga0495670_0022828 3300046691 Bacteria 3090
121 Ga0495660_0047838 3300046810 Bacteria 2340
122 Ga0495636_0046505 3300047318 Bacteria 1810
123 Ga0495672_0009559 3300047320 Bacteria 7009
124 Ga0495672_0009846 3300047320 Bacteria 6876
125 Ga0495683_0114303 3300047323 Bacteria 1286
126 Ga0496100_0397401 3300048903 Bacteria 1049
127 Ga0496101_0143297 3300048904 Bacteria 1823
128 Ga0496108_0285652 3300048911 Bacteria 1436
129 Ga0496109_0270551 3300048912 Bacteria 1601
130 Ga0496114_0066750 3300048917 Bacteria 3017
131 Ga0496122_0054654 3300048925 Bacteria 2996
132 Ga0495682_0029088 3300049460 Bacteria 2046
133 Ga0501034_0581884 3300049571 Bacteria 1026
134 Ga0501038_0754598 3300049574 Bacteria 726
135 Ga0501039_0194713 3300049575 Bacteria 1594
136 Ga0501042_0317959 3300049578 Bacteria 1125
137 Ga0501047_0580849 3300049581 Bacteria 943
138 Ga0501067_0169482 3300049583 Bacteria 1216
139 Ga0501070_0641964 3300049586 Bacteria 843
140 Ga0501074_0651662 3300049590 Bacteria 744
141 Ga0501075_0010682 3300049591 Bacteria 6461
142 Ga0501075_0494767 3300049591 Bacteria 933
143 Ga0501076_0133073 3300049592 Bacteria 2017
144 Ga0501076_0592616 3300049592 Bacteria 914
145 Ga0501077_0003508 3300049593 Bacteria 9414
146 Ga0501077_0176610 3300049593 Bacteria 1357
147 Ga0501081_0000197 3300049743 Bacteria 29348
148 Ga0501081_0194376 3300049743 Bacteria 1470
149 Ga0501081_0238852 3300049743 Bacteria 1325
150 Ga0501083_0066740 3300049744 Bacteria 2395
151 Ga0501035_0596841 3300049822 Bacteria 900
152 Ga0501045_0174590 3300049824 Bacteria 1601
153 nmdc:mga05p37_575068_c1 3300050507 Bacteria 1277
154 nmdc:mga09592_580703_c1 3300050508 Bacteria 961
155 nmdc:mga0qj67_31924_c1 3300050509 Bacteria 4105
156 nmdc:mga06r32_157714_c1 3300050510 Bacteria 2251
157 nmdc:mga06r32_7930_c1 3300050510 Bacteria 9548
158 nmdc:mga0n895_60316_c1 3300050512 Bacteria 3743
159 Ga0495619_0176167 3300053085 Bacteria 1479
160 Ga0500578_0058072 3300053086 Bacteria 2473
161 Ga0500556_0023224 3300053104 Bacteria 2024
162 Ga0500557_004954 3300053105 Bacteria 2861
163 Ga0500569_011185 3300053109 Bacteria 2136
164 Ga0500594_0004472 3300053118 Bacteria 3081
165 Ga0500658_0216792 3300053134 Bacteria 877
166 Ga0500568_0045202 3300053139 Bacteria 1753
167 Ga0500577_0030061 3300053142 Bacteria 1887
168 Ga0500616_0145753 3300053153 Bacteria 1101
169 Ga0500627_0018286 3300053158 Bacteria 2772
170 Ga0500645_026044 3300053730 Bacteria 1781
171 Ga0501084_0111290 3300054114 Bacteria 2301
172 Ga0501084_0375436 3300054114 Bacteria 1202
173 Ga0501082_0034167 3300060353 Bacteria 4386
174 2512035752 2511231221 Bacteria 6846400
175 2599105838 2597490356 Bacteria 7030811
176 2600373382 2600254933 Bacteria 4750527
177 2739792467 2739367756 Bacteria 4553612
178 2819720045 2818991467 Bacteria 5893227
179 2846955620 2846952575 Bacteria 6587527
180 2848862392 2848858292 Bacteria 7391279
181 8054007925 8054002106 Bacteria 7987183
182 Ga0496108_0657626
183 JGI24739J22299_10056605
184 rootH2_10119041
185 rootL2_10065139
186 Ga0055526_1000017
187 Ga0055524_1007164
188 Ga0070659_100090231
189 Ga0070714_100254103
190 Ga0070713_100320159
191 Ga0070711_100577127
192 Ga0070711_100858246
193 Ga0070662_100123941
194 Ga0070662_100181580
195 Ga0070681_10037851
196 Ga0068853_100496775
197 Ga0068855_100623962
198 Ga0068854_100146090
199 Ga0068854_100372577
200 Ga0068856_100584115
201 Ga0068852_100541516
202 Ga0081455_10046343
203 Ga0070712_100869677
204 Ga0075430_100022633
205 Ga0075430_100331933
206 Ga0075431_100001586
207 Ga0075431_100146344
208 Ga0075434_100094193
209 Ga0079104_1006992
210 Ga0075435_100210647
211 Ga0099795_10066161
212 Ga0105240_10070266
213 Ga0105240_10140396
214 Ga0114129_10215107
215 Ga0105248_10427044
216 Ga0105237_10306541
217 Ga0105238_10010386
218 Ga0105239_10185859
219 Ga0105239_10324101
220 Ga0157373_10002228
221 Ga0157371_10100398
222 Ga0157370_10119712
223 Ga0157372_10031001
224 Ga0157372_10044766
225 Ga0206354_11213605
226 Ga0206353_10498485
227 Ga0213874_10010259
228 Ga0213874_10039322
229 Ga0209025_1045569
230 Ga0209564_1000031
231 Ga0209256_1000181
232 Ga0207688_10009345
233 Ga0207647_10001697
234 Ga0207695_10087516
235 Ga0207695_10452852
236 Ga0207693_10716236
237 Ga0207663_10310282
238 Ga0207694_10028614
239 Ga0207690_10066124
240 Ga0207706_10173302
241 Ga0207665_10677056
242 Ga0207711_10807932
243 Ga0207661_10110192
244 Ga0207667_10030784
245 Ga0207640_10011118
246 Ga0207640_10177574
247 Ga0207639_10179564
248 Ga0207698_10251252
249 Ga0209371_1004385
250 Ga0268256_1004023
251 Ga0265330_10036272
252 Ga0265330_10064984
253 Ga0265316_10220396
254 Ga0307408_100768635
255 Ga0307508_10268033
256 Ga0307406_10055484
257 Ga0307407_10186877
258 Ga0307409_101026345
259 Ga0307414_10327202
260 Ga0373943_0034721
261 Ga0373946_0323988
262 Ga0395899_0017806
263 Ga0395905_0000022
264 Ga0395905_0000872
265 Ga0395905_1125253
266 Ga0400490_43208
267 Ga0400489_40036
268 Ga0436365_1350274
269 Ga0436365_1596063
270 Ga0436361_0568157
271 Ga0436363_1070704
272 Ga0436363_1549275
273 Ga0466969_0231866
274 Ga0453683_0210828
275 Ga0466966_0047064
276 Ga0466966_0047269
277 Ga0453684_0010763
278 Ga0466971_0121227
279 Ga0466968_0043066
280 Ga0466970_0028399
281 Ga0466970_0418642
282 Ga0466957_0023081
283 Ga0466959_0053803
284 Ga0466959_0055334
285 Ga0466959_0171883
286 Ga0451576_0003460
287 Ga0466958_0001560
288 Ga0495638_0000397
289 Ga0495580_0370631
290 Ga0495605_0004542
291 Ga0495585_0011064
292 Ga0495607_0174097
293 Ga0495606_0076968
294 Ga0495620_0052198
295 Ga0495631_0007664
296 Ga0495632_0031746
297 Ga0495643_0109114
298 Ga0495654_0072789
299 Ga0495597_0047238
300 Ga0495625_0002547
301 Ga0495670_0022828
302 Ga0495660_0047838
303 Ga0495636_0046505
304 Ga0495672_0009559
305 Ga0495672_0009846
306 Ga0495683_0114303
307 Ga0496100_0397401
308 Ga0496101_0143297
309 Ga0496108_0285652
310 Ga0496109_0270551
311 Ga0496114_0066750
312 Ga0496122_0054654
313 Ga0495682_0029088
314 Ga0501034_0581884
315 Ga0501038_0754598
316 Ga0501039_0194713
317 Ga0501042_0317959
318 Ga0501047_0580849
319 Ga0501067_0169482
320 Ga0501070_0641964
321 Ga0501074_0651662
322 Ga0501075_0010682
323 Ga0501075_0494767
324 Ga0501076_0133073
325 Ga0501076_0592616
326 Ga0501077_0003508
327 Ga0501077_0176610
328 Ga0501081_0000197
329 Ga0501081_0194376
330 Ga0501081_0238852
331 Ga0501083_0066740
332 Ga0501035_0596841
333 Ga0501045_0174590
334 nmdc:mga05p37_575068_c1
335 nmdc:mga09592_580703_c1
336 nmdc:mga0qj67_31924_c1
337 nmdc:mga06r32_157714_c1
338 nmdc:mga06r32_7930_c1
339 nmdc:mga0n895_60316_c1
340 Ga0495619_0176167
341 Ga0500578_0058072
342 Ga0500556_0023224
343 Ga0500557_004954
344 Ga0500569_011185
345 Ga0500594_0004472
346 Ga0500658_0216792
347 Ga0500568_0045202
348 Ga0500577_0030061
349 Ga0500616_0145753
350 Ga0500627_0018286
351 Ga0500645_026044
352 Ga0501084_0111290
353 Ga0501084_0375436
354 Ga0501082_0034167
355 2512035752
356 2599105838
357 2600373382
358 2739792467
359 2819720045
360 2846955620
361 2848862392
362 8054007925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01923

Cob_adeno_trans

Cobalamin adenosyltransferase

7

187

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gei-assembly1.cif.gz_A-2 crystal structure of mnme from chlorobium tepidum in complex with gcp 0.5759 67 159
4jvs-assembly1.cif.gz_A crystal structure of lepb gap domain from legionella drancourtii in complex with rab1-gdp and alf3 0.5246 104 165
8ako-assembly1.cif.gz_B structure of espb-espk complex: the non-identical twin of the pe-ppe-espg secretion mechanism. 0.5141 104 158
1rty-assembly1.cif.gz_C crystal structure of bacillus subtilis yvqk, a putative atp-binding cobalamin adenosyltransferase, the north east structural genomics target sr128 0.4825 30 166
1rty-assembly1.cif.gz_A crystal structure of bacillus subtilis yvqk, a putative atp-binding cobalamin adenosyltransferase, the north east structural genomics target sr128 0.4821 29 167
ID Description Score Start End Superfamily
af_Q21052_1_123_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8062 103 154 1.20.1300.10
3iqfC02 Special;Helix non-globular;Helix Hairpins; 0.7701 101 157 6.10.140.120
af_Q4CM10_1_131_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7291 98 157 1.20.140.150
af_A0A3B1E9Z2_1_144_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7002 103 156 1.20.140.150
af_Q5A330_180_296_1.20.120.900 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Pex19, mPTS binding domain 0.6537 101 157 1.20.120.900
ID Description Score Start End GO Terms
AF-A0A0C1YQJ2-F1-model_v4 deleted 0.9723 95 170
AF-A0A7K0JV37-F1-model_v4 deleted 0.9665 6 77
AF-A0A2N3DWJ5-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9309 1 79 GO:0005524
GO:0008817
GO:0009236
AF-A0A434RVI7-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9259 88 170 GO:0005524
GO:0008817
GO:0009236
AF-A0A7S1NF66-F1-model_v4 Cobalamin adenosyltransferase-like domain-containing protein 0.9222 4 86 GO:0005524
GO:0008817

Map