F277815

General Info

Members Datasets Scaffolds Average Seq Length
181 132 362 214

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0019912|Ga0451577_0019912_4238_4963
Length 241
Sequence MYPGRFFRKTTMSNKRILVLGIGNLLWADEGFGVRCVEALNAGWEFPPQVTLMDGGTQGLYLLPYVQEADCLLVFDAVDYGDAPGTLREVVGDQVPRFMGAKKMSLHQTGFQEVLMAAELTGKLPAELVLIGVQPEELEDYGGSLRDVVKAQMAPALDVAFRWLERWGAAAQPRSGKAEAITDTALAIDVYEGERPPADQAFRLGDARFLNMENTTPTRAAHAAPQGGAPLPWGGPAGGAA

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
3 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
4 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
61 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
62 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
64 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
65 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
66 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
67 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
68 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
69 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
70 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
71 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
79 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
80 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
91 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
92 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
102 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
103 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
106 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
107 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
108 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
109 2519103095 Burkholderia sp. KJ006 Isolate Nodule
110 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
111 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
112 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
113 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
114 2643221660 Methylibium sp. Root1272 Isolate Unclassified
115 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
116 2738541277 Variovorax sp. GV051 Isolate Unclassified
117 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
118 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
119 2738543019 Variovorax sp. GV040 Isolate Unclassified
120 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
121 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
122 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
123 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
124 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
125 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
126 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
127 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
128 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
129 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
130 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
131 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
132 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.74
Metatranscriptomes 0
Isolates 13.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.78
Nodule 3.31
Rhizoplane 2.21
Rhizosphere 64.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0019912 3300042876 Bacteria 6163
2 Ga0055537_1000097 3300003773 Bacteria 65441
3 Ga0055534_1000014 3300003784 Bacteria 150629
4 Ga0055528_1015191 3300003790 Bacteria 2796
5 Ga0055528_1039373 3300003790 Bacteria 1081
6 Ga0055540_1012494 3300003792 Bacteria 2661
7 Ga0055540_1013545 3300003792 Bacteria 2485
8 Ga0065714_10022422 3300005288 Bacteria 1050
9 Ga0070676_10007312 3300005328 Bacteria 5923
10 Ga0068869_100027586 3300005334 Bacteria 3960
11 Ga0070675_100018627 3300005354 Bacteria 5527
12 Ga0070671_100201199 3300005355 Bacteria 1689
13 Ga0070673_100451040 3300005364 Bacteria 1157
14 Ga0070678_100090923 3300005456 Bacteria 2341
15 Ga0070678_100145627 3300005456 Bacteria 1901
16 Ga0068867_100266674 3300005459 Bacteria 1398
17 Ga0070672_100044352 3300005543 Bacteria 3434
18 Ga0068857_100017286 3300005577 Bacteria 6320
19 Ga0068870_10017129 3300005840 Bacteria 3477
20 Ga0075368_10150798 3300006042 Bacteria 971
21 Ga0075363_100416368 3300006048 Bacteria 791
22 Ga0075364_10160425 3300006051 Bacteria 1518
23 Ga0075432_10032380 3300006058 Bacteria 1811
24 Ga0075362_10276650 3300006177 Bacteria 830
25 Ga0075367_10214858 3300006178 Bacteria 1203
26 Ga0075366_10202363 3300006195 Bacteria 1208
27 Ga0075370_10108640 3300006353 Bacteria 1610
28 Ga0075370_10133717 3300006353 Bacteria 1448
29 Ga0068865_100281185 3300006881 Bacteria 1325
30 Ga0099826_10000072 3300006948 Bacteria 53143
31 Ga0105245_10123412 3300009098 Bacteria 2422
32 Ga0105243_10105599 3300009148 Bacteria 2346
33 Ga0105237_10002315 3300009545 Bacteria 23664
34 Ga0105246_10131810 3300011119 Bacteria 1868
35 Ga0157373_10009228 3300013100 Bacteria 7293
36 Ga0157375_10029276 3300013308 Bacteria 5177
37 Ga0182008_10057274 3300014497 Bacteria 1924
38 Ga0157379_10836817 3300014968 Bacteria 870
39 Ga0182006_1030961 3300015261 Bacteria 2159
40 Ga0163161_10012613 3300017792 Bacteria 5872
41 Ga0213872_10002229 3300021361 Bacteria 11597
42 Ga0209565_1000047 3300025263 Bacteria 225745
43 Ga0209673_1000079 3300025273 Bacteria 225746
44 Ga0209673_1016102 3300025273 Bacteria 2810
45 Ga0209675_1000046 3300025291 Bacteria 225746
46 Ga0209676_1022587 3300025292 Bacteria 2080
47 Ga0209676_1049225 3300025292 Bacteria 1120
48 Ga0209025_1071280 3300025294 Bacteria 1232
49 Ga0209564_1050438 3300025295 Bacteria 1019
50 Ga0209050_1059223 3300025298 Bacteria 915
51 Ga0209051_1000049 3300025303 Bacteria 287483
52 Ga0209051_1006343 3300025303 Bacteria 6691
53 Ga0209051_1030835 3300025303 Bacteria 2074
54 Ga0207645_10001993 3300025907 Bacteria 16424
55 Ga0207643_10010561 3300025908 Bacteria 4972
56 Ga0207671_10003143 3300025914 Bacteria 16762
57 Ga0207659_10009144 3300025926 Bacteria 6186
58 Ga0207687_10097225 3300025927 Bacteria 2159
59 Ga0207644_10022422 3300025931 Bacteria 4315
60 Ga0207709_10350689 3300025935 Bacteria 1114
61 Ga0207704_10405398 3300025938 Bacteria 1077
62 Ga0207691_10056739 3300025940 Bacteria 3567
63 Ga0207689_10014999 3300025942 Bacteria 6572
64 Ga0207651_10409919 3300025960 Bacteria 1154
65 Ga0207648_10080126 3300026089 Bacteria 2849
66 Ga0207674_10028376 3300026116 Bacteria 5908
67 Ga0207683_10272653 3300026121 Bacteria 1546
68 Ga0207683_10411264 3300026121 Bacteria 1245
69 Ga0209282_1000111 3300027666 Bacteria 53376
70 Ga0209813_10115031 3300027866 Bacteria 931
71 Ga0209974_10017128 3300027876 Bacteria 2404
72 Ga0265334_10066591 3300028573 Bacteria 1348
73 Ga0265323_10013873 3300028653 Bacteria 3204
74 Ga0265336_10000097 3300028666 Bacteria 66270
75 Ga0307517_10171651 3300028786 Bacteria 1424
76 Ga0307515_10000014 3300028794 Bacteria 562358
77 Ga0265324_10000001 3300029957 Bacteria 562975
78 Ga0265324_10000160 3300029957 Bacteria 52007
79 Ga0265324_10044357 3300029957 Bacteria 1533
80 Ga0265330_10000062 3300031235 Bacteria 95409
81 Ga0265332_10000001 3300031238 Bacteria 863783
82 Ga0265332_10007914 3300031238 Bacteria 4790
83 Ga0265325_10001227 3300031241 Bacteria 18265
84 Ga0265325_10025546 3300031241 Bacteria 3206
85 Ga0265325_10029210 3300031241 Bacteria 2964
86 Ga0265331_10006344 3300031250 Bacteria 7001
87 Ga0265331_10123126 3300031250 Bacteria 1185
88 Ga0265327_10000283 3300031251 Bacteria 100296
89 Ga0265327_10001775 3300031251 Bacteria 25434
90 Ga0265327_10005938 3300031251 Bacteria 9958
91 Ga0265316_10022511 3300031344 Bacteria 5311
92 Ga0265316_10022701 3300031344 Bacteria 5284
93 Ga0265316_10056455 3300031344 Bacteria 3066
94 Ga0265316_10151509 3300031344 Bacteria 1737
95 Ga0265316_10172786 3300031344 Bacteria 1611
96 Ga0265316_10244129 3300031344 Bacteria 1320
97 Ga0307408_100011505 3300031548 Bacteria 5845
98 Ga0307408_100511158 3300031548 Bacteria 1053
99 Ga0307514_10001865 3300031649 Bacteria 23265
100 Ga0265314_10000145 3300031711 Bacteria 106541
101 Ga0265314_10000185 3300031711 Bacteria 92226
102 Ga0265314_10077134 3300031711 Bacteria 2211
103 Ga0316576_10003998 3300031727 Bacteria 8764
104 Ga0316576_10022189 3300031727 Bacteria 4405
105 Ga0316578_10105966 3300031728 Bacteria 1687
106 Ga0307516_10000045 3300031730 Bacteria 132787
107 Ga0307516_10070364 3300031730 Bacteria 3362
108 Ga0307405_10358089 3300031731 Bacteria 1128
109 Ga0307413_10176750 3300031824 Bacteria 1517
110 Ga0307407_10223511 3300031903 Bacteria 1274
111 Ga0307414_10062170 3300032004 Bacteria 2648
112 Ga0307414_10492104 3300032004 Bacteria 1083
113 Ga0307411_10080453 3300032005 Bacteria 2240
114 Ga0316574_0017634 3300035398 Bacteria 4182
115 Ga0316574_0021790 3300035398 Bacteria 3809
116 Ga0373937_0065978 3300036401 Bacteria 3333
117 Ga0316584_0047896 3300036712 Bacteria 3194
118 Ga0316584_0096909 3300036712 Bacteria 2208
119 Ga0316584_0270889 3300036712 Bacteria 1236
120 Ga0395905_0007854 3300037471 Bacteria 10567
121 Ga0436361_0500419 3300039447 Bacteria 18953
122 Ga0439461_0050423 3300041410 Bacteria 922
123 Ga0450918_003487 3300042531 Bacteria 2918
124 Ga0451577_0000235 3300042876 Bacteria 109693
125 Ga0451577_0018698 3300042876 Bacteria 6377
126 Ga0451577_0021531 3300042876 Bacteria 5898
127 Ga0451577_0243188 3300042876 Bacteria 1628
128 Ga0453683_0020580 3300044673 Bacteria 4215
129 Ga0453683_0063681 3300044673 Bacteria 2305
130 Ga0453684_0000906 3300044712 Bacteria 98768
131 Ga0453684_0011701 3300044712 Bacteria 14634
132 Ga0453684_0013321 3300044712 Bacteria 13382
133 Ga0453684_0022832 3300044712 Bacteria 9261
134 Ga0453684_0113375 3300044712 Bacteria 3289
135 Ga0453684_0137492 3300044712 Bacteria 2922
136 Ga0453684_0384511 3300044712 Bacteria 1575
137 Ga0451576_0000184 3300045051 Bacteria 157166
138 Ga0451576_0020121 3300045051 Bacteria 7272
139 Ga0451576_0026986 3300045051 Bacteria 6171
140 Ga0451576_0052275 3300045051 Bacteria 4281
141 Ga0451576_0529515 3300045051 Bacteria 1238
142 Ga0495625_0000238 3300046660 Bacteria 85959
143 Ga0496101_0062361 3300048904 Bacteria 2710
144 Ga0496102_0119293 3300048905 Bacteria 2463
145 Ga0496102_0233632 3300048905 Bacteria 1733
146 Ga0496114_0329258 3300048917 Bacteria 1350
147 Ga0496126_0000719 3300048929 Bacteria 60201
148 Ga0501300_003269 3300049523 Bacteria 2419
149 Ga0501280_000698 3300049776 Bacteria 7423
150 Ga0501282_001885 3300049778 Bacteria 2309
151 nmdc:mga00v17_187501_c1 3300050491 Bacteria 1335
152 nmdc:mga0k408_223474_c1 3300050493 Bacteria 1124
153 nmdc:mga07m45_109896_c1 3300050496 Bacteria 1587
154 nmdc:mga07m45_31835_c1 3300050496 Bacteria 2923
155 nmdc:mga07m45_43846_c1 3300050496 Bacteria 2508
156 Ga0500559_0000184 3300053136 Bacteria 49756
157 Ga0500596_001305 3300053735 Bacteria 5037
158 2519462727 2519103095 Bacteria 6629912
159 2526211343 2526164512 Bacteria 4025691
160 2574429612 2574179768 Bacteria 4907129
161 2585291797 2582581311 Bacteria 6763856
162 2621299536 2619619299 Bacteria 6649820
163 2644338288 2643221660 Bacteria 4208257
164 2738669564 2738541265 Bacteria 6594665
165 2738721220 2738541277 Bacteria 7458140
166 2738747957 2738541282 Bacteria 6593925
167 2738856999 2738541303 Bacteria 6591772
168 2739280419 2738543019 Bacteria 7459457
169 2753566817 2751185846 Bacteria 7242164
170 2817262604 2816332253 Bacteria 6764532
171 2817276325 2816332256 Bacteria 6891714
172 2817453767 2816332286 Bacteria 6853759
173 2817490898 2816332298 Bacteria 6852809
174 2854681396 2854681122 Bacteria 4548679
175 2870074195 2870068957 Bacteria 8925310
176 2874172851 2874168670 Bacteria 8062617
177 2885312463 2885305155 Bacteria 7348390
178 2885333485 2885326080 Bacteria 7134805
179 2919139983 2919138771 Bacteria 5281312
180 8020809755 8020807995 Bacteria 6801506
181 8040178255 8040173305 Bacteria 6827067
182 Ga0451577_0019912
183 Ga0055537_1000097
184 Ga0055534_1000014
185 Ga0055528_1015191
186 Ga0055528_1039373
187 Ga0055540_1012494
188 Ga0055540_1013545
189 Ga0065714_10022422
190 Ga0070676_10007312
191 Ga0068869_100027586
192 Ga0070675_100018627
193 Ga0070671_100201199
194 Ga0070673_100451040
195 Ga0070678_100090923
196 Ga0070678_100145627
197 Ga0068867_100266674
198 Ga0070672_100044352
199 Ga0068857_100017286
200 Ga0068870_10017129
201 Ga0075368_10150798
202 Ga0075363_100416368
203 Ga0075364_10160425
204 Ga0075432_10032380
205 Ga0075362_10276650
206 Ga0075367_10214858
207 Ga0075366_10202363
208 Ga0075370_10108640
209 Ga0075370_10133717
210 Ga0068865_100281185
211 Ga0099826_10000072
212 Ga0105245_10123412
213 Ga0105243_10105599
214 Ga0105237_10002315
215 Ga0105246_10131810
216 Ga0157373_10009228
217 Ga0157375_10029276
218 Ga0182008_10057274
219 Ga0157379_10836817
220 Ga0182006_1030961
221 Ga0163161_10012613
222 Ga0213872_10002229
223 Ga0209565_1000047
224 Ga0209673_1000079
225 Ga0209673_1016102
226 Ga0209675_1000046
227 Ga0209676_1022587
228 Ga0209676_1049225
229 Ga0209025_1071280
230 Ga0209564_1050438
231 Ga0209050_1059223
232 Ga0209051_1000049
233 Ga0209051_1006343
234 Ga0209051_1030835
235 Ga0207645_10001993
236 Ga0207643_10010561
237 Ga0207671_10003143
238 Ga0207659_10009144
239 Ga0207687_10097225
240 Ga0207644_10022422
241 Ga0207709_10350689
242 Ga0207704_10405398
243 Ga0207691_10056739
244 Ga0207689_10014999
245 Ga0207651_10409919
246 Ga0207648_10080126
247 Ga0207674_10028376
248 Ga0207683_10272653
249 Ga0207683_10411264
250 Ga0209282_1000111
251 Ga0209813_10115031
252 Ga0209974_10017128
253 Ga0265334_10066591
254 Ga0265323_10013873
255 Ga0265336_10000097
256 Ga0307517_10171651
257 Ga0307515_10000014
258 Ga0265324_10000001
259 Ga0265324_10000160
260 Ga0265324_10044357
261 Ga0265330_10000062
262 Ga0265332_10000001
263 Ga0265332_10007914
264 Ga0265325_10001227
265 Ga0265325_10025546
266 Ga0265325_10029210
267 Ga0265331_10006344
268 Ga0265331_10123126
269 Ga0265327_10000283
270 Ga0265327_10001775
271 Ga0265327_10005938
272 Ga0265316_10022511
273 Ga0265316_10022701
274 Ga0265316_10056455
275 Ga0265316_10151509
276 Ga0265316_10172786
277 Ga0265316_10244129
278 Ga0307408_100011505
279 Ga0307408_100511158
280 Ga0307514_10001865
281 Ga0265314_10000145
282 Ga0265314_10000185
283 Ga0265314_10077134
284 Ga0316576_10003998
285 Ga0316576_10022189
286 Ga0316578_10105966
287 Ga0307516_10000045
288 Ga0307516_10070364
289 Ga0307405_10358089
290 Ga0307413_10176750
291 Ga0307407_10223511
292 Ga0307414_10062170
293 Ga0307414_10492104
294 Ga0307411_10080453
295 Ga0316574_0017634
296 Ga0316574_0021790
297 Ga0373937_0065978
298 Ga0316584_0047896
299 Ga0316584_0096909
300 Ga0316584_0270889
301 Ga0395905_0007854
302 Ga0436361_0500419
303 Ga0439461_0050423
304 Ga0450918_003487
305 Ga0451577_0000235
306 Ga0451577_0018698
307 Ga0451577_0021531
308 Ga0451577_0243188
309 Ga0453683_0020580
310 Ga0453683_0063681
311 Ga0453684_0000906
312 Ga0453684_0011701
313 Ga0453684_0013321
314 Ga0453684_0022832
315 Ga0453684_0113375
316 Ga0453684_0137492
317 Ga0453684_0384511
318 Ga0451576_0000184
319 Ga0451576_0020121
320 Ga0451576_0026986
321 Ga0451576_0052275
322 Ga0451576_0529515
323 Ga0495625_0000238
324 Ga0496101_0062361
325 Ga0496102_0119293
326 Ga0496102_0233632
327 Ga0496114_0329258
328 Ga0496126_0000719
329 Ga0501300_003269
330 Ga0501280_000698
331 Ga0501282_001885
332 nmdc:mga00v17_187501_c1
333 nmdc:mga0k408_223474_c1
334 nmdc:mga07m45_109896_c1
335 nmdc:mga07m45_31835_c1
336 nmdc:mga07m45_43846_c1
337 Ga0500559_0000184
338 Ga0500596_001305
339 2519462727
340 2526211343
341 2574429612
342 2585291797
343 2621299536
344 2644338288
345 2738669564
346 2738721220
347 2738747957
348 2738856999
349 2739280419
350 2753566817
351 2817262604
352 2817276325
353 2817453767
354 2817490898
355 2854681396
356 2870074195
357 2874172851
358 2885312463
359 2885333485
360 2919139983
361 8020809755
362 8040178255

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01750

HycI

Hydrogenase maturation protease

34

163

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cfz-assembly2.cif.gz_B hydrogenase maturating endopeptidase hybd from e. coli 0.9468 6 165
1cfz-assembly2.cif.gz_B hydrogenase maturating endopeptidase hybd from e. coli 0.9244 6 165
2kml-assembly1.cif.gz_A solution structure of an endopeptidase from escherichia coli 0.9149 6 165
2kml-assembly1.cif.gz_A solution structure of an endopeptidase from escherichia coli 0.8934 6 165
5ija-assembly2.cif.gz_B [nife] hydrogenase maturation protease hybd from thermococcus kodakarensis 0.8235 6 153
ID Description Score Start End Superfamily
af_P19930_4_164_3.40.50.1450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HybD-like 0.9576 5 165 3.40.50.1450
af_P19930_4_164_3.40.50.1450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HybD-like 0.9518 5 165 3.40.50.1450
1cfzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HybD-like 0.9471 6 165 3.40.50.1450
1cfzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HybD-like 0.9246 6 165 3.40.50.1450
5ijaB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HybD-like 0.8235 6 153 3.40.50.1450
ID Description Score Start End GO Terms
AF-A0A5C9CRI5-F1-model_v4 Hydrogenase 1 maturation protease 0.9689 1 128 GO:0004190
GO:0008047
GO:0016485
GO:0046872
AF-A0A7U3YQ03-F1-model_v4 Hydrogenase maturation protease 0.9681 6 165 GO:0004190
GO:0008047
GO:0016485
AF-A0A522WAD0-F1-model_v4 HyaD/HybD family hydrogenase maturation endopeptidase 0.9662 6 128 GO:0004190
GO:0008047
GO:0016485
GO:0046872
AF-D9PL60-F1-model_v4 Peptidase A31, hydrogenase expression/formation protein 0.9613 5 128 GO:0004190
GO:0008047
GO:0016485
GO:0046872
AF-A0A3M1DUQ3-F1-model_v4 HyaD/HybD family hydrogenase maturation endopeptidase 0.96 6 165 GO:0004190
GO:0008047
GO:0016485
GO:0046872

Map