F277815
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 181 | 132 | 362 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0019912|Ga0451577_0019912_4238_4963 |
| Length | 241 |
| Sequence | MYPGRFFRKTTMSNKRILVLGIGNLLWADEGFGVRCVEALNAGWEFPPQVTLMDGGTQGLYLLPYVQEADCLLVFDAVDYGDAPGTLREVVGDQVPRFMGAKKMSLHQTGFQEVLMAAELTGKLPAELVLIGVQPEELEDYGGSLRDVVKAQMAPALDVAFRWLERWGAAAQPRSGKAEAITDTALAIDVYEGERPPADQAFRLGDARFLNMENTTPTRAAHAAPQGGAPLPWGGPAGGAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 2 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 3 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 4 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 14 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 16 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 17 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 18 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 19 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 20 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 21 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 22 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 23 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 24 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 25 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 26 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 27 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 34 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 36 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 38 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 39 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 40 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 41 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 42 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 44 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 61 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 64 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 65 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 66 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 67 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 68 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 69 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 70 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 71 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 72 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 73 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 74 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 75 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 76 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 77 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 78 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 79 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 80 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 81 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 82 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 83 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 84 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 85 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 86 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 87 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 88 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 89 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 90 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 91 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 92 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 93 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 94 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 95 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 96 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 98 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 99 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 100 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 101 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 102 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 103 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 104 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 105 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 106 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 107 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 108 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 109 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 110 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 111 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 112 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 113 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 114 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 115 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 116 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 117 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 118 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 119 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 120 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 121 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 122 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 123 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 124 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 125 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 126 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 127 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 128 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 129 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 130 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 131 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 132 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.74 |
| Metatranscriptomes | 0 |
| Isolates | 13.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.78 |
| Nodule | 3.31 |
| Rhizoplane | 2.21 |
| Rhizosphere | 64.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451577_0019912 | 3300042876 | Bacteria | 6163 |
| 2 | Ga0055537_1000097 | 3300003773 | Bacteria | 65441 |
| 3 | Ga0055534_1000014 | 3300003784 | Bacteria | 150629 |
| 4 | Ga0055528_1015191 | 3300003790 | Bacteria | 2796 |
| 5 | Ga0055528_1039373 | 3300003790 | Bacteria | 1081 |
| 6 | Ga0055540_1012494 | 3300003792 | Bacteria | 2661 |
| 7 | Ga0055540_1013545 | 3300003792 | Bacteria | 2485 |
| 8 | Ga0065714_10022422 | 3300005288 | Bacteria | 1050 |
| 9 | Ga0070676_10007312 | 3300005328 | Bacteria | 5923 |
| 10 | Ga0068869_100027586 | 3300005334 | Bacteria | 3960 |
| 11 | Ga0070675_100018627 | 3300005354 | Bacteria | 5527 |
| 12 | Ga0070671_100201199 | 3300005355 | Bacteria | 1689 |
| 13 | Ga0070673_100451040 | 3300005364 | Bacteria | 1157 |
| 14 | Ga0070678_100090923 | 3300005456 | Bacteria | 2341 |
| 15 | Ga0070678_100145627 | 3300005456 | Bacteria | 1901 |
| 16 | Ga0068867_100266674 | 3300005459 | Bacteria | 1398 |
| 17 | Ga0070672_100044352 | 3300005543 | Bacteria | 3434 |
| 18 | Ga0068857_100017286 | 3300005577 | Bacteria | 6320 |
| 19 | Ga0068870_10017129 | 3300005840 | Bacteria | 3477 |
| 20 | Ga0075368_10150798 | 3300006042 | Bacteria | 971 |
| 21 | Ga0075363_100416368 | 3300006048 | Bacteria | 791 |
| 22 | Ga0075364_10160425 | 3300006051 | Bacteria | 1518 |
| 23 | Ga0075432_10032380 | 3300006058 | Bacteria | 1811 |
| 24 | Ga0075362_10276650 | 3300006177 | Bacteria | 830 |
| 25 | Ga0075367_10214858 | 3300006178 | Bacteria | 1203 |
| 26 | Ga0075366_10202363 | 3300006195 | Bacteria | 1208 |
| 27 | Ga0075370_10108640 | 3300006353 | Bacteria | 1610 |
| 28 | Ga0075370_10133717 | 3300006353 | Bacteria | 1448 |
| 29 | Ga0068865_100281185 | 3300006881 | Bacteria | 1325 |
| 30 | Ga0099826_10000072 | 3300006948 | Bacteria | 53143 |
| 31 | Ga0105245_10123412 | 3300009098 | Bacteria | 2422 |
| 32 | Ga0105243_10105599 | 3300009148 | Bacteria | 2346 |
| 33 | Ga0105237_10002315 | 3300009545 | Bacteria | 23664 |
| 34 | Ga0105246_10131810 | 3300011119 | Bacteria | 1868 |
| 35 | Ga0157373_10009228 | 3300013100 | Bacteria | 7293 |
| 36 | Ga0157375_10029276 | 3300013308 | Bacteria | 5177 |
| 37 | Ga0182008_10057274 | 3300014497 | Bacteria | 1924 |
| 38 | Ga0157379_10836817 | 3300014968 | Bacteria | 870 |
| 39 | Ga0182006_1030961 | 3300015261 | Bacteria | 2159 |
| 40 | Ga0163161_10012613 | 3300017792 | Bacteria | 5872 |
| 41 | Ga0213872_10002229 | 3300021361 | Bacteria | 11597 |
| 42 | Ga0209565_1000047 | 3300025263 | Bacteria | 225745 |
| 43 | Ga0209673_1000079 | 3300025273 | Bacteria | 225746 |
| 44 | Ga0209673_1016102 | 3300025273 | Bacteria | 2810 |
| 45 | Ga0209675_1000046 | 3300025291 | Bacteria | 225746 |
| 46 | Ga0209676_1022587 | 3300025292 | Bacteria | 2080 |
| 47 | Ga0209676_1049225 | 3300025292 | Bacteria | 1120 |
| 48 | Ga0209025_1071280 | 3300025294 | Bacteria | 1232 |
| 49 | Ga0209564_1050438 | 3300025295 | Bacteria | 1019 |
| 50 | Ga0209050_1059223 | 3300025298 | Bacteria | 915 |
| 51 | Ga0209051_1000049 | 3300025303 | Bacteria | 287483 |
| 52 | Ga0209051_1006343 | 3300025303 | Bacteria | 6691 |
| 53 | Ga0209051_1030835 | 3300025303 | Bacteria | 2074 |
| 54 | Ga0207645_10001993 | 3300025907 | Bacteria | 16424 |
| 55 | Ga0207643_10010561 | 3300025908 | Bacteria | 4972 |
| 56 | Ga0207671_10003143 | 3300025914 | Bacteria | 16762 |
| 57 | Ga0207659_10009144 | 3300025926 | Bacteria | 6186 |
| 58 | Ga0207687_10097225 | 3300025927 | Bacteria | 2159 |
| 59 | Ga0207644_10022422 | 3300025931 | Bacteria | 4315 |
| 60 | Ga0207709_10350689 | 3300025935 | Bacteria | 1114 |
| 61 | Ga0207704_10405398 | 3300025938 | Bacteria | 1077 |
| 62 | Ga0207691_10056739 | 3300025940 | Bacteria | 3567 |
| 63 | Ga0207689_10014999 | 3300025942 | Bacteria | 6572 |
| 64 | Ga0207651_10409919 | 3300025960 | Bacteria | 1154 |
| 65 | Ga0207648_10080126 | 3300026089 | Bacteria | 2849 |
| 66 | Ga0207674_10028376 | 3300026116 | Bacteria | 5908 |
| 67 | Ga0207683_10272653 | 3300026121 | Bacteria | 1546 |
| 68 | Ga0207683_10411264 | 3300026121 | Bacteria | 1245 |
| 69 | Ga0209282_1000111 | 3300027666 | Bacteria | 53376 |
| 70 | Ga0209813_10115031 | 3300027866 | Bacteria | 931 |
| 71 | Ga0209974_10017128 | 3300027876 | Bacteria | 2404 |
| 72 | Ga0265334_10066591 | 3300028573 | Bacteria | 1348 |
| 73 | Ga0265323_10013873 | 3300028653 | Bacteria | 3204 |
| 74 | Ga0265336_10000097 | 3300028666 | Bacteria | 66270 |
| 75 | Ga0307517_10171651 | 3300028786 | Bacteria | 1424 |
| 76 | Ga0307515_10000014 | 3300028794 | Bacteria | 562358 |
| 77 | Ga0265324_10000001 | 3300029957 | Bacteria | 562975 |
| 78 | Ga0265324_10000160 | 3300029957 | Bacteria | 52007 |
| 79 | Ga0265324_10044357 | 3300029957 | Bacteria | 1533 |
| 80 | Ga0265330_10000062 | 3300031235 | Bacteria | 95409 |
| 81 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 82 | Ga0265332_10007914 | 3300031238 | Bacteria | 4790 |
| 83 | Ga0265325_10001227 | 3300031241 | Bacteria | 18265 |
| 84 | Ga0265325_10025546 | 3300031241 | Bacteria | 3206 |
| 85 | Ga0265325_10029210 | 3300031241 | Bacteria | 2964 |
| 86 | Ga0265331_10006344 | 3300031250 | Bacteria | 7001 |
| 87 | Ga0265331_10123126 | 3300031250 | Bacteria | 1185 |
| 88 | Ga0265327_10000283 | 3300031251 | Bacteria | 100296 |
| 89 | Ga0265327_10001775 | 3300031251 | Bacteria | 25434 |
| 90 | Ga0265327_10005938 | 3300031251 | Bacteria | 9958 |
| 91 | Ga0265316_10022511 | 3300031344 | Bacteria | 5311 |
| 92 | Ga0265316_10022701 | 3300031344 | Bacteria | 5284 |
| 93 | Ga0265316_10056455 | 3300031344 | Bacteria | 3066 |
| 94 | Ga0265316_10151509 | 3300031344 | Bacteria | 1737 |
| 95 | Ga0265316_10172786 | 3300031344 | Bacteria | 1611 |
| 96 | Ga0265316_10244129 | 3300031344 | Bacteria | 1320 |
| 97 | Ga0307408_100011505 | 3300031548 | Bacteria | 5845 |
| 98 | Ga0307408_100511158 | 3300031548 | Bacteria | 1053 |
| 99 | Ga0307514_10001865 | 3300031649 | Bacteria | 23265 |
| 100 | Ga0265314_10000145 | 3300031711 | Bacteria | 106541 |
| 101 | Ga0265314_10000185 | 3300031711 | Bacteria | 92226 |
| 102 | Ga0265314_10077134 | 3300031711 | Bacteria | 2211 |
| 103 | Ga0316576_10003998 | 3300031727 | Bacteria | 8764 |
| 104 | Ga0316576_10022189 | 3300031727 | Bacteria | 4405 |
| 105 | Ga0316578_10105966 | 3300031728 | Bacteria | 1687 |
| 106 | Ga0307516_10000045 | 3300031730 | Bacteria | 132787 |
| 107 | Ga0307516_10070364 | 3300031730 | Bacteria | 3362 |
| 108 | Ga0307405_10358089 | 3300031731 | Bacteria | 1128 |
| 109 | Ga0307413_10176750 | 3300031824 | Bacteria | 1517 |
| 110 | Ga0307407_10223511 | 3300031903 | Bacteria | 1274 |
| 111 | Ga0307414_10062170 | 3300032004 | Bacteria | 2648 |
| 112 | Ga0307414_10492104 | 3300032004 | Bacteria | 1083 |
| 113 | Ga0307411_10080453 | 3300032005 | Bacteria | 2240 |
| 114 | Ga0316574_0017634 | 3300035398 | Bacteria | 4182 |
| 115 | Ga0316574_0021790 | 3300035398 | Bacteria | 3809 |
| 116 | Ga0373937_0065978 | 3300036401 | Bacteria | 3333 |
| 117 | Ga0316584_0047896 | 3300036712 | Bacteria | 3194 |
| 118 | Ga0316584_0096909 | 3300036712 | Bacteria | 2208 |
| 119 | Ga0316584_0270889 | 3300036712 | Bacteria | 1236 |
| 120 | Ga0395905_0007854 | 3300037471 | Bacteria | 10567 |
| 121 | Ga0436361_0500419 | 3300039447 | Bacteria | 18953 |
| 122 | Ga0439461_0050423 | 3300041410 | Bacteria | 922 |
| 123 | Ga0450918_003487 | 3300042531 | Bacteria | 2918 |
| 124 | Ga0451577_0000235 | 3300042876 | Bacteria | 109693 |
| 125 | Ga0451577_0018698 | 3300042876 | Bacteria | 6377 |
| 126 | Ga0451577_0021531 | 3300042876 | Bacteria | 5898 |
| 127 | Ga0451577_0243188 | 3300042876 | Bacteria | 1628 |
| 128 | Ga0453683_0020580 | 3300044673 | Bacteria | 4215 |
| 129 | Ga0453683_0063681 | 3300044673 | Bacteria | 2305 |
| 130 | Ga0453684_0000906 | 3300044712 | Bacteria | 98768 |
| 131 | Ga0453684_0011701 | 3300044712 | Bacteria | 14634 |
| 132 | Ga0453684_0013321 | 3300044712 | Bacteria | 13382 |
| 133 | Ga0453684_0022832 | 3300044712 | Bacteria | 9261 |
| 134 | Ga0453684_0113375 | 3300044712 | Bacteria | 3289 |
| 135 | Ga0453684_0137492 | 3300044712 | Bacteria | 2922 |
| 136 | Ga0453684_0384511 | 3300044712 | Bacteria | 1575 |
| 137 | Ga0451576_0000184 | 3300045051 | Bacteria | 157166 |
| 138 | Ga0451576_0020121 | 3300045051 | Bacteria | 7272 |
| 139 | Ga0451576_0026986 | 3300045051 | Bacteria | 6171 |
| 140 | Ga0451576_0052275 | 3300045051 | Bacteria | 4281 |
| 141 | Ga0451576_0529515 | 3300045051 | Bacteria | 1238 |
| 142 | Ga0495625_0000238 | 3300046660 | Bacteria | 85959 |
| 143 | Ga0496101_0062361 | 3300048904 | Bacteria | 2710 |
| 144 | Ga0496102_0119293 | 3300048905 | Bacteria | 2463 |
| 145 | Ga0496102_0233632 | 3300048905 | Bacteria | 1733 |
| 146 | Ga0496114_0329258 | 3300048917 | Bacteria | 1350 |
| 147 | Ga0496126_0000719 | 3300048929 | Bacteria | 60201 |
| 148 | Ga0501300_003269 | 3300049523 | Bacteria | 2419 |
| 149 | Ga0501280_000698 | 3300049776 | Bacteria | 7423 |
| 150 | Ga0501282_001885 | 3300049778 | Bacteria | 2309 |
| 151 | nmdc:mga00v17_187501_c1 | 3300050491 | Bacteria | 1335 |
| 152 | nmdc:mga0k408_223474_c1 | 3300050493 | Bacteria | 1124 |
| 153 | nmdc:mga07m45_109896_c1 | 3300050496 | Bacteria | 1587 |
| 154 | nmdc:mga07m45_31835_c1 | 3300050496 | Bacteria | 2923 |
| 155 | nmdc:mga07m45_43846_c1 | 3300050496 | Bacteria | 2508 |
| 156 | Ga0500559_0000184 | 3300053136 | Bacteria | 49756 |
| 157 | Ga0500596_001305 | 3300053735 | Bacteria | 5037 |
| 158 | 2519462727 | 2519103095 | Bacteria | 6629912 |
| 159 | 2526211343 | 2526164512 | Bacteria | 4025691 |
| 160 | 2574429612 | 2574179768 | Bacteria | 4907129 |
| 161 | 2585291797 | 2582581311 | Bacteria | 6763856 |
| 162 | 2621299536 | 2619619299 | Bacteria | 6649820 |
| 163 | 2644338288 | 2643221660 | Bacteria | 4208257 |
| 164 | 2738669564 | 2738541265 | Bacteria | 6594665 |
| 165 | 2738721220 | 2738541277 | Bacteria | 7458140 |
| 166 | 2738747957 | 2738541282 | Bacteria | 6593925 |
| 167 | 2738856999 | 2738541303 | Bacteria | 6591772 |
| 168 | 2739280419 | 2738543019 | Bacteria | 7459457 |
| 169 | 2753566817 | 2751185846 | Bacteria | 7242164 |
| 170 | 2817262604 | 2816332253 | Bacteria | 6764532 |
| 171 | 2817276325 | 2816332256 | Bacteria | 6891714 |
| 172 | 2817453767 | 2816332286 | Bacteria | 6853759 |
| 173 | 2817490898 | 2816332298 | Bacteria | 6852809 |
| 174 | 2854681396 | 2854681122 | Bacteria | 4548679 |
| 175 | 2870074195 | 2870068957 | Bacteria | 8925310 |
| 176 | 2874172851 | 2874168670 | Bacteria | 8062617 |
| 177 | 2885312463 | 2885305155 | Bacteria | 7348390 |
| 178 | 2885333485 | 2885326080 | Bacteria | 7134805 |
| 179 | 2919139983 | 2919138771 | Bacteria | 5281312 |
| 180 | 8020809755 | 8020807995 | Bacteria | 6801506 |
| 181 | 8040178255 | 8040173305 | Bacteria | 6827067 |
| 182 | Ga0451577_0019912 | |||
| 183 | Ga0055537_1000097 | |||
| 184 | Ga0055534_1000014 | |||
| 185 | Ga0055528_1015191 | |||
| 186 | Ga0055528_1039373 | |||
| 187 | Ga0055540_1012494 | |||
| 188 | Ga0055540_1013545 | |||
| 189 | Ga0065714_10022422 | |||
| 190 | Ga0070676_10007312 | |||
| 191 | Ga0068869_100027586 | |||
| 192 | Ga0070675_100018627 | |||
| 193 | Ga0070671_100201199 | |||
| 194 | Ga0070673_100451040 | |||
| 195 | Ga0070678_100090923 | |||
| 196 | Ga0070678_100145627 | |||
| 197 | Ga0068867_100266674 | |||
| 198 | Ga0070672_100044352 | |||
| 199 | Ga0068857_100017286 | |||
| 200 | Ga0068870_10017129 | |||
| 201 | Ga0075368_10150798 | |||
| 202 | Ga0075363_100416368 | |||
| 203 | Ga0075364_10160425 | |||
| 204 | Ga0075432_10032380 | |||
| 205 | Ga0075362_10276650 | |||
| 206 | Ga0075367_10214858 | |||
| 207 | Ga0075366_10202363 | |||
| 208 | Ga0075370_10108640 | |||
| 209 | Ga0075370_10133717 | |||
| 210 | Ga0068865_100281185 | |||
| 211 | Ga0099826_10000072 | |||
| 212 | Ga0105245_10123412 | |||
| 213 | Ga0105243_10105599 | |||
| 214 | Ga0105237_10002315 | |||
| 215 | Ga0105246_10131810 | |||
| 216 | Ga0157373_10009228 | |||
| 217 | Ga0157375_10029276 | |||
| 218 | Ga0182008_10057274 | |||
| 219 | Ga0157379_10836817 | |||
| 220 | Ga0182006_1030961 | |||
| 221 | Ga0163161_10012613 | |||
| 222 | Ga0213872_10002229 | |||
| 223 | Ga0209565_1000047 | |||
| 224 | Ga0209673_1000079 | |||
| 225 | Ga0209673_1016102 | |||
| 226 | Ga0209675_1000046 | |||
| 227 | Ga0209676_1022587 | |||
| 228 | Ga0209676_1049225 | |||
| 229 | Ga0209025_1071280 | |||
| 230 | Ga0209564_1050438 | |||
| 231 | Ga0209050_1059223 | |||
| 232 | Ga0209051_1000049 | |||
| 233 | Ga0209051_1006343 | |||
| 234 | Ga0209051_1030835 | |||
| 235 | Ga0207645_10001993 | |||
| 236 | Ga0207643_10010561 | |||
| 237 | Ga0207671_10003143 | |||
| 238 | Ga0207659_10009144 | |||
| 239 | Ga0207687_10097225 | |||
| 240 | Ga0207644_10022422 | |||
| 241 | Ga0207709_10350689 | |||
| 242 | Ga0207704_10405398 | |||
| 243 | Ga0207691_10056739 | |||
| 244 | Ga0207689_10014999 | |||
| 245 | Ga0207651_10409919 | |||
| 246 | Ga0207648_10080126 | |||
| 247 | Ga0207674_10028376 | |||
| 248 | Ga0207683_10272653 | |||
| 249 | Ga0207683_10411264 | |||
| 250 | Ga0209282_1000111 | |||
| 251 | Ga0209813_10115031 | |||
| 252 | Ga0209974_10017128 | |||
| 253 | Ga0265334_10066591 | |||
| 254 | Ga0265323_10013873 | |||
| 255 | Ga0265336_10000097 | |||
| 256 | Ga0307517_10171651 | |||
| 257 | Ga0307515_10000014 | |||
| 258 | Ga0265324_10000001 | |||
| 259 | Ga0265324_10000160 | |||
| 260 | Ga0265324_10044357 | |||
| 261 | Ga0265330_10000062 | |||
| 262 | Ga0265332_10000001 | |||
| 263 | Ga0265332_10007914 | |||
| 264 | Ga0265325_10001227 | |||
| 265 | Ga0265325_10025546 | |||
| 266 | Ga0265325_10029210 | |||
| 267 | Ga0265331_10006344 | |||
| 268 | Ga0265331_10123126 | |||
| 269 | Ga0265327_10000283 | |||
| 270 | Ga0265327_10001775 | |||
| 271 | Ga0265327_10005938 | |||
| 272 | Ga0265316_10022511 | |||
| 273 | Ga0265316_10022701 | |||
| 274 | Ga0265316_10056455 | |||
| 275 | Ga0265316_10151509 | |||
| 276 | Ga0265316_10172786 | |||
| 277 | Ga0265316_10244129 | |||
| 278 | Ga0307408_100011505 | |||
| 279 | Ga0307408_100511158 | |||
| 280 | Ga0307514_10001865 | |||
| 281 | Ga0265314_10000145 | |||
| 282 | Ga0265314_10000185 | |||
| 283 | Ga0265314_10077134 | |||
| 284 | Ga0316576_10003998 | |||
| 285 | Ga0316576_10022189 | |||
| 286 | Ga0316578_10105966 | |||
| 287 | Ga0307516_10000045 | |||
| 288 | Ga0307516_10070364 | |||
| 289 | Ga0307405_10358089 | |||
| 290 | Ga0307413_10176750 | |||
| 291 | Ga0307407_10223511 | |||
| 292 | Ga0307414_10062170 | |||
| 293 | Ga0307414_10492104 | |||
| 294 | Ga0307411_10080453 | |||
| 295 | Ga0316574_0017634 | |||
| 296 | Ga0316574_0021790 | |||
| 297 | Ga0373937_0065978 | |||
| 298 | Ga0316584_0047896 | |||
| 299 | Ga0316584_0096909 | |||
| 300 | Ga0316584_0270889 | |||
| 301 | Ga0395905_0007854 | |||
| 302 | Ga0436361_0500419 | |||
| 303 | Ga0439461_0050423 | |||
| 304 | Ga0450918_003487 | |||
| 305 | Ga0451577_0000235 | |||
| 306 | Ga0451577_0018698 | |||
| 307 | Ga0451577_0021531 | |||
| 308 | Ga0451577_0243188 | |||
| 309 | Ga0453683_0020580 | |||
| 310 | Ga0453683_0063681 | |||
| 311 | Ga0453684_0000906 | |||
| 312 | Ga0453684_0011701 | |||
| 313 | Ga0453684_0013321 | |||
| 314 | Ga0453684_0022832 | |||
| 315 | Ga0453684_0113375 | |||
| 316 | Ga0453684_0137492 | |||
| 317 | Ga0453684_0384511 | |||
| 318 | Ga0451576_0000184 | |||
| 319 | Ga0451576_0020121 | |||
| 320 | Ga0451576_0026986 | |||
| 321 | Ga0451576_0052275 | |||
| 322 | Ga0451576_0529515 | |||
| 323 | Ga0495625_0000238 | |||
| 324 | Ga0496101_0062361 | |||
| 325 | Ga0496102_0119293 | |||
| 326 | Ga0496102_0233632 | |||
| 327 | Ga0496114_0329258 | |||
| 328 | Ga0496126_0000719 | |||
| 329 | Ga0501300_003269 | |||
| 330 | Ga0501280_000698 | |||
| 331 | Ga0501282_001885 | |||
| 332 | nmdc:mga00v17_187501_c1 | |||
| 333 | nmdc:mga0k408_223474_c1 | |||
| 334 | nmdc:mga07m45_109896_c1 | |||
| 335 | nmdc:mga07m45_31835_c1 | |||
| 336 | nmdc:mga07m45_43846_c1 | |||
| 337 | Ga0500559_0000184 | |||
| 338 | Ga0500596_001305 | |||
| 339 | 2519462727 | |||
| 340 | 2526211343 | |||
| 341 | 2574429612 | |||
| 342 | 2585291797 | |||
| 343 | 2621299536 | |||
| 344 | 2644338288 | |||
| 345 | 2738669564 | |||
| 346 | 2738721220 | |||
| 347 | 2738747957 | |||
| 348 | 2738856999 | |||
| 349 | 2739280419 | |||
| 350 | 2753566817 | |||
| 351 | 2817262604 | |||
| 352 | 2817276325 | |||
| 353 | 2817453767 | |||
| 354 | 2817490898 | |||
| 355 | 2854681396 | |||
| 356 | 2870074195 | |||
| 357 | 2874172851 | |||
| 358 | 2885312463 | |||
| 359 | 2885333485 | |||
| 360 | 2919139983 | |||
| 361 | 8020809755 | |||
| 362 | 8040178255 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1cfz-assembly2.cif.gz_B | hydrogenase maturating endopeptidase hybd from e. coli | 0.9468 | 6 | 165 |
| 1cfz-assembly2.cif.gz_B | hydrogenase maturating endopeptidase hybd from e. coli | 0.9244 | 6 | 165 |
| 2kml-assembly1.cif.gz_A | solution structure of an endopeptidase from escherichia coli | 0.9149 | 6 | 165 |
| 2kml-assembly1.cif.gz_A | solution structure of an endopeptidase from escherichia coli | 0.8934 | 6 | 165 |
| 5ija-assembly2.cif.gz_B | [nife] hydrogenase maturation protease hybd from thermococcus kodakarensis | 0.8235 | 6 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P19930_4_164_3.40.50.1450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HybD-like | 0.9576 | 5 | 165 | 3.40.50.1450 |
| af_P19930_4_164_3.40.50.1450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HybD-like | 0.9518 | 5 | 165 | 3.40.50.1450 |
| 1cfzA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HybD-like | 0.9471 | 6 | 165 | 3.40.50.1450 |
| 1cfzA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HybD-like | 0.9246 | 6 | 165 | 3.40.50.1450 |
| 5ijaB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HybD-like | 0.8235 | 6 | 153 | 3.40.50.1450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C9CRI5-F1-model_v4 | Hydrogenase 1 maturation protease | 0.9689 | 1 | 128 |
GO:0004190
GO:0008047 GO:0016485 GO:0046872 |
| AF-A0A7U3YQ03-F1-model_v4 | Hydrogenase maturation protease | 0.9681 | 6 | 165 |
GO:0004190
GO:0008047 GO:0016485 |
| AF-A0A522WAD0-F1-model_v4 | HyaD/HybD family hydrogenase maturation endopeptidase | 0.9662 | 6 | 128 |
GO:0004190
GO:0008047 GO:0016485 GO:0046872 |
| AF-D9PL60-F1-model_v4 | Peptidase A31, hydrogenase expression/formation protein | 0.9613 | 5 | 128 |
GO:0004190
GO:0008047 GO:0016485 GO:0046872 |
| AF-A0A3M1DUQ3-F1-model_v4 | HyaD/HybD family hydrogenase maturation endopeptidase | 0.96 | 6 | 165 |
GO:0004190
GO:0008047 GO:0016485 GO:0046872 |