F277251

General Info

Members Datasets Scaffolds Average Seq Length
181 102 362 142

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10251081|Ga0111539_102510812
Length 171
Sequence LTGRQKWKIDRAAGAFSDDPAQQLRPNRLNIMPGTYWEHFPHEADMGVRGVGATREEAFEQAAVALTAVITDPEGVAPLEEIDVECEAPDDELLLAEWLNALIYQMATRRMLFARFEVQFDDSRLNGKAWGEPVDIGRHNPAVEVKGATYTQLKVARVETGAWLAQCVVDV

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
39 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
40 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
41 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
42 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
43 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
44 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
45 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
46 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
47 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
48 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
50 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
51 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
52 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
53 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
54 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
55 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
60 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
61 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
62 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
63 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
66 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
67 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
68 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
69 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
85 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
86 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
87 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
88 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
89 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
90 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
91 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
94 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
95 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
96 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
100 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
102 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 1.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 96.69
Stem 0
Stem Tuber 0
Unclassified 19.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10251081 3300009094 Bacteria 2060
2 Ga0070670_100670073 3300005331 Unclassified 932
3 Ga0068868_101611973 3300005338 Unclassified 610
4 Ga0070671_100793355 3300005355 Unclassified 824
5 Ga0070711_100655612 3300005439 Bacteria 880
6 Ga0070708_100089087 3300005445 Bacteria 2807
7 Ga0070706_100007143 3300005467 Bacteria 10503
8 Ga0070706_100729859 3300005467 Bacteria 918
9 Ga0070707_100002833 3300005468 Bacteria 16503
10 Ga0070698_100007518 3300005471 Bacteria 11786
11 Ga0070699_100007835 3300005518 Bacteria 9281
12 Ga0070699_100662176 3300005518 Bacteria 953
13 Ga0070699_101761217 3300005518 Bacteria 567
14 Ga0070697_100082554 3300005536 Bacteria 2649
15 Ga0070704_100057109 3300005549 Bacteria 2774
16 Ga0070664_100458352 3300005564 Unclassified 1171
17 Ga0068857_100604984 3300005577 Bacteria 1036
18 Ga0068857_101021438 3300005577 Bacteria 796
19 Ga0068859_100041883 3300005617 Bacteria 4600
20 Ga0068864_100137951 3300005618 Bacteria 2197
21 Ga0068864_101238779 3300005618 Unclassified 745
22 Ga0068870_10246038 3300005840 Bacteria 1106
23 Ga0068870_10830477 3300005840 Unclassified 648
24 Ga0081455_10140303 3300005937 Bacteria 1878
25 Ga0070717_10421089 3300006028 Unclassified 1201
26 Ga0075430_100328399 3300006846 Unclassified 1264
27 Ga0075431_100010791 3300006847 Bacteria 9186
28 Ga0075431_100625673 3300006847 Bacteria 1058
29 Ga0097620_100041881 3300006931 Bacteria 4600
30 Ga0099794_10023259 3300007265 Bacteria 2832
31 Ga0111539_10129247 3300009094 Bacteria 2958
32 Ga0114129_11050427 3300009147 Unclassified 1023
33 Ga0105246_10235190 3300011119 Unclassified 1445
34 Ga0157373_10059721 3300013100 Bacteria 2702
35 Ga0157378_11167200 3300013297 Unclassified 809
36 Ga0163163_10511847 3300014325 Bacteria 1262
37 Ga0157376_11374239 3300014969 Unclassified 737
38 Ga0207684_10002110 3300025910 Bacteria 20381
39 Ga0207646_10000662 3300025922 Bacteria 44719
40 Ga0207650_10291867 3300025925 Bacteria 1330
41 Ga0207650_10585075 3300025925 Unclassified 938
42 Ga0207700_10490973 3300025928 Unclassified 1086
43 Ga0207676_10256538 3300026095 Bacteria 1576
44 Ga0207676_10556892 3300026095 Bacteria 1096
45 Ga0207674_10440183 3300026116 Bacteria 1260
46 Ga0207674_11021457 3300026116 Unclassified 796
47 Ga0207675_102113202 3300026118 Unclassified 579
48 Ga0209974_10096591 3300027876 Bacteria 1029
49 Ga0209974_10118771 3300027876 Bacteria 935
50 Ga0316575_10000015 3300031665 Bacteria 44411
51 Ga0316579_10000437 3300031691 Bacteria 13285
52 Ga0316579_10007770 3300031691 Bacteria 4443
53 Ga0316579_10149003 3300031691 Bacteria 1128
54 Ga0316579_10226007 3300031691 Bacteria 905
55 Ga0316576_10133206 3300031727 Bacteria 1870
56 Ga0316576_10171116 3300031727 Bacteria 1639
57 Ga0316578_10031032 3300031728 Bacteria 3042
58 Ga0316578_10035918 3300031728 Bacteria 2850
59 Ga0316578_10209913 3300031728 Bacteria 1171
60 Ga0316577_10000848 3300031733 Bacteria 13372
61 Ga0316577_10127402 3300031733 Bacteria 1432
62 Ga0316577_10188563 3300031733 Bacteria 1165
63 Ga0316577_10194395 3300031733 Bacteria 1147
64 Ga0316577_10253103 3300031733 Bacteria 996
65 Ga0307413_10698462 3300031824 Bacteria 842
66 Ga0307409_100683117 3300031995 Unclassified 1024
67 Ga0316583_10035169 3300032133 Bacteria 1778
68 Ga0316583_10066743 3300032133 Bacteria 1259
69 Ga0316583_10098170 3300032133 Bacteria 1021
70 Ga0316583_10150940 3300032133 Bacteria 809
71 Ga0316585_10000187 3300032137 Bacteria 12616
72 Ga0316580_10048352 3300032139 Bacteria 1310
73 Ga0316580_10056946 3300032139 Bacteria 1201
74 Ga0316593_10050563 3300032168 Bacteria 1403
75 Ga0316593_10214166 3300032168 Bacteria 714
76 Ga0373926_0422383 3300035083 Unclassified 528
77 Ga0373961_0405362 3300035241 Unclassified 524
78 Ga0316574_0000344 3300035398 Bacteria 17965
79 Ga0316574_0103338 3300035398 Bacteria 1824
80 Ga0373927_0146904 3300035695 Bacteria 1544
81 Ga0373937_1783426 3300036401 Unclassified 562
82 Ga0316582_0000250 3300036647 Bacteria 17986
83 Ga0316582_0024663 3300036647 Bacteria 3601
84 Ga0316582_0071185 3300036647 Bacteria 2252
85 Ga0316582_0079796 3300036647 Bacteria 2134
86 Ga0316582_0283407 3300036647 Bacteria 1137
87 Ga0316582_0316755 3300036647 Bacteria 1072
88 Ga0316582_0927491 3300036647 Unclassified 595
89 Ga0316584_0018067 3300036712 Bacteria 5083
90 Ga0316584_0048409 3300036712 Bacteria 3176
91 Ga0316584_0051453 3300036712 Bacteria 3080
92 Ga0316584_0053157 3300036712 Bacteria 3030
93 Ga0316584_0070707 3300036712 Bacteria 2615
94 Ga0316584_0253391 3300036712 Bacteria 1285
95 Ga0316584_0631660 3300036712 Unclassified 740
96 Ga0395898_0237548 3300037466 Bacteria 1738
97 Ga0316581_0007401 3300037588 Bacteria 2944
98 Ga0395901_0177924 3300038443 Unclassified 2231
99 Ga0400490_06783 3300038726 Bacteria 58124
100 Ga0400490_17198 3300038726 Bacteria 36147
101 Ga0400490_23886 3300038726 Bacteria 10943
102 Ga0400488_40260 3300038741 Bacteria 3237
103 Ga0400488_63276 3300038741 Bacteria 2358
104 Ga0400487_31940 3300039110 Bacteria 9979
105 Ga0450888_030872 3300042126 Bacteria 717
106 Ga0453683_0168630 3300044673 Bacteria 1386
107 Ga0453684_0457408 3300044712 Bacteria 1420
108 Ga0495580_0230639 3300046472 Bacteria 1271
109 Ga0495664_0555778 3300046477 Bacteria 684
110 Ga0495647_0375948 3300046681 Unclassified 650
111 Ga0495658_0331768 3300046683 Unclassified 965
112 Ga0501031_0331296 3300049568 Unclassified 986
113 Ga0501032_0845470 3300049569 Bacteria 577
114 Ga0501033_0209679 3300049570 Bacteria 1390
115 Ga0501033_0254521 3300049570 Bacteria 1244
116 Ga0501033_0270424 3300049570 Bacteria 1201
117 Ga0501036_0194755 3300049572 Bacteria 1705
118 Ga0501036_0959973 3300049572 Bacteria 700
119 Ga0501037_0063574 3300049573 Bacteria 2690
120 Ga0501037_0335424 3300049573 Bacteria 1045
121 Ga0501038_0075211 3300049574 Bacteria 2855
122 Ga0501038_0531999 3300049574 Bacteria 896
123 Ga0501039_0643273 3300049575 Unclassified 830
124 Ga0501040_0014098 3300049576 Bacteria 5262
125 Ga0501040_0334364 3300049576 Bacteria 1084
126 Ga0501040_1068284 3300049576 Bacteria 585
127 Ga0501041_0006720 3300049577 Bacteria 6743
128 Ga0501041_0106869 3300049577 Bacteria 1735
129 Ga0501042_0685683 3300049578 Unclassified 745
130 Ga0501042_0742351 3300049578 Bacteria 714
131 Ga0501042_1076659 3300049578 Unclassified 586
132 Ga0501043_0203705 3300049579 Bacteria 1535
133 Ga0501043_0523212 3300049579 Unclassified 884
134 Ga0501046_0125653 3300049580 Bacteria 1949
135 Ga0501046_0594144 3300049580 Bacteria 786
136 Ga0501048_0071837 3300049582 Bacteria 2443
137 Ga0501048_0080784 3300049582 Bacteria 2294
138 Ga0501048_0430872 3300049582 Bacteria 944
139 Ga0501068_0121516 3300049584 Bacteria 1629
140 Ga0501071_0075326 3300049587 Bacteria 2463
141 Ga0501072_0282103 3300049588 Bacteria 1321
142 Ga0501075_0085282 3300049591 Bacteria 2393
143 Ga0501075_0188240 3300049591 Bacteria 1574
144 Ga0501075_0360234 3300049591 Bacteria 1108
145 Ga0501075_0592922 3300049591 Bacteria 845
146 Ga0501076_0045897 3300049592 Bacteria 3451
147 Ga0501076_0145568 3300049592 Bacteria 1926
148 Ga0501076_0204665 3300049592 Bacteria 1612
149 Ga0501076_0426504 3300049592 Bacteria 1091
150 Ga0501077_0007960 3300049593 Bacteria 6551
151 Ga0501079_0082134 3300049741 Bacteria 2492
152 Ga0501079_0336016 3300049741 Bacteria 1183
153 Ga0501079_0408500 3300049741 Unclassified 1065
154 Ga0501081_0042765 3300049743 Bacteria 3106
155 Ga0501081_0343272 3300049743 Bacteria 1100
156 Ga0501081_1048900 3300049743 Bacteria 616
157 Ga0501083_0229497 3300049744 Unclassified 1209
158 Ga0501083_0768512 3300049744 Bacteria 627
159 Ga0501035_0247276 3300049822 Bacteria 1516
160 Ga0501035_1177484 3300049822 Bacteria 595
161 Ga0501044_0795281 3300049823 Bacteria 825
162 Ga0501045_0640556 3300049824 Bacteria 786
163 Ga0501045_1040045 3300049824 Unclassified 600
164 nmdc:mga05p37_861237_c1 3300050507 Bacteria 983
165 nmdc:mga0qj67_280293_c1 3300050509 Bacteria 1351
166 nmdc:mga06r32_148612_c1 3300050510 Bacteria 2321
167 nmdc:mga06r32_797754_c1 3300050510 Bacteria 905
168 nmdc:mga08y16_320691_c1 3300050511 Bacteria 1595
169 nmdc:mga08y16_6655_c1 3300050511 Bacteria 12124
170 nmdc:mga0n895_225782_c1 3300050512 Bacteria 1901
171 nmdc:mga0n895_455398_c1 3300050512 Bacteria 1291
172 nmdc:mga0a205_91224_c1 3300050515 Bacteria 2944
173 Ga0501084_0018517 3300054114 Bacteria 5797
174 Ga0501084_0608250 3300054114 Bacteria 923
175 Ga0501084_1029395 3300054114 Unclassified 692
176 Ga0501084_1572480 3300054114 Unclassified 550
177 Ga0501082_0172762 3300060353 Bacteria 1879
178 Ga0501082_1223934 3300060353 Bacteria 656
179 Ga0530510_0237205 3300061734 Bacteria 1357
180 Ga0530510_0289876 3300061734 Bacteria 1224
181 Ga0530510_0504631 3300061734 Bacteria 917
182 Ga0111539_10251081
183 Ga0070670_100670073
184 Ga0068868_101611973
185 Ga0070671_100793355
186 Ga0070711_100655612
187 Ga0070708_100089087
188 Ga0070706_100007143
189 Ga0070706_100729859
190 Ga0070707_100002833
191 Ga0070698_100007518
192 Ga0070699_100007835
193 Ga0070699_100662176
194 Ga0070699_101761217
195 Ga0070697_100082554
196 Ga0070704_100057109
197 Ga0070664_100458352
198 Ga0068857_100604984
199 Ga0068857_101021438
200 Ga0068859_100041883
201 Ga0068864_100137951
202 Ga0068864_101238779
203 Ga0068870_10246038
204 Ga0068870_10830477
205 Ga0081455_10140303
206 Ga0070717_10421089
207 Ga0075430_100328399
208 Ga0075431_100010791
209 Ga0075431_100625673
210 Ga0097620_100041881
211 Ga0099794_10023259
212 Ga0111539_10129247
213 Ga0114129_11050427
214 Ga0105246_10235190
215 Ga0157373_10059721
216 Ga0157378_11167200
217 Ga0163163_10511847
218 Ga0157376_11374239
219 Ga0207684_10002110
220 Ga0207646_10000662
221 Ga0207650_10291867
222 Ga0207650_10585075
223 Ga0207700_10490973
224 Ga0207676_10256538
225 Ga0207676_10556892
226 Ga0207674_10440183
227 Ga0207674_11021457
228 Ga0207675_102113202
229 Ga0209974_10096591
230 Ga0209974_10118771
231 Ga0316575_10000015
232 Ga0316579_10000437
233 Ga0316579_10007770
234 Ga0316579_10149003
235 Ga0316579_10226007
236 Ga0316576_10133206
237 Ga0316576_10171116
238 Ga0316578_10031032
239 Ga0316578_10035918
240 Ga0316578_10209913
241 Ga0316577_10000848
242 Ga0316577_10127402
243 Ga0316577_10188563
244 Ga0316577_10194395
245 Ga0316577_10253103
246 Ga0307413_10698462
247 Ga0307409_100683117
248 Ga0316583_10035169
249 Ga0316583_10066743
250 Ga0316583_10098170
251 Ga0316583_10150940
252 Ga0316585_10000187
253 Ga0316580_10048352
254 Ga0316580_10056946
255 Ga0316593_10050563
256 Ga0316593_10214166
257 Ga0373926_0422383
258 Ga0373961_0405362
259 Ga0316574_0000344
260 Ga0316574_0103338
261 Ga0373927_0146904
262 Ga0373937_1783426
263 Ga0316582_0000250
264 Ga0316582_0024663
265 Ga0316582_0071185
266 Ga0316582_0079796
267 Ga0316582_0283407
268 Ga0316582_0316755
269 Ga0316582_0927491
270 Ga0316584_0018067
271 Ga0316584_0048409
272 Ga0316584_0051453
273 Ga0316584_0053157
274 Ga0316584_0070707
275 Ga0316584_0253391
276 Ga0316584_0631660
277 Ga0395898_0237548
278 Ga0316581_0007401
279 Ga0395901_0177924
280 Ga0400490_06783
281 Ga0400490_17198
282 Ga0400490_23886
283 Ga0400488_40260
284 Ga0400488_63276
285 Ga0400487_31940
286 Ga0450888_030872
287 Ga0453683_0168630
288 Ga0453684_0457408
289 Ga0495580_0230639
290 Ga0495664_0555778
291 Ga0495647_0375948
292 Ga0495658_0331768
293 Ga0501031_0331296
294 Ga0501032_0845470
295 Ga0501033_0209679
296 Ga0501033_0254521
297 Ga0501033_0270424
298 Ga0501036_0194755
299 Ga0501036_0959973
300 Ga0501037_0063574
301 Ga0501037_0335424
302 Ga0501038_0075211
303 Ga0501038_0531999
304 Ga0501039_0643273
305 Ga0501040_0014098
306 Ga0501040_0334364
307 Ga0501040_1068284
308 Ga0501041_0006720
309 Ga0501041_0106869
310 Ga0501042_0685683
311 Ga0501042_0742351
312 Ga0501042_1076659
313 Ga0501043_0203705
314 Ga0501043_0523212
315 Ga0501046_0125653
316 Ga0501046_0594144
317 Ga0501048_0071837
318 Ga0501048_0080784
319 Ga0501048_0430872
320 Ga0501068_0121516
321 Ga0501071_0075326
322 Ga0501072_0282103
323 Ga0501075_0085282
324 Ga0501075_0188240
325 Ga0501075_0360234
326 Ga0501075_0592922
327 Ga0501076_0045897
328 Ga0501076_0145568
329 Ga0501076_0204665
330 Ga0501076_0426504
331 Ga0501077_0007960
332 Ga0501079_0082134
333 Ga0501079_0336016
334 Ga0501079_0408500
335 Ga0501081_0042765
336 Ga0501081_0343272
337 Ga0501081_1048900
338 Ga0501083_0229497
339 Ga0501083_0768512
340 Ga0501035_0247276
341 Ga0501035_1177484
342 Ga0501044_0795281
343 Ga0501045_0640556
344 Ga0501045_1040045
345 nmdc:mga05p37_861237_c1
346 nmdc:mga0qj67_280293_c1
347 nmdc:mga06r32_148612_c1
348 nmdc:mga06r32_797754_c1
349 nmdc:mga08y16_320691_c1
350 nmdc:mga08y16_6655_c1
351 nmdc:mga0n895_225782_c1
352 nmdc:mga0n895_455398_c1
353 nmdc:mga0a205_91224_c1
354 Ga0501084_0018517
355 Ga0501084_0608250
356 Ga0501084_1029395
357 Ga0501084_1572480
358 Ga0501082_0172762
359 Ga0501082_1223934
360 Ga0530510_0237205
361 Ga0530510_0289876
362 Ga0530510_0504631

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01951

Archease

Archease protein family (MTH1598/TM1083)

37

171

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n2p-assembly1.cif.gz_A structure of archease from pyrococcus horikoshii 0.9022 5 140
5yzl-assembly1.cif.gz_B crystal structure of human archease d178a 0.8998 7 138
1jw3-assembly1.cif.gz_A solution structure of methanobacterium thermoautotrophicum protein 1598. ontario centre for structural proteomics target mth1598_1_140; northeast structural genomics target tt6 0.8782 4 140
4n2p-assembly1.cif.gz_A structure of archease from pyrococcus horikoshii 0.8711 5 140
5yzj-assembly1.cif.gz_B crystal structure of human archease mutant d51a 0.8641 7 138
ID Description Score Start End Superfamily
af_Q60334_1_139_3.55.10.10 Alpha Beta;3-Layer(bab) Sandwich;Archease, Possible Chaperone; Chain: A; domain 1;Archease domain 0.9561 6 140 3.55.10.10
af_Q9TZN1_15_155_3.55.10.10 Alpha Beta;3-Layer(bab) Sandwich;Archease, Possible Chaperone; Chain: A; domain 1;Archease domain 0.9364 3 140 3.55.10.10
af_Q8ILH4_99_237_3.55.10.10 Alpha Beta;3-Layer(bab) Sandwich;Archease, Possible Chaperone; Chain: A; domain 1;Archease domain 0.9348 5 140 3.55.10.10
af_Q54BU9_8_151_3.55.10.10 Alpha Beta;3-Layer(bab) Sandwich;Archease, Possible Chaperone; Chain: A; domain 1;Archease domain 0.9311 5 140 3.55.10.10
af_Q60334_1_139_3.55.10.10 Alpha Beta;3-Layer(bab) Sandwich;Archease, Possible Chaperone; Chain: A; domain 1;Archease domain 0.9229 6 140 3.55.10.10
ID Description Score Start End GO Terms
AF-A0A7C5G696-F1-model_v4 Archease 0.996 2 140 GO:0008033
GO:0046872
AF-A0A7T9JKR5-F1-model_v4 deleted 0.9928 1 140
AF-A0A2V5MVD2-F1-model_v4 Archease domain-containing protein 0.9897 55 140 GO:0008033
GO:0046872
AF-A0A6I7MZA5-F1-model_v4 Archease 0.9873 15 140 GO:0008033
GO:0046872
AF-A0A1M3GVL9-F1-model_v4 Multifunctional CCA protein [Includes: CCA-adding enzyme (EC 2.7.7.72) (CCA tRNA nucleotidyltransferase) (tRNA CCA-pyrophosphorylase) (tRNA adenylyl-/cytidylyl-transferase) (tRNA nucleotidyltransferase) (tRNA-NT); 2'-nucleotidase (EC 3.1.3.-); 2',3'-cyclic phosphodiesterase (EC 3.1.4.-); Phosphatase] 0.9871 2 140 GO:0000049
GO:0000287
GO:0001680
GO:0004112
GO:0005524
GO:0016791
GO:0042245
GO:0160016

Map