F276523
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 180 | 152 | 136 | 255 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8054913762|8054915296 |
| Length | 282 |
| Sequence | FIGAGPGAADLITVRGRDLVASCPVCLYAGSLVPAELLSHCPPGARLVDTARMTLDAITAELCAADAAGHDVARLHSGDPSLYSALAEQMRRLDAAGVPYDVTPGVPAFAAAAASLRRELTVPGVAQSVVLTRTAVLSSPMPPGEDLATLGRSRATLVLHLAVHRIETLVEELVPSYGPDCPAAVVAWASRPDEVVLRGTLADIAAQSRAAGLTKTAVIIVGRALAAAGFRDSFLYSPQRFAPDGCQPAPATGWSSVPGNSLSEDSLSGGSAPGNLDPAGPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 2 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 3 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 4 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 5 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 6 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 7 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 8 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 9 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 10 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 11 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 12 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 13 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 14 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 15 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 16 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 17 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 18 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 19 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 20 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 21 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 22 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 23 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 24 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 25 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 26 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 27 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 28 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 29 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 30 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 31 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 32 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 33 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 34 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 35 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 36 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 37 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 38 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 39 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 40 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 75 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 76 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 98 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 99 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 100 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 101 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 102 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 103 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 104 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 105 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 106 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 107 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 108 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 109 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 110 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 111 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 112 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 113 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 114 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 115 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 118 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 119 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 120 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 121 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 122 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 123 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 124 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 125 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 126 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 127 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 141 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 146 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 147 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 148 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 149 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 150 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 151 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 152 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.56 |
| Metatranscriptomes | 0 |
| Isolates | 24.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.33 |
| Nodule | 8.33 |
| Rhizoplane | 2.78 |
| Rhizosphere | 64.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10015670 | 3300003203 | Bacteria | 3189 |
| 2 | Ga0070666_10228676 | 3300005335 | Bacteria | 1313 |
| 3 | Ga0070680_100238048 | 3300005336 | Bacteria | 1538 |
| 4 | Ga0070668_100158531 | 3300005347 | Bacteria | 1835 |
| 5 | Ga0070668_100180751 | 3300005347 | Bacteria | 1723 |
| 6 | Ga0070671_100199403 | 3300005355 | Bacteria | 1697 |
| 7 | Ga0070667_100002139 | 3300005367 | Bacteria | 17394 |
| 8 | Ga0070667_100161815 | 3300005367 | Bacteria | 1972 |
| 9 | Ga0070681_10006541 | 3300005458 | Bacteria | 11347 |
| 10 | Ga0070665_100001690 | 3300005548 | Bacteria | 25404 |
| 11 | Ga0068857_100576841 | 3300005577 | Bacteria | 1061 |
| 12 | Ga0068863_100000263 | 3300005841 | Bacteria | 54959 |
| 13 | Ga0068863_100245220 | 3300005841 | Bacteria | 1730 |
| 14 | Ga0068858_100025272 | 3300005842 | Bacteria | 5527 |
| 15 | Ga0068860_100000067 | 3300005843 | Bacteria | 180176 |
| 16 | Ga0068862_100335672 | 3300005844 | Bacteria | 1399 |
| 17 | Ga0081539_10000079 | 3300005985 | Bacteria | 223413 |
| 18 | Ga0070717_10565711 | 3300006028 | Bacteria | 1030 |
| 19 | Ga0075370_10066558 | 3300006353 | Bacteria | 2055 |
| 20 | Ga0075428_100010214 | 3300006844 | Bacteria | 10422 |
| 21 | Ga0075430_100010314 | 3300006846 | Bacteria | 7911 |
| 22 | Ga0075431_100004705 | 3300006847 | Bacteria | 13403 |
| 23 | Ga0075429_100015606 | 3300006880 | Bacteria | 6583 |
| 24 | Ga0097620_100824806 | 3300006931 | Bacteria | 1014 |
| 25 | Ga0075435_100225777 | 3300007076 | Bacteria | 1591 |
| 26 | Ga0105251_10189691 | 3300009011 | Bacteria | 926 |
| 27 | Ga0105240_10001798 | 3300009093 | Bacteria | 36105 |
| 28 | Ga0105247_10000127 | 3300009101 | Bacteria | 73316 |
| 29 | Ga0105247_10049034 | 3300009101 | Bacteria | 2595 |
| 30 | Ga0114129_10004236 | 3300009147 | Bacteria | 20256 |
| 31 | Ga0105243_10415678 | 3300009148 | Bacteria | 1253 |
| 32 | Ga0105248_10006801 | 3300009177 | Bacteria | 12537 |
| 33 | Ga0105237_10399144 | 3300009545 | Bacteria | 1380 |
| 34 | Ga0105238_10368695 | 3300009551 | Bacteria | 1426 |
| 35 | Ga0105238_10446436 | 3300009551 | Bacteria | 1290 |
| 36 | Ga0105029_101762 | 3300009984 | Bacteria | 1369 |
| 37 | Ga0163163_10081640 | 3300014325 | Bacteria | 3235 |
| 38 | Ga0157380_10019607 | 3300014326 | Bacteria | 5041 |
| 39 | Ga0157379_10007864 | 3300014968 | Bacteria | 9238 |
| 40 | Ga0157379_10016237 | 3300014968 | Bacteria | 6552 |
| 41 | Ga0157379_10060449 | 3300014968 | Bacteria | 3387 |
| 42 | Ga0213872_10000615 | 3300021361 | Bacteria | 26974 |
| 43 | Ga0213872_10007895 | 3300021361 | Bacteria | 5191 |
| 44 | Ga0213874_10040882 | 3300021377 | Bacteria | 1386 |
| 45 | Ga0209437_100275 | 3300025233 | Bacteria | 76419 |
| 46 | Ga0207710_10000155 | 3300025900 | Bacteria | 73331 |
| 47 | Ga0207647_10091935 | 3300025904 | Bacteria | 1809 |
| 48 | Ga0207707_10130007 | 3300025912 | Bacteria | 2202 |
| 49 | Ga0207695_10001636 | 3300025913 | Bacteria | 36191 |
| 50 | Ga0207671_10224113 | 3300025914 | Bacteria | 1473 |
| 51 | Ga0207660_10072606 | 3300025917 | Bacteria | 2506 |
| 52 | Ga0207652_10051751 | 3300025921 | Bacteria | 3522 |
| 53 | Ga0207652_10219418 | 3300025921 | Bacteria | 1713 |
| 54 | Ga0207686_10052845 | 3300025934 | Bacteria | 2537 |
| 55 | Ga0207709_10676116 | 3300025935 | Bacteria | 824 |
| 56 | Ga0207711_10012974 | 3300025941 | Bacteria | 6922 |
| 57 | Ga0207661_10154319 | 3300025944 | Bacteria | 1987 |
| 58 | Ga0207679_10224622 | 3300025945 | Bacteria | 1582 |
| 59 | Ga0207668_10483812 | 3300025972 | Bacteria | 1062 |
| 60 | Ga0207658_10003008 | 3300025986 | Bacteria | 12058 |
| 61 | Ga0207658_10052898 | 3300025986 | Bacteria | 2998 |
| 62 | Ga0207703_10030058 | 3300026035 | Bacteria | 4291 |
| 63 | Ga0207703_10033873 | 3300026035 | Bacteria | 4051 |
| 64 | Ga0207703_10082278 | 3300026035 | Bacteria | 2686 |
| 65 | Ga0207641_10002388 | 3300026088 | Bacteria | 17327 |
| 66 | Ga0207676_10201735 | 3300026095 | Bacteria | 1758 |
| 67 | Ga0207674_10017708 | 3300026116 | Bacteria | 7765 |
| 68 | Ga0207674_10226097 | 3300026116 | Bacteria | 1819 |
| 69 | Ga0207698_10034457 | 3300026142 | Bacteria | 3691 |
| 70 | Ga0268264_10000114 | 3300028381 | Bacteria | 203211 |
| 71 | Ga0268264_10013013 | 3300028381 | Bacteria | 6839 |
| 72 | Ga0307515_10001186 | 3300028794 | Bacteria | 59639 |
| 73 | Ga0307515_10113489 | 3300028794 | Bacteria | 3141 |
| 74 | Ga0307513_10001922 | 3300031456 | Bacteria | 29483 |
| 75 | Ga0307513_10121809 | 3300031456 | Bacteria | 2573 |
| 76 | Ga0307513_10332895 | 3300031456 | Bacteria | 1272 |
| 77 | Ga0307513_10376944 | 3300031456 | Bacteria | 1159 |
| 78 | Ga0307408_100425723 | 3300031548 | Bacteria | 1146 |
| 79 | Ga0307508_10055860 | 3300031616 | Bacteria | 3497 |
| 80 | Ga0307508_10224877 | 3300031616 | Bacteria | 1476 |
| 81 | Ga0307516_10001015 | 3300031730 | Bacteria | 38933 |
| 82 | Ga0307406_10360976 | 3300031901 | Bacteria | 1139 |
| 83 | Ga0307411_10032763 | 3300032005 | Bacteria | 3215 |
| 84 | Ga0307415_100046889 | 3300032126 | Bacteria | 2906 |
| 85 | Ga0307415_100092549 | 3300032126 | Bacteria | 2193 |
| 86 | Ga0373956_0001711 | 3300035119 | Bacteria | 9046 |
| 87 | Ga0436361_0558115 | 3300039447 | Bacteria | 3276 |
| 88 | Ga0436361_0872724 | 3300039447 | Bacteria | 57229 |
| 89 | Ga0436363_0148652 | 3300039450 | Bacteria | 1531 |
| 90 | Ga0451791_0608697 | 3300041451 | Bacteria | 1338 |
| 91 | Ga0451843_0654840 | 3300041509 | Bacteria | 1444 |
| 92 | Ga0451853_0755571 | 3300041512 | Bacteria | 3625 |
| 93 | Ga0466961_0003618 | 3300044693 | Bacteria | 9631 |
| 94 | Ga0466961_0030576 | 3300044693 | Bacteria | 3461 |
| 95 | Ga0466964_0015126 | 3300044706 | Bacteria | 2938 |
| 96 | Ga0453684_0119009 | 3300044712 | Bacteria | 3193 |
| 97 | Ga0466967_0011331 | 3300045976 | Bacteria | 6746 |
| 98 | Ga0466967_0017332 | 3300045976 | Bacteria | 5714 |
| 99 | Ga0466967_0054347 | 3300045976 | Bacteria | 3524 |
| 100 | Ga0466967_0069624 | 3300045976 | Bacteria | 3145 |
| 101 | Ga0466967_0347496 | 3300045976 | Bacteria | 1435 |
| 102 | Ga0495668_0000171 | 3300046616 | Bacteria | 96971 |
| 103 | Ga0495649_0240600 | 3300046694 | Bacteria | 932 |
| 104 | Ga0496102_0375496 | 3300048905 | Bacteria | 1338 |
| 105 | Ga0496108_0126487 | 3300048911 | Bacteria | 2194 |
| 106 | Ga0496113_0136444 | 3300048916 | Bacteria | 1928 |
| 107 | Ga0496118_0165109 | 3300048921 | Bacteria | 1362 |
| 108 | Ga0496119_0000425 | 3300048922 | Bacteria | 58047 |
| 109 | Ga0496120_0000563 | 3300048923 | Bacteria | 56530 |
| 110 | Ga0496121_0002913 | 3300048924 | Bacteria | 25104 |
| 111 | Ga0496121_0074535 | 3300048924 | Bacteria | 2714 |
| 112 | Ga0496122_0000134 | 3300048925 | Bacteria | 171080 |
| 113 | Ga0496123_0000307 | 3300048926 | Bacteria | 95174 |
| 114 | Ga0496125_0028312 | 3300048928 | Bacteria | 5064 |
| 115 | Ga0501031_0066928 | 3300049568 | Bacteria | 2341 |
| 116 | Ga0501032_0000031 | 3300049569 | Bacteria | 130204 |
| 117 | Ga0501033_0000305 | 3300049570 | Bacteria | 46466 |
| 118 | Ga0501034_0000064 | 3300049571 | Bacteria | 189461 |
| 119 | Ga0501036_0027818 | 3300049572 | Bacteria | 4779 |
| 120 | Ga0501037_0000132 | 3300049573 | Bacteria | 69775 |
| 121 | Ga0501038_0000055 | 3300049574 | Bacteria | 93761 |
| 122 | Ga0501039_0000045 | 3300049575 | Bacteria | 104513 |
| 123 | Ga0501043_0000015 | 3300049579 | Bacteria | 175932 |
| 124 | Ga0501046_0020551 | 3300049580 | Bacteria | 5458 |
| 125 | Ga0501047_0032373 | 3300049581 | Bacteria | 5047 |
| 126 | Ga0501047_0069041 | 3300049581 | Bacteria | 3404 |
| 127 | Ga0501035_0000105 | 3300049822 | Bacteria | 104877 |
| 128 | Ga0501044_0008070 | 3300049823 | Bacteria | 11564 |
| 129 | nmdc:mga07m45_61921_c1 | 3300050496 | Bacteria | 2120 |
| 130 | nmdc:mga05p37_23250_c1 | 3300050507 | Bacteria | 7518 |
| 131 | nmdc:mga09592_18035_c1 | 3300050508 | Bacteria | 5786 |
| 132 | nmdc:mga0qj67_9476_c1 | 3300050509 | Bacteria | 7249 |
| 133 | nmdc:mga06r32_161169_c1 | 3300050510 | Bacteria | 2226 |
| 134 | Ga0500647_0182778 | 3300053091 | Bacteria | 961 |
| 135 | Ga0500641_0089505 | 3300053096 | Bacteria | 1313 |
| 136 | Ga0500604_0034010 | 3300053151 | Bacteria | 1510 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025904 | Ga0207647_10091935 | Ga0207647_100919352 | 202 |
| 2 | 3300009011 | Ga0105251_10189691 | Ga0105251_101896911 | 218 |
| 3 | 3300014326 | Ga0157380_10019607 | Ga0157380_100196073 | 228 |
| 4 | 3300007076 | Ga0075435_100225777 | Ga0075435_1002257772 | 231 |
| 5 | 3300026035 | Ga0207703_10082278 | Ga0207703_100822783 | 231 |
| 6 | 3300049581 | Ga0501047_0032373 | Ga0501047_0032373_1909_2664 | 232 |
| 7 | 3300025934 | Ga0207686_10052845 | Ga0207686_100528452 | 234 |
| 8 | 3300026095 | Ga0207676_10201735 | Ga0207676_102017352 | 234 |
| 9 | 3300031730 | Ga0307516_10001015 | Ga0307516_100010158 | 234 |
| 10 | 3300031616 | Ga0307508_10055860 | Ga0307508_100558603 | 238 |
| 11 | 3300025945 | Ga0207679_10224622 | Ga0207679_102246221 | 239 |
| 12 | 3300053096 | Ga0500641_0089505 | Ga0500641_0089505_258_1043 | 242 |
| 13 | iso_pu_bacteria | 2870782633 | 2870790776 | 243 |
| 14 | iso_pu_bacteria | 2891326441 | 2891329505 | 243 |
| 15 | iso_pu_bacteria | 2899359706 | 2899364471 | 243 |
| 16 | iso_pu_bacteria | 8055066027 | 8055072247 | 243 |
| 17 | iso_pu_bacteria | 2565956761 | 2566993389 | 245 |
| 18 | iso_pu_bacteria | 2738541308 | 2738890315 | 245 |
| 19 | iso_pu_bacteria | 2738543011 | 2739235283 | 245 |
| 20 | iso_pu_bacteria | 2795385472 | 2795792849 | 245 |
| 21 | iso_pu_bacteria | 2889300758 | 2889301721 | 245 |
| 22 | iso_pu_bacteria | 2904535858 | 2904539537 | 245 |
| 23 | iso_pu_bacteria | 2922554459 | 2922555383 | 245 |
| 24 | iso_pu_bacteria | 2928142448 | 2928144430 | 245 |
| 25 | iso_pu_bacteria | 2939743619 | 2939747282 | 245 |
| 26 | 3300005347 | Ga0070668_100180751 | Ga0070668_1001807512 | 246 |
| 27 | 3300009148 | Ga0105243_10415678 | Ga0105243_104156782 | 246 |
| 28 | 3300025935 | Ga0207709_10676116 | Ga0207709_106761161 | 246 |
| 29 | 3300025972 | Ga0207668_10483812 | Ga0207668_104838122 | 246 |
| 30 | 3300026116 | Ga0207674_10017708 | Ga0207674_100177084 | 246 |
| 31 | 3300031456 | Ga0307513_10332895 | Ga0307513_103328952 | 246 |
| 32 | 3300035119 | Ga0373956_0001711 | Ga0373956_0001711_7676_8416 | 246 |
| 33 | 3300045976 | Ga0466967_0347496 | Ga0466967_0347496_436_1176 | 246 |
| 34 | 3300048905 | Ga0496102_0375496 | Ga0496102_0375496_220_960 | 246 |
| 35 | 3300048916 | Ga0496113_0136444 | Ga0496113_0136444_505_1245 | 246 |
| 36 | 3300049581 | Ga0501047_0069041 | Ga0501047_0069041_2313_3053 | 246 |
| 37 | iso_pu_bacteria | 2517572101 | 2517761129 | 246 |
| 38 | iso_pu_bacteria | 8002784119 | 8002791220 | 246 |
| 39 | 3300005347 | Ga0070668_100158531 | Ga0070668_1001585311 | 247 |
| 40 | 3300005367 | Ga0070667_100161815 | Ga0070667_1001618152 | 247 |
| 41 | 3300005841 | Ga0068863_100245220 | Ga0068863_1002452202 | 247 |
| 42 | 3300014325 | Ga0163163_10081640 | Ga0163163_100816403 | 247 |
| 43 | 3300025986 | Ga0207658_10052898 | Ga0207658_100528983 | 247 |
| 44 | 3300026035 | Ga0207703_10030058 | Ga0207703_100300582 | 247 |
| 45 | 3300028381 | Ga0268264_10013013 | Ga0268264_100130132 | 247 |
| 46 | 3300028794 | Ga0307515_10001186 | Ga0307515_1000118645 | 247 |
| 47 | 3300028794 | Ga0307515_10113489 | Ga0307515_101134891 | 247 |
| 48 | 3300031456 | Ga0307513_10121809 | Ga0307513_101218093 | 247 |
| 49 | 3300031548 | Ga0307408_100425723 | Ga0307408_1004257232 | 247 |
| 50 | 3300031901 | Ga0307406_10360976 | Ga0307406_103609762 | 247 |
| 51 | 3300032126 | Ga0307415_100046889 | Ga0307415_1000468892 | 247 |
| 52 | 3300032126 | Ga0307415_100092549 | Ga0307415_1000925492 | 247 |
| 53 | 3300041451 | Ga0451791_0608697 | Ga0451791_0608697_445_1233 | 247 |
| 54 | 3300044693 | Ga0466961_0030576 | Ga0466961_0030576_2302_3045 | 247 |
| 55 | 3300044706 | Ga0466964_0015126 | Ga0466964_0015126_2146_2889 | 247 |
| 56 | 3300045976 | Ga0466967_0011331 | Ga0466967_0011331_5133_5876 | 247 |
| 57 | 3300045976 | Ga0466967_0069624 | Ga0466967_0069624_1856_2599 | 247 |
| 58 | iso_pu_bacteria | 2527291627 | 2528206266 | 247 |
| 59 | iso_pu_bacteria | 2527291629 | 2528214286 | 247 |
| 60 | iso_pu_bacteria | 2546825537 | 2546948291 | 247 |
| 61 | iso_pu_bacteria | 2576861822 | 2579749609 | 247 |
| 62 | iso_pu_bacteria | 2582580736 | 2583150294 | 247 |
| 63 | iso_pu_bacteria | 2684623036 | 2686544770 | 247 |
| 64 | iso_pu_bacteria | 2710264753 | 2710601876 | 247 |
| 65 | iso_pu_bacteria | 2773857924 | 2774863676 | 247 |
| 66 | iso_pu_bacteria | 637000116 | 637878860 | 247 |
| 67 | 3300005335 | Ga0070666_10228676 | Ga0070666_102286762 | 248 |
| 68 | 3300005355 | Ga0070671_100199403 | Ga0070671_1001994032 | 248 |
| 69 | 3300005367 | Ga0070667_100002139 | Ga0070667_1000021392 | 248 |
| 70 | 3300005548 | Ga0070665_100001690 | Ga0070665_10000169018 | 248 |
| 71 | 3300005841 | Ga0068863_100000263 | Ga0068863_10000026332 | 248 |
| 72 | 3300005842 | Ga0068858_100025272 | Ga0068858_1000252724 | 248 |
| 73 | 3300005843 | Ga0068860_100000067 | Ga0068860_100000067161 | 248 |
| 74 | 3300014968 | Ga0157379_10007864 | Ga0157379_100078645 | 248 |
| 75 | 3300025986 | Ga0207658_10003008 | Ga0207658_1000300811 | 248 |
| 76 | 3300026035 | Ga0207703_10033873 | Ga0207703_100338732 | 248 |
| 77 | 3300026088 | Ga0207641_10002388 | Ga0207641_100023886 | 248 |
| 78 | 3300028381 | Ga0268264_10000114 | Ga0268264_1000011418 | 248 |
| 79 | 3300032005 | Ga0307411_10032763 | Ga0307411_100327632 | 248 |
| 80 | 3300041509 | Ga0451843_0654840 | Ga0451843_0654840_657_1403 | 248 |
| 81 | 3300041512 | Ga0451853_0755571 | Ga0451853_0755571_2861_3607 | 248 |
| 82 | 3300045976 | Ga0466967_0017332 | Ga0466967_0017332_552_1298 | 248 |
| 83 | 3300005577 | Ga0068857_100576841 | Ga0068857_1005768412 | 249 |
| 84 | 3300006353 | Ga0075370_10066558 | Ga0075370_100665583 | 249 |
| 85 | 3300006844 | Ga0075428_100010214 | Ga0075428_1000102143 | 249 |
| 86 | 3300006846 | Ga0075430_100010314 | Ga0075430_1000103145 | 249 |
| 87 | 3300006847 | Ga0075431_100004705 | Ga0075431_1000047056 | 249 |
| 88 | 3300006880 | Ga0075429_100015606 | Ga0075429_1000156066 | 249 |
| 89 | 3300009147 | Ga0114129_10004236 | Ga0114129_1000423619 | 249 |
| 90 | 3300025921 | Ga0207652_10219418 | Ga0207652_102194182 | 249 |
| 91 | 3300026116 | Ga0207674_10226097 | Ga0207674_102260972 | 249 |
| 92 | 3300045976 | Ga0466967_0054347 | Ga0466967_0054347_1694_2443 | 249 |
| 93 | 3300046616 | Ga0495668_0000171 | Ga0495668_0000171_48890_49639 | 249 |
| 94 | 3300048911 | Ga0496108_0126487 | Ga0496108_0126487_1241_1990 | 249 |
| 95 | 3300048928 | Ga0496125_0028312 | Ga0496125_0028312_1283_2032 | 249 |
| 96 | 3300050496 | nmdc:mga07m45_61921_c1 | nmdc:mga07m45_61921_c1_765_1514 | 249 |
| 97 | 3300050507 | nmdc:mga05p37_23250_c1 | nmdc:mga05p37_23250_c1_2804_3595 | 249 |
| 98 | 3300050508 | nmdc:mga09592_18035_c1 | nmdc:mga09592_18035_c1_1645_2436 | 249 |
| 99 | 3300050509 | nmdc:mga0qj67_9476_c1 | nmdc:mga0qj67_9476_c1_3371_4162 | 249 |
| 100 | 3300050510 | nmdc:mga06r32_161169_c1 | nmdc:mga06r32_161169_c1_1411_2202 | 249 |
| 101 | iso_pu_bacteria | 2547132103 | 2547373929 | 249 |
| 102 | iso_pu_bacteria | 2548876994 | 2550695474 | 249 |
| 103 | iso_pu_bacteria | 2579778521 | 2579858152 | 249 |
| 104 | iso_pu_bacteria | 2582581305 | 2585259809 | 249 |
| 105 | iso_pu_bacteria | 2619618881 | 2619859078 | 249 |
| 106 | iso_pu_bacteria | 2619619003 | 2620354213 | 249 |
| 107 | iso_pu_bacteria | 2626541554 | 2626639156 | 249 |
| 108 | iso_pu_bacteria | 2751185725 | 2753034867 | 249 |
| 109 | iso_pu_bacteria | 2751185792 | 2753323384 | 249 |
| 110 | iso_pu_bacteria | 2818991445 | 2819591805 | 249 |
| 111 | iso_pu_bacteria | 2839993093 | 2839994723 | 249 |
| 112 | iso_pu_bacteria | 2843690924 | 2843693177 | 249 |
| 113 | iso_pu_bacteria | 2846033681 | 2846036800 | 249 |
| 114 | iso_pu_bacteria | 2873314349 | 2873317730 | 249 |
| 115 | iso_pu_bacteria | 2885266251 | 2885268356 | 249 |
| 116 | iso_pu_bacteria | 3006425503 | 3006426940 | 249 |
| 117 | iso_pu_bacteria | 8054913762 | 8054915296 | 249 |
| 118 | iso_pu_bacteria | 8054920844 | 8054925376 | 249 |
| 119 | 3300046694 | Ga0495649_0240600 | Ga0495649_0240600_57_809 | 250 |
| 120 | iso_pu_bacteria | 2791354901 | 2791910338 | 250 |
| 121 | 3300005336 | Ga0070680_100238048 | Ga0070680_1002380482 | 252 |
| 122 | 3300005458 | Ga0070681_10006541 | Ga0070681_100065416 | 252 |
| 123 | 3300005844 | Ga0068862_100335672 | Ga0068862_1003356722 | 252 |
| 124 | 3300009101 | Ga0105247_10049034 | Ga0105247_100490343 | 252 |
| 125 | 3300009551 | Ga0105238_10446436 | Ga0105238_104464362 | 252 |
| 126 | 3300014968 | Ga0157379_10060449 | Ga0157379_100604492 | 252 |
| 127 | 3300025912 | Ga0207707_10130007 | Ga0207707_101300073 | 252 |
| 128 | 3300025917 | Ga0207660_10072606 | Ga0207660_100726062 | 252 |
| 129 | 3300025921 | Ga0207652_10051751 | Ga0207652_100517514 | 252 |
| 130 | 3300031456 | Ga0307513_10376944 | Ga0307513_103769442 | 252 |
| 131 | 3300053151 | Ga0500604_0034010 | Ga0500604_0034010_612_1373 | 252 |
| 132 | 3300003203 | JGI25406J46586_10015670 | JGI25406J46586_100156703 | 253 |
| 133 | 3300005985 | Ga0081539_10000079 | Ga0081539_10000079159 | 253 |
| 134 | 3300006028 | Ga0070717_10565711 | Ga0070717_105657112 | 253 |
| 135 | 3300006931 | Ga0097620_100824806 | Ga0097620_1008248062 | 253 |
| 136 | 3300009093 | Ga0105240_10001798 | Ga0105240_1000179812 | 253 |
| 137 | 3300009101 | Ga0105247_10000127 | Ga0105247_1000012718 | 253 |
| 138 | 3300009177 | Ga0105248_10006801 | Ga0105248_100068016 | 253 |
| 139 | 3300009545 | Ga0105237_10399144 | Ga0105237_103991442 | 253 |
| 140 | 3300009551 | Ga0105238_10368695 | Ga0105238_103686952 | 253 |
| 141 | 3300009984 | Ga0105029_101762 | Ga0105029_1017622 | 253 |
| 142 | 3300014968 | Ga0157379_10016237 | Ga0157379_100162373 | 253 |
| 143 | 3300021361 | Ga0213872_10000615 | Ga0213872_1000061510 | 253 |
| 144 | 3300021361 | Ga0213872_10007895 | Ga0213872_100078952 | 253 |
| 145 | 3300021377 | Ga0213874_10040882 | Ga0213874_100408822 | 253 |
| 146 | 3300025233 | Ga0209437_100275 | Ga0209437_10027573 | 253 |
| 147 | 3300025900 | Ga0207710_10000155 | Ga0207710_1000015517 | 253 |
| 148 | 3300025913 | Ga0207695_10001636 | Ga0207695_1000163612 | 253 |
| 149 | 3300025914 | Ga0207671_10224113 | Ga0207671_102241132 | 253 |
| 150 | 3300025941 | Ga0207711_10012974 | Ga0207711_100129746 | 253 |
| 151 | 3300025944 | Ga0207661_10154319 | Ga0207661_101543192 | 253 |
| 152 | 3300026142 | Ga0207698_10034457 | Ga0207698_100344572 | 253 |
| 153 | 3300031456 | Ga0307513_10001922 | Ga0307513_1000192216 | 253 |
| 154 | 3300031616 | Ga0307508_10224877 | Ga0307508_102248772 | 253 |
| 155 | 3300039447 | Ga0436361_0558115 | Ga0436361_0558115_1784_2611 | 253 |
| 156 | 3300039447 | Ga0436361_0872724 | Ga0436361_0872724_20492_21289 | 253 |
| 157 | 3300039450 | Ga0436363_0148652 | Ga0436363_0148652_81_845 | 253 |
| 158 | 3300044693 | Ga0466961_0003618 | Ga0466961_0003618_696_1472 | 253 |
| 159 | 3300044712 | Ga0453684_0119009 | Ga0453684_0119009_1391_2158 | 253 |
| 160 | 3300048921 | Ga0496118_0165109 | Ga0496118_0165109_111_932 | 253 |
| 161 | 3300048922 | Ga0496119_0000425 | Ga0496119_0000425_4091_4891 | 253 |
| 162 | 3300048923 | Ga0496120_0000563 | Ga0496120_0000563_28907_29707 | 253 |
| 163 | 3300048924 | Ga0496121_0002913 | Ga0496121_0002913_16973_17794 | 253 |
| 164 | 3300048924 | Ga0496121_0074535 | Ga0496121_0074535_1561_2382 | 253 |
| 165 | 3300048925 | Ga0496122_0000134 | Ga0496122_0000134_112839_113660 | 253 |
| 166 | 3300048926 | Ga0496123_0000307 | Ga0496123_0000307_38544_39365 | 253 |
| 167 | 3300049568 | Ga0501031_0066928 | Ga0501031_0066928_75_839 | 253 |
| 168 | 3300049569 | Ga0501032_0000031 | Ga0501032_0000031_104129_104893 | 253 |
| 169 | 3300049570 | Ga0501033_0000305 | Ga0501033_0000305_11776_12540 | 253 |
| 170 | 3300049571 | Ga0501034_0000064 | Ga0501034_0000064_84569_85333 | 253 |
| 171 | 3300049572 | Ga0501036_0027818 | Ga0501036_0027818_3760_4524 | 253 |
| 172 | 3300049573 | Ga0501037_0000132 | Ga0501037_0000132_20439_21203 | 253 |
| 173 | 3300049574 | Ga0501038_0000055 | Ga0501038_0000055_50003_50767 | 253 |
| 174 | 3300049575 | Ga0501039_0000045 | Ga0501039_0000045_77000_77764 | 253 |
| 175 | 3300049579 | Ga0501043_0000015 | Ga0501043_0000015_123850_124614 | 253 |
| 176 | 3300049580 | Ga0501046_0020551 | Ga0501046_0020551_3897_4661 | 253 |
| 177 | 3300049822 | Ga0501035_0000105 | Ga0501035_0000105_19562_20326 | 253 |
| 178 | 3300049823 | Ga0501044_0008070 | Ga0501044_0008070_5396_6160 | 253 |
| 179 | 3300053091 | Ga0500647_0182778 | Ga0500647_0182778_63_827 | 253 |
| 180 | iso_pu_bacteria | 2846037992 | 2846041447 | 253 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1cbf-assembly1.cif.gz_A | the x-ray structure of a cobalamin biosynthetic enzyme, cobalt precorrin-4 methyltransferase, cbif | 0.9627 | 2 | 229 |
| 3ndc-assembly1.cif.gz_B | crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus | 0.9623 | 1 | 237 |
| 3ndc-assembly1.cif.gz_B | crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus | 0.9583 | 1 | 237 |
| 3ndc-assembly1.cif.gz_A | crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus | 0.9526 | 2 | 234 |
| 3nei-assembly1.cif.gz_A | crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus (no sah bound) | 0.942 | 1 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGB1_111_234_3.30.950.10 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9889 | 111 | 233 | 3.30.950.10 |
| af_P9WGB1_111_234_3.30.950.10 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9732 | 111 | 233 | 3.30.950.10 |
| 3neiB01 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9652 | 1 | 110 | 3.40.1010.10 |
| 3neiB01 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9567 | 1 | 110 | 3.40.1010.10 |
| 4e16A01 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9442 | 2 | 110 | 3.40.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5M3XA37-F1-model_v4 | Precorrin-4 C(11)-methyltransferase | 0.9855 | 1 | 246 |
GO:0009236
GO:0032259 GO:0046026 |
| AF-A0A1J0UGS9-F1-model_v4 | deleted | 0.9846 | 1 | 246 |
|
| AF-A0A5N0IAC7-F1-model_v4 | Precorrin-4 C(11)-methyltransferase (EC 2.1.1.133) | 0.9839 | 1 | 246 |
GO:0009236
GO:0032259 GO:0046026 |
| AF-A0A1A3GMS8-F1-model_v4 | Precorrin-4 C(11)-methyltransferase | 0.9838 | 1 | 246 |
GO:0009236
GO:0032259 GO:0046026 |
| AF-A0A391PC72-F1-model_v4 | Precorrin-4 C(11)-methyltransferase | 0.9827 | 1 | 246 |
GO:0009236
GO:0032259 GO:0046026 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar