F276523

General Info

Members Datasets Scaffolds Average Seq Length
180 152 136 255

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8054913762|8054915296
Length 282
Sequence FIGAGPGAADLITVRGRDLVASCPVCLYAGSLVPAELLSHCPPGARLVDTARMTLDAITAELCAADAAGHDVARLHSGDPSLYSALAEQMRRLDAAGVPYDVTPGVPAFAAAAASLRRELTVPGVAQSVVLTRTAVLSSPMPPGEDLATLGRSRATLVLHLAVHRIETLVEELVPSYGPDCPAAVVAWASRPDEVVLRGTLADIAAQSRAAGLTKTAVIIVGRALAAAGFRDSFLYSPQRFAPDGCQPAPATGWSSVPGNSLSEDSLSGGSAPGNLDPAGPR

Samples

Sample ID Description Type Environment
1 2517572101 Frankia sp. DC12 Isolate Nodule
2 2527291627 Frankia casuarinae Thr Isolate Nodule
3 2527291629 Frankia sp. BMG5.23 Isolate Nodule
4 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
5 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
6 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
7 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
8 2576861822 Frankia sp. CeD Isolate Nodule
9 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
10 2582580736 Prauserella sp. Am3 Isolate Unclassified
11 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
12 2619618881 Frankia sp. ACN1ag Isolate Unclassified
13 2619619003 Frankia sp. CpI1-P Isolate Nodule
14 2626541554 Frankia sp. AvcI.1 Isolate Nodule
15 2684623036 Frankia sp. CgIM4 Isolate Nodule
16 2710264753 Frankia sp. KB5 Isolate Nodule
17 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
18 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
19 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
20 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
21 2773857924 Frankia sp. CgIS1 Isolate Nodule
22 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
23 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
24 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
25 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
26 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
27 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
28 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
29 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
30 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
31 2885266251 Ralstonia sp. SET104 Isolate Nodule
32 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
33 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
34 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
35 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
36 2922554459 Rhodococcus sp. 66b Isolate Unclassified
37 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
38 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
39 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
40 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
109 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
146 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
147 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
148 637000116 Frankia casuarinae CcI3 Isolate Nodule
149 8002784119 Frankia sp. AgB1.9 Isolate Nodule
150 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
151 8054920844 Frankia tisae Agncl-8 Isolate Nodule
152 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 75.56
Metatranscriptomes 0
Isolates 24.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.33
Nodule 8.33
Rhizoplane 2.78
Rhizosphere 64.44
Stem 0
Stem Tuber 0
Unclassified 21.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10015670 3300003203 Bacteria 3189
2 Ga0070666_10228676 3300005335 Bacteria 1313
3 Ga0070680_100238048 3300005336 Bacteria 1538
4 Ga0070668_100158531 3300005347 Bacteria 1835
5 Ga0070668_100180751 3300005347 Bacteria 1723
6 Ga0070671_100199403 3300005355 Bacteria 1697
7 Ga0070667_100002139 3300005367 Bacteria 17394
8 Ga0070667_100161815 3300005367 Bacteria 1972
9 Ga0070681_10006541 3300005458 Bacteria 11347
10 Ga0070665_100001690 3300005548 Bacteria 25404
11 Ga0068857_100576841 3300005577 Bacteria 1061
12 Ga0068863_100000263 3300005841 Bacteria 54959
13 Ga0068863_100245220 3300005841 Bacteria 1730
14 Ga0068858_100025272 3300005842 Bacteria 5527
15 Ga0068860_100000067 3300005843 Bacteria 180176
16 Ga0068862_100335672 3300005844 Bacteria 1399
17 Ga0081539_10000079 3300005985 Bacteria 223413
18 Ga0070717_10565711 3300006028 Bacteria 1030
19 Ga0075370_10066558 3300006353 Bacteria 2055
20 Ga0075428_100010214 3300006844 Bacteria 10422
21 Ga0075430_100010314 3300006846 Bacteria 7911
22 Ga0075431_100004705 3300006847 Bacteria 13403
23 Ga0075429_100015606 3300006880 Bacteria 6583
24 Ga0097620_100824806 3300006931 Bacteria 1014
25 Ga0075435_100225777 3300007076 Bacteria 1591
26 Ga0105251_10189691 3300009011 Bacteria 926
27 Ga0105240_10001798 3300009093 Bacteria 36105
28 Ga0105247_10000127 3300009101 Bacteria 73316
29 Ga0105247_10049034 3300009101 Bacteria 2595
30 Ga0114129_10004236 3300009147 Bacteria 20256
31 Ga0105243_10415678 3300009148 Bacteria 1253
32 Ga0105248_10006801 3300009177 Bacteria 12537
33 Ga0105237_10399144 3300009545 Bacteria 1380
34 Ga0105238_10368695 3300009551 Bacteria 1426
35 Ga0105238_10446436 3300009551 Bacteria 1290
36 Ga0105029_101762 3300009984 Bacteria 1369
37 Ga0163163_10081640 3300014325 Bacteria 3235
38 Ga0157380_10019607 3300014326 Bacteria 5041
39 Ga0157379_10007864 3300014968 Bacteria 9238
40 Ga0157379_10016237 3300014968 Bacteria 6552
41 Ga0157379_10060449 3300014968 Bacteria 3387
42 Ga0213872_10000615 3300021361 Bacteria 26974
43 Ga0213872_10007895 3300021361 Bacteria 5191
44 Ga0213874_10040882 3300021377 Bacteria 1386
45 Ga0209437_100275 3300025233 Bacteria 76419
46 Ga0207710_10000155 3300025900 Bacteria 73331
47 Ga0207647_10091935 3300025904 Bacteria 1809
48 Ga0207707_10130007 3300025912 Bacteria 2202
49 Ga0207695_10001636 3300025913 Bacteria 36191
50 Ga0207671_10224113 3300025914 Bacteria 1473
51 Ga0207660_10072606 3300025917 Bacteria 2506
52 Ga0207652_10051751 3300025921 Bacteria 3522
53 Ga0207652_10219418 3300025921 Bacteria 1713
54 Ga0207686_10052845 3300025934 Bacteria 2537
55 Ga0207709_10676116 3300025935 Bacteria 824
56 Ga0207711_10012974 3300025941 Bacteria 6922
57 Ga0207661_10154319 3300025944 Bacteria 1987
58 Ga0207679_10224622 3300025945 Bacteria 1582
59 Ga0207668_10483812 3300025972 Bacteria 1062
60 Ga0207658_10003008 3300025986 Bacteria 12058
61 Ga0207658_10052898 3300025986 Bacteria 2998
62 Ga0207703_10030058 3300026035 Bacteria 4291
63 Ga0207703_10033873 3300026035 Bacteria 4051
64 Ga0207703_10082278 3300026035 Bacteria 2686
65 Ga0207641_10002388 3300026088 Bacteria 17327
66 Ga0207676_10201735 3300026095 Bacteria 1758
67 Ga0207674_10017708 3300026116 Bacteria 7765
68 Ga0207674_10226097 3300026116 Bacteria 1819
69 Ga0207698_10034457 3300026142 Bacteria 3691
70 Ga0268264_10000114 3300028381 Bacteria 203211
71 Ga0268264_10013013 3300028381 Bacteria 6839
72 Ga0307515_10001186 3300028794 Bacteria 59639
73 Ga0307515_10113489 3300028794 Bacteria 3141
74 Ga0307513_10001922 3300031456 Bacteria 29483
75 Ga0307513_10121809 3300031456 Bacteria 2573
76 Ga0307513_10332895 3300031456 Bacteria 1272
77 Ga0307513_10376944 3300031456 Bacteria 1159
78 Ga0307408_100425723 3300031548 Bacteria 1146
79 Ga0307508_10055860 3300031616 Bacteria 3497
80 Ga0307508_10224877 3300031616 Bacteria 1476
81 Ga0307516_10001015 3300031730 Bacteria 38933
82 Ga0307406_10360976 3300031901 Bacteria 1139
83 Ga0307411_10032763 3300032005 Bacteria 3215
84 Ga0307415_100046889 3300032126 Bacteria 2906
85 Ga0307415_100092549 3300032126 Bacteria 2193
86 Ga0373956_0001711 3300035119 Bacteria 9046
87 Ga0436361_0558115 3300039447 Bacteria 3276
88 Ga0436361_0872724 3300039447 Bacteria 57229
89 Ga0436363_0148652 3300039450 Bacteria 1531
90 Ga0451791_0608697 3300041451 Bacteria 1338
91 Ga0451843_0654840 3300041509 Bacteria 1444
92 Ga0451853_0755571 3300041512 Bacteria 3625
93 Ga0466961_0003618 3300044693 Bacteria 9631
94 Ga0466961_0030576 3300044693 Bacteria 3461
95 Ga0466964_0015126 3300044706 Bacteria 2938
96 Ga0453684_0119009 3300044712 Bacteria 3193
97 Ga0466967_0011331 3300045976 Bacteria 6746
98 Ga0466967_0017332 3300045976 Bacteria 5714
99 Ga0466967_0054347 3300045976 Bacteria 3524
100 Ga0466967_0069624 3300045976 Bacteria 3145
101 Ga0466967_0347496 3300045976 Bacteria 1435
102 Ga0495668_0000171 3300046616 Bacteria 96971
103 Ga0495649_0240600 3300046694 Bacteria 932
104 Ga0496102_0375496 3300048905 Bacteria 1338
105 Ga0496108_0126487 3300048911 Bacteria 2194
106 Ga0496113_0136444 3300048916 Bacteria 1928
107 Ga0496118_0165109 3300048921 Bacteria 1362
108 Ga0496119_0000425 3300048922 Bacteria 58047
109 Ga0496120_0000563 3300048923 Bacteria 56530
110 Ga0496121_0002913 3300048924 Bacteria 25104
111 Ga0496121_0074535 3300048924 Bacteria 2714
112 Ga0496122_0000134 3300048925 Bacteria 171080
113 Ga0496123_0000307 3300048926 Bacteria 95174
114 Ga0496125_0028312 3300048928 Bacteria 5064
115 Ga0501031_0066928 3300049568 Bacteria 2341
116 Ga0501032_0000031 3300049569 Bacteria 130204
117 Ga0501033_0000305 3300049570 Bacteria 46466
118 Ga0501034_0000064 3300049571 Bacteria 189461
119 Ga0501036_0027818 3300049572 Bacteria 4779
120 Ga0501037_0000132 3300049573 Bacteria 69775
121 Ga0501038_0000055 3300049574 Bacteria 93761
122 Ga0501039_0000045 3300049575 Bacteria 104513
123 Ga0501043_0000015 3300049579 Bacteria 175932
124 Ga0501046_0020551 3300049580 Bacteria 5458
125 Ga0501047_0032373 3300049581 Bacteria 5047
126 Ga0501047_0069041 3300049581 Bacteria 3404
127 Ga0501035_0000105 3300049822 Bacteria 104877
128 Ga0501044_0008070 3300049823 Bacteria 11564
129 nmdc:mga07m45_61921_c1 3300050496 Bacteria 2120
130 nmdc:mga05p37_23250_c1 3300050507 Bacteria 7518
131 nmdc:mga09592_18035_c1 3300050508 Bacteria 5786
132 nmdc:mga0qj67_9476_c1 3300050509 Bacteria 7249
133 nmdc:mga06r32_161169_c1 3300050510 Bacteria 2226
134 Ga0500647_0182778 3300053091 Bacteria 961
135 Ga0500641_0089505 3300053096 Bacteria 1313
136 Ga0500604_0034010 3300053151 Bacteria 1510

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025904 Ga0207647_10091935 Ga0207647_100919352 202
2 3300009011 Ga0105251_10189691 Ga0105251_101896911 218
3 3300014326 Ga0157380_10019607 Ga0157380_100196073 228
4 3300007076 Ga0075435_100225777 Ga0075435_1002257772 231
5 3300026035 Ga0207703_10082278 Ga0207703_100822783 231
6 3300049581 Ga0501047_0032373 Ga0501047_0032373_1909_2664 232
7 3300025934 Ga0207686_10052845 Ga0207686_100528452 234
8 3300026095 Ga0207676_10201735 Ga0207676_102017352 234
9 3300031730 Ga0307516_10001015 Ga0307516_100010158 234
10 3300031616 Ga0307508_10055860 Ga0307508_100558603 238
11 3300025945 Ga0207679_10224622 Ga0207679_102246221 239
12 3300053096 Ga0500641_0089505 Ga0500641_0089505_258_1043 242
13 iso_pu_bacteria 2870782633 2870790776 243
14 iso_pu_bacteria 2891326441 2891329505 243
15 iso_pu_bacteria 2899359706 2899364471 243
16 iso_pu_bacteria 8055066027 8055072247 243
17 iso_pu_bacteria 2565956761 2566993389 245
18 iso_pu_bacteria 2738541308 2738890315 245
19 iso_pu_bacteria 2738543011 2739235283 245
20 iso_pu_bacteria 2795385472 2795792849 245
21 iso_pu_bacteria 2889300758 2889301721 245
22 iso_pu_bacteria 2904535858 2904539537 245
23 iso_pu_bacteria 2922554459 2922555383 245
24 iso_pu_bacteria 2928142448 2928144430 245
25 iso_pu_bacteria 2939743619 2939747282 245
26 3300005347 Ga0070668_100180751 Ga0070668_1001807512 246
27 3300009148 Ga0105243_10415678 Ga0105243_104156782 246
28 3300025935 Ga0207709_10676116 Ga0207709_106761161 246
29 3300025972 Ga0207668_10483812 Ga0207668_104838122 246
30 3300026116 Ga0207674_10017708 Ga0207674_100177084 246
31 3300031456 Ga0307513_10332895 Ga0307513_103328952 246
32 3300035119 Ga0373956_0001711 Ga0373956_0001711_7676_8416 246
33 3300045976 Ga0466967_0347496 Ga0466967_0347496_436_1176 246
34 3300048905 Ga0496102_0375496 Ga0496102_0375496_220_960 246
35 3300048916 Ga0496113_0136444 Ga0496113_0136444_505_1245 246
36 3300049581 Ga0501047_0069041 Ga0501047_0069041_2313_3053 246
37 iso_pu_bacteria 2517572101 2517761129 246
38 iso_pu_bacteria 8002784119 8002791220 246
39 3300005347 Ga0070668_100158531 Ga0070668_1001585311 247
40 3300005367 Ga0070667_100161815 Ga0070667_1001618152 247
41 3300005841 Ga0068863_100245220 Ga0068863_1002452202 247
42 3300014325 Ga0163163_10081640 Ga0163163_100816403 247
43 3300025986 Ga0207658_10052898 Ga0207658_100528983 247
44 3300026035 Ga0207703_10030058 Ga0207703_100300582 247
45 3300028381 Ga0268264_10013013 Ga0268264_100130132 247
46 3300028794 Ga0307515_10001186 Ga0307515_1000118645 247
47 3300028794 Ga0307515_10113489 Ga0307515_101134891 247
48 3300031456 Ga0307513_10121809 Ga0307513_101218093 247
49 3300031548 Ga0307408_100425723 Ga0307408_1004257232 247
50 3300031901 Ga0307406_10360976 Ga0307406_103609762 247
51 3300032126 Ga0307415_100046889 Ga0307415_1000468892 247
52 3300032126 Ga0307415_100092549 Ga0307415_1000925492 247
53 3300041451 Ga0451791_0608697 Ga0451791_0608697_445_1233 247
54 3300044693 Ga0466961_0030576 Ga0466961_0030576_2302_3045 247
55 3300044706 Ga0466964_0015126 Ga0466964_0015126_2146_2889 247
56 3300045976 Ga0466967_0011331 Ga0466967_0011331_5133_5876 247
57 3300045976 Ga0466967_0069624 Ga0466967_0069624_1856_2599 247
58 iso_pu_bacteria 2527291627 2528206266 247
59 iso_pu_bacteria 2527291629 2528214286 247
60 iso_pu_bacteria 2546825537 2546948291 247
61 iso_pu_bacteria 2576861822 2579749609 247
62 iso_pu_bacteria 2582580736 2583150294 247
63 iso_pu_bacteria 2684623036 2686544770 247
64 iso_pu_bacteria 2710264753 2710601876 247
65 iso_pu_bacteria 2773857924 2774863676 247
66 iso_pu_bacteria 637000116 637878860 247
67 3300005335 Ga0070666_10228676 Ga0070666_102286762 248
68 3300005355 Ga0070671_100199403 Ga0070671_1001994032 248
69 3300005367 Ga0070667_100002139 Ga0070667_1000021392 248
70 3300005548 Ga0070665_100001690 Ga0070665_10000169018 248
71 3300005841 Ga0068863_100000263 Ga0068863_10000026332 248
72 3300005842 Ga0068858_100025272 Ga0068858_1000252724 248
73 3300005843 Ga0068860_100000067 Ga0068860_100000067161 248
74 3300014968 Ga0157379_10007864 Ga0157379_100078645 248
75 3300025986 Ga0207658_10003008 Ga0207658_1000300811 248
76 3300026035 Ga0207703_10033873 Ga0207703_100338732 248
77 3300026088 Ga0207641_10002388 Ga0207641_100023886 248
78 3300028381 Ga0268264_10000114 Ga0268264_1000011418 248
79 3300032005 Ga0307411_10032763 Ga0307411_100327632 248
80 3300041509 Ga0451843_0654840 Ga0451843_0654840_657_1403 248
81 3300041512 Ga0451853_0755571 Ga0451853_0755571_2861_3607 248
82 3300045976 Ga0466967_0017332 Ga0466967_0017332_552_1298 248
83 3300005577 Ga0068857_100576841 Ga0068857_1005768412 249
84 3300006353 Ga0075370_10066558 Ga0075370_100665583 249
85 3300006844 Ga0075428_100010214 Ga0075428_1000102143 249
86 3300006846 Ga0075430_100010314 Ga0075430_1000103145 249
87 3300006847 Ga0075431_100004705 Ga0075431_1000047056 249
88 3300006880 Ga0075429_100015606 Ga0075429_1000156066 249
89 3300009147 Ga0114129_10004236 Ga0114129_1000423619 249
90 3300025921 Ga0207652_10219418 Ga0207652_102194182 249
91 3300026116 Ga0207674_10226097 Ga0207674_102260972 249
92 3300045976 Ga0466967_0054347 Ga0466967_0054347_1694_2443 249
93 3300046616 Ga0495668_0000171 Ga0495668_0000171_48890_49639 249
94 3300048911 Ga0496108_0126487 Ga0496108_0126487_1241_1990 249
95 3300048928 Ga0496125_0028312 Ga0496125_0028312_1283_2032 249
96 3300050496 nmdc:mga07m45_61921_c1 nmdc:mga07m45_61921_c1_765_1514 249
97 3300050507 nmdc:mga05p37_23250_c1 nmdc:mga05p37_23250_c1_2804_3595 249
98 3300050508 nmdc:mga09592_18035_c1 nmdc:mga09592_18035_c1_1645_2436 249
99 3300050509 nmdc:mga0qj67_9476_c1 nmdc:mga0qj67_9476_c1_3371_4162 249
100 3300050510 nmdc:mga06r32_161169_c1 nmdc:mga06r32_161169_c1_1411_2202 249
101 iso_pu_bacteria 2547132103 2547373929 249
102 iso_pu_bacteria 2548876994 2550695474 249
103 iso_pu_bacteria 2579778521 2579858152 249
104 iso_pu_bacteria 2582581305 2585259809 249
105 iso_pu_bacteria 2619618881 2619859078 249
106 iso_pu_bacteria 2619619003 2620354213 249
107 iso_pu_bacteria 2626541554 2626639156 249
108 iso_pu_bacteria 2751185725 2753034867 249
109 iso_pu_bacteria 2751185792 2753323384 249
110 iso_pu_bacteria 2818991445 2819591805 249
111 iso_pu_bacteria 2839993093 2839994723 249
112 iso_pu_bacteria 2843690924 2843693177 249
113 iso_pu_bacteria 2846033681 2846036800 249
114 iso_pu_bacteria 2873314349 2873317730 249
115 iso_pu_bacteria 2885266251 2885268356 249
116 iso_pu_bacteria 3006425503 3006426940 249
117 iso_pu_bacteria 8054913762 8054915296 249
118 iso_pu_bacteria 8054920844 8054925376 249
119 3300046694 Ga0495649_0240600 Ga0495649_0240600_57_809 250
120 iso_pu_bacteria 2791354901 2791910338 250
121 3300005336 Ga0070680_100238048 Ga0070680_1002380482 252
122 3300005458 Ga0070681_10006541 Ga0070681_100065416 252
123 3300005844 Ga0068862_100335672 Ga0068862_1003356722 252
124 3300009101 Ga0105247_10049034 Ga0105247_100490343 252
125 3300009551 Ga0105238_10446436 Ga0105238_104464362 252
126 3300014968 Ga0157379_10060449 Ga0157379_100604492 252
127 3300025912 Ga0207707_10130007 Ga0207707_101300073 252
128 3300025917 Ga0207660_10072606 Ga0207660_100726062 252
129 3300025921 Ga0207652_10051751 Ga0207652_100517514 252
130 3300031456 Ga0307513_10376944 Ga0307513_103769442 252
131 3300053151 Ga0500604_0034010 Ga0500604_0034010_612_1373 252
132 3300003203 JGI25406J46586_10015670 JGI25406J46586_100156703 253
133 3300005985 Ga0081539_10000079 Ga0081539_10000079159 253
134 3300006028 Ga0070717_10565711 Ga0070717_105657112 253
135 3300006931 Ga0097620_100824806 Ga0097620_1008248062 253
136 3300009093 Ga0105240_10001798 Ga0105240_1000179812 253
137 3300009101 Ga0105247_10000127 Ga0105247_1000012718 253
138 3300009177 Ga0105248_10006801 Ga0105248_100068016 253
139 3300009545 Ga0105237_10399144 Ga0105237_103991442 253
140 3300009551 Ga0105238_10368695 Ga0105238_103686952 253
141 3300009984 Ga0105029_101762 Ga0105029_1017622 253
142 3300014968 Ga0157379_10016237 Ga0157379_100162373 253
143 3300021361 Ga0213872_10000615 Ga0213872_1000061510 253
144 3300021361 Ga0213872_10007895 Ga0213872_100078952 253
145 3300021377 Ga0213874_10040882 Ga0213874_100408822 253
146 3300025233 Ga0209437_100275 Ga0209437_10027573 253
147 3300025900 Ga0207710_10000155 Ga0207710_1000015517 253
148 3300025913 Ga0207695_10001636 Ga0207695_1000163612 253
149 3300025914 Ga0207671_10224113 Ga0207671_102241132 253
150 3300025941 Ga0207711_10012974 Ga0207711_100129746 253
151 3300025944 Ga0207661_10154319 Ga0207661_101543192 253
152 3300026142 Ga0207698_10034457 Ga0207698_100344572 253
153 3300031456 Ga0307513_10001922 Ga0307513_1000192216 253
154 3300031616 Ga0307508_10224877 Ga0307508_102248772 253
155 3300039447 Ga0436361_0558115 Ga0436361_0558115_1784_2611 253
156 3300039447 Ga0436361_0872724 Ga0436361_0872724_20492_21289 253
157 3300039450 Ga0436363_0148652 Ga0436363_0148652_81_845 253
158 3300044693 Ga0466961_0003618 Ga0466961_0003618_696_1472 253
159 3300044712 Ga0453684_0119009 Ga0453684_0119009_1391_2158 253
160 3300048921 Ga0496118_0165109 Ga0496118_0165109_111_932 253
161 3300048922 Ga0496119_0000425 Ga0496119_0000425_4091_4891 253
162 3300048923 Ga0496120_0000563 Ga0496120_0000563_28907_29707 253
163 3300048924 Ga0496121_0002913 Ga0496121_0002913_16973_17794 253
164 3300048924 Ga0496121_0074535 Ga0496121_0074535_1561_2382 253
165 3300048925 Ga0496122_0000134 Ga0496122_0000134_112839_113660 253
166 3300048926 Ga0496123_0000307 Ga0496123_0000307_38544_39365 253
167 3300049568 Ga0501031_0066928 Ga0501031_0066928_75_839 253
168 3300049569 Ga0501032_0000031 Ga0501032_0000031_104129_104893 253
169 3300049570 Ga0501033_0000305 Ga0501033_0000305_11776_12540 253
170 3300049571 Ga0501034_0000064 Ga0501034_0000064_84569_85333 253
171 3300049572 Ga0501036_0027818 Ga0501036_0027818_3760_4524 253
172 3300049573 Ga0501037_0000132 Ga0501037_0000132_20439_21203 253
173 3300049574 Ga0501038_0000055 Ga0501038_0000055_50003_50767 253
174 3300049575 Ga0501039_0000045 Ga0501039_0000045_77000_77764 253
175 3300049579 Ga0501043_0000015 Ga0501043_0000015_123850_124614 253
176 3300049580 Ga0501046_0020551 Ga0501046_0020551_3897_4661 253
177 3300049822 Ga0501035_0000105 Ga0501035_0000105_19562_20326 253
178 3300049823 Ga0501044_0008070 Ga0501044_0008070_5396_6160 253
179 3300053091 Ga0500647_0182778 Ga0500647_0182778_63_827 253
180 iso_pu_bacteria 2846037992 2846041447 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

1

205

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cbf-assembly1.cif.gz_A the x-ray structure of a cobalamin biosynthetic enzyme, cobalt precorrin-4 methyltransferase, cbif 0.9627 2 229
3ndc-assembly1.cif.gz_B crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus 0.9623 1 237
3ndc-assembly1.cif.gz_B crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus 0.9583 1 237
3ndc-assembly1.cif.gz_A crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus 0.9526 2 234
3nei-assembly1.cif.gz_A crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus (no sah bound) 0.942 1 231
ID Description Score Start End Superfamily
af_P9WGB1_111_234_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9889 111 233 3.30.950.10
af_P9WGB1_111_234_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9732 111 233 3.30.950.10
3neiB01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9652 1 110 3.40.1010.10
3neiB01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9567 1 110 3.40.1010.10
4e16A01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9442 2 110 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A5M3XA37-F1-model_v4 Precorrin-4 C(11)-methyltransferase 0.9855 1 246 GO:0009236
GO:0032259
GO:0046026
AF-A0A1J0UGS9-F1-model_v4 deleted 0.9846 1 246
AF-A0A5N0IAC7-F1-model_v4 Precorrin-4 C(11)-methyltransferase (EC 2.1.1.133) 0.9839 1 246 GO:0009236
GO:0032259
GO:0046026
AF-A0A1A3GMS8-F1-model_v4 Precorrin-4 C(11)-methyltransferase 0.9838 1 246 GO:0009236
GO:0032259
GO:0046026
AF-A0A391PC72-F1-model_v4 Precorrin-4 C(11)-methyltransferase 0.9827 1 246 GO:0009236
GO:0032259
GO:0046026

Feature Viewer

pLDDT pTM Quality
90.98 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map