F276417

General Info

Members Datasets Scaffolds Average Seq Length
180 122 180 115

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_009848|Ga0500595_009848_2572_2976
Length 134
Sequence VGVTPVAASSSSVTVDRTLAALADPHRRQVINLLRERPRPAGELAREIGLAPPAMSRHLRTLRQSGLVEESHPAFDARVRVYALRPEPMIELLRWLEETERLWTAQLAAFRHHLLKDRPAPTPPSPPTKRTPKR

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
50 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
95 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
101 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
116 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
117 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
118 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
119 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
120 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
121 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
122 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.11
Nodule 0
Rhizoplane 2.22
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 1.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10023107 3300003215 Bacteria 2274
2 Ga0065165_1153011 3300005262 Bacteria 537
3 Ga0070658_10194930 3300005327 Bacteria 1708
4 Ga0070658_10363061 3300005327 Bacteria 1241
5 Ga0070658_10726373 3300005327 Bacteria 862
6 Ga0070683_100857209 3300005329 Bacteria 871
7 Ga0070680_100029429 3300005336 Bacteria 4412
8 Ga0070660_100862979 3300005339 Bacteria 762
9 Ga0070691_10008779 3300005341 Bacteria 4627
10 Ga0070668_100011861 3300005347 Bacteria 6492
11 Ga0070668_100043015 3300005347 Bacteria 3463
12 Ga0070671_101743024 3300005355 Bacteria 553
13 Ga0070659_100007132 3300005366 Bacteria 8108
14 Ga0070713_100098876 3300005436 Bacteria 2524
15 Ga0070710_10774234 3300005437 Bacteria 683
16 Ga0070711_100134631 3300005439 Bacteria 1845
17 Ga0070705_101756765 3300005440 Bacteria 525
18 Ga0070681_10014751 3300005458 Bacteria 7769
19 Ga0070681_10923141 3300005458 Bacteria 792
20 Ga0070681_10955450 3300005458 Bacteria 776
21 Ga0070706_100172562 3300005467 Bacteria 2019
22 Ga0070707_100866909 3300005468 Bacteria 867
23 Ga0070698_100087685 3300005471 Bacteria 3098
24 Ga0070699_100231115 3300005518 Bacteria 1649
25 Ga0070679_100014413 3300005530 Bacteria 7593
26 Ga0070679_100208109 3300005530 Bacteria 1920
27 Ga0070679_100261955 3300005530 Bacteria 1684
28 Ga0070679_101433032 3300005530 Unclassified 637
29 Ga0070684_101137454 3300005535 Bacteria 734
30 Ga0070697_100710026 3300005536 Bacteria 887
31 Ga0068853_100268203 3300005539 Bacteria 1571
32 Ga0068853_100489140 3300005539 Bacteria 1161
33 Ga0068853_101867093 3300005539 Bacteria 582
34 Ga0070665_100094917 3300005548 Bacteria 2987
35 Ga0068855_100147393 3300005563 Bacteria 2678
36 Ga0068855_100773756 3300005563 Bacteria 1022
37 Ga0068857_100250768 3300005577 Bacteria 1623
38 Ga0068857_101740684 3300005577 Bacteria 610
39 Ga0068854_100680406 3300005578 Bacteria 886
40 Ga0068856_100163288 3300005614 Bacteria 2239
41 Ga0068856_101133778 3300005614 Bacteria 799
42 Ga0068859_100290563 3300005617 Bacteria 1728
43 Ga0068864_100239062 3300005618 Bacteria 1682
44 Ga0068863_100219776 3300005841 Unclassified 1830
45 Ga0068863_100693664 3300005841 Bacteria 1012
46 Ga0068860_100000318 3300005843 Bacteria 65549
47 Ga0068860_100878318 3300005843 Bacteria 912
48 Ga0068862_100001932 3300005844 Bacteria 18805
49 Ga0068862_100061066 3300005844 Bacteria 3239
50 Ga0070715_10092532 3300006163 Bacteria 1394
51 Ga0075369_10005492 3300006186 Bacteria 4739
52 Ga0097620_100290570 3300006931 Bacteria 1728
53 Ga0105240_10166085 3300009093 Bacteria 2618
54 Ga0105240_10398754 3300009093 Bacteria 1550
55 Ga0105240_10682349 3300009093 Bacteria 1123
56 Ga0105240_11161287 3300009093 Bacteria 819
57 Ga0111539_11069799 3300009094 Bacteria 937
58 Ga0111539_13002970 3300009094 Unclassified 545
59 Ga0105248_11992892 3300009177 Bacteria 660
60 Ga0105238_10014386 3300009551 Bacteria 7997
61 Ga0105238_10790547 3300009551 Bacteria 964
62 Ga0105249_10333754 3300009553 Bacteria 1531
63 Ga0105246_12358929 3300011119 Bacteria 521
64 Ga0157370_10021218 3300013104 Bacteria 6474
65 Ga0157370_10197201 3300013104 Bacteria 1868
66 Ga0157369_11540797 3300013105 Bacteria 676
67 Ga0157372_12452129 3300013307 Bacteria 599
68 Ga0163163_10087715 3300014325 Bacteria 3122
69 Ga0163163_10351214 3300014325 Bacteria 1531
70 Ga0163163_10420756 3300014325 Bacteria 1395
71 Ga0163163_10451513 3300014325 Bacteria 1346
72 Ga0163163_10578801 3300014325 Bacteria 1186
73 Ga0163163_10763788 3300014325 Bacteria 1030
74 Ga0163163_12977424 3300014325 Bacteria 528
75 Ga0213873_10044423 3300021358 Bacteria 1156
76 Ga0213872_10016043 3300021361 Bacteria 3479
77 Ga0213872_10207153 3300021361 Bacteria 839
78 Ga0213871_10057033 3300021441 Bacteria 1081
79 Ga0207685_10116239 3300025905 Bacteria 1167
80 Ga0207705_10045034 3300025909 Bacteria 3171
81 Ga0207705_10559407 3300025909 Bacteria 889
82 Ga0207684_10077537 3300025910 Bacteria 2826
83 Ga0207654_10247391 3300025911 Bacteria 1194
84 Ga0207707_10443693 3300025912 Bacteria 1111
85 Ga0207707_11329512 3300025912 Bacteria 576
86 Ga0207695_10000575 3300025913 Bacteria 74997
87 Ga0207695_10002640 3300025913 Bacteria 26217
88 Ga0207695_10317507 3300025913 Bacteria 1447
89 Ga0207693_10531207 3300025915 Bacteria 918
90 Ga0207660_10000537 3300025917 Bacteria 25426
91 Ga0207660_10542893 3300025917 Bacteria 945
92 Ga0207657_10006388 3300025919 Bacteria 12240
93 Ga0207657_10119001 3300025919 Bacteria 2174
94 Ga0207652_10059896 3300025921 Bacteria 3283
95 Ga0207652_10207477 3300025921 Bacteria 1764
96 Ga0207646_10362838 3300025922 Bacteria 1309
97 Ga0207681_10199226 3300025923 Bacteria 1536
98 Ga0207694_10036638 3300025924 Bacteria 3765
99 Ga0207694_10360836 3300025924 Bacteria 1204
100 Ga0207700_10088735 3300025928 Bacteria 2435
101 Ga0207690_10087949 3300025932 Bacteria 2187
102 Ga0207690_10193650 3300025932 Bacteria 1539
103 Ga0207711_10237448 3300025941 Bacteria 1671
104 Ga0207711_11551617 3300025941 Bacteria 605
105 Ga0207667_10041405 3300025949 Bacteria 4899
106 Ga0207667_10090272 3300025949 Bacteria 3167
107 Ga0207668_10006361 3300025972 Bacteria 6984
108 Ga0207668_10022818 3300025972 Bacteria 4011
109 Ga0207658_10092484 3300025986 Bacteria 2350
110 Ga0207639_10040401 3300026041 Bacteria 3481
111 Ga0207639_10199779 3300026041 Bacteria 1714
112 Ga0207708_11305497 3300026075 Bacteria 636
113 Ga0207702_10315974 3300026078 Bacteria 1486
114 Ga0207702_10994224 3300026078 Bacteria 832
115 Ga0207641_12197163 3300026088 Bacteria 552
116 Ga0207676_10164659 3300026095 Bacteria 1925
117 Ga0207674_10289306 3300026116 Bacteria 1587
118 Ga0207674_10714623 3300026116 Bacteria 967
119 Ga0268266_10055599 3300028379 Bacteria 3403
120 Ga0268265_10007087 3300028380 Bacteria 7575
121 Ga0268265_10014592 3300028380 Bacteria 5356
122 Ga0268264_10000376 3300028381 Bacteria 65554
123 Ga0268264_10783196 3300028381 Bacteria 952
124 Ga0265319_1238336 3300028563 Bacteria 555
125 Ga0265334_10069528 3300028573 Bacteria 1314
126 Ga0265338_10055285 3300028800 Bacteria 3532
127 Ga0265338_10813827 3300028800 Bacteria 640
128 Ga0265327_10000381 3300031251 Bacteria 83617
129 Ga0265327_10042745 3300031251 Bacteria 2430
130 Ga0307513_10000162 3300031456 Bacteria 96000
131 Ga0265314_10669920 3300031711 Bacteria 527
132 Ga0373941_0354197 3300035115 Bacteria 598
133 Ga0373931_0234396 3300035691 Bacteria 1110
134 Ga0373931_0292160 3300035691 Bacteria 1004
135 Ga0395899_0210618 3300037312 Bacteria 1351
136 Ga0395899_0985789 3300037312 Unclassified 509
137 Ga0395900_0177633 3300037418 Bacteria 2165
138 Ga0395898_0072857 3300037466 Bacteria 3318
139 Ga0395905_0004157 3300037471 Bacteria 15144
140 Ga0395905_0742013 3300037471 Bacteria 884
141 Ga0395905_1390786 3300037471 Bacteria 606
142 Ga0237819_00703 3300038705 Bacteria 10868
143 Ga0436360_0005860 3300039438 Bacteria 3289
144 Ga0436360_0121263 3300039438 Bacteria 771
145 Ga0436361_0815232 3300039447 Bacteria 511
146 Ga0436361_0907410 3300039447 Bacteria 1973
147 Ga0436361_1105872 3300039447 Unclassified 839
148 Ga0436361_1210990 3300039447 Bacteria 2145
149 Ga0436362_0193981 3300039453 Bacteria 565
150 Ga0436362_0235225 3300039453 Bacteria 1219
151 Ga0451791_1383939 3300041451 Bacteria 721
152 Ga0439432_138300 3300042006 Unclassified 717
153 Ga0453684_0548771 3300044712 Bacteria 1273
154 Ga0466957_0132424 3300044842 Bacteria 1599
155 Ga0466959_0299165 3300045049 Bacteria 1102
156 Ga0451576_1882504 3300045051 Bacteria 617
157 Ga0495650_0326371 3300046471 Unclassified 510
158 Ga0495585_0259162 3300046492 Bacteria 865
159 Ga0495583_0433566 3300046506 Bacteria 515
160 Ga0495581_0748840 3300047315 Bacteria 562
161 Ga0495673_0003560 3300047469 Bacteria 10248
162 Ga0495686_0007217 3300047472 Bacteria 8368
163 Ga0496100_0555221 3300048903 Bacteria 889
164 Ga0496115_0135312 3300048918 Bacteria 2032
165 Ga0496115_0473316 3300048918 Bacteria 1009
166 Ga0496124_0007944 3300048927 Bacteria 11165
167 Ga0501033_0842962 3300049570 Bacteria 618
168 Ga0501039_0611444 3300049575 Bacteria 854
169 Ga0501046_0774512 3300049580 Unclassified 673
170 Ga0501047_0376627 3300049581 Bacteria 1254
171 Ga0501081_0574976 3300049743 Unclassified 843
172 nmdc:mga00v17_513547_c1 3300050491 Bacteria 776
173 nmdc:mga0sz30_2808_c1 3300050516 Bacteria 5771
174 Ga0500644_0000193 3300053088 Bacteria 37831
175 Ga0500646_0074717 3300053090 Bacteria 1023
176 Ga0500641_0380024 3300053096 Bacteria 560
177 Ga0500555_001421 3300053103 Bacteria 7364
178 Ga0500595_009848 3300053119 Bacteria 3835
179 Ga0500564_000135 3300053138 Bacteria 19069
180 Ga0530510_0220206 3300061734 Unclassified 1411

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005578 Ga0068854_100680406 Ga0068854_1006804062 106
2 3300049575 Ga0501039_0611444 Ga0501039_0611444_413_745 106
3 3300014325 Ga0163163_10578801 Ga0163163_105788012 107
4 3300005262 Ga0065165_1153011 Ga0065165_11530111 108
5 3300005327 Ga0070658_10194930 Ga0070658_101949302 108
6 3300005843 Ga0068860_100000318 Ga0068860_10000031869 108
7 3300006186 Ga0075369_10005492 Ga0075369_100054923 108
8 3300009551 Ga0105238_10790547 Ga0105238_107905472 108
9 3300026075 Ga0207708_11305497 Ga0207708_113054972 108
10 3300028381 Ga0268264_10000376 Ga0268264_1000037667 108
11 3300031251 Ga0265327_10000381 Ga0265327_1000038149 108
12 3300031456 Ga0307513_10000162 Ga0307513_1000016231 108
13 3300041451 Ga0451791_1383939 Ga0451791_1383939_21_347 108
14 3300047469 Ga0495673_0003560 Ga0495673_0003560_5897_6223 108
15 3300048918 Ga0496115_0473316 Ga0496115_0473316_466_801 108
16 3300048927 Ga0496124_0007944 Ga0496124_0007944_829_1158 108
17 3300050516 nmdc:mga0sz30_2808_c1 nmdc:mga0sz30_2808_c1_3366_3695 108
18 3300053088 Ga0500644_0000193 Ga0500644_0000193_32784_33110 108
19 3300053138 Ga0500564_000135 Ga0500564_000135_7002_7328 108
20 3300005347 Ga0070668_100011861 Ga0070668_1000118613 109
21 3300005440 Ga0070705_101756765 Ga0070705_1017567652 109
22 3300005841 Ga0068863_100219776 Ga0068863_1002197762 109
23 3300005843 Ga0068860_100878318 Ga0068860_1008783182 109
24 3300013105 Ga0157369_11540797 Ga0157369_115407972 109
25 3300021358 Ga0213873_10044423 Ga0213873_100444234 109
26 3300021361 Ga0213872_10207153 Ga0213872_102071532 109
27 3300028381 Ga0268264_10783196 Ga0268264_107831962 109
28 3300031251 Ga0265327_10042745 Ga0265327_100427453 109
29 3300035115 Ga0373941_0354197 Ga0373941_0354197_85_414 109
30 3300035691 Ga0373931_0234396 Ga0373931_0234396_129_458 109
31 3300037312 Ga0395899_0985789 Ga0395899_0985789_83_412 109
32 3300037471 Ga0395905_0004157 Ga0395905_0004157_9612_9941 109
33 3300037471 Ga0395905_0742013 Ga0395905_0742013_362_691 109
34 3300039447 Ga0436361_0907410 Ga0436361_0907410_1572_1901 109
35 3300039447 Ga0436361_1105872 Ga0436361_1105872_439_768 109
36 3300039453 Ga0436362_0193981 Ga0436362_0193981_142_471 109
37 3300039453 Ga0436362_0235225 Ga0436362_0235225_561_890 109
38 3300045051 Ga0451576_1882504 Ga0451576_1882504_277_606 109
39 3300047472 Ga0495686_0007217 Ga0495686_0007217_3969_4298 109
40 3300049580 Ga0501046_0774512 Ga0501046_0774512_11_343 109
41 3300049743 Ga0501081_0574976 Ga0501081_0574976_101_433 109
42 3300053096 Ga0500641_0380024 Ga0500641_0380024_88_417 109
43 3300005329 Ga0070683_100857209 Ga0070683_1008572092 110
44 3300005436 Ga0070713_100098876 Ga0070713_1000988762 110
45 3300005437 Ga0070710_10774234 Ga0070710_107742341 110
46 3300005439 Ga0070711_100134631 Ga0070711_1001346313 110
47 3300005458 Ga0070681_10955450 Ga0070681_109554502 110
48 3300005467 Ga0070706_100172562 Ga0070706_1001725623 110
49 3300005468 Ga0070707_100866909 Ga0070707_1008669092 110
50 3300005471 Ga0070698_100087685 Ga0070698_1000876854 110
51 3300005518 Ga0070699_100231115 Ga0070699_1002311153 110
52 3300005536 Ga0070697_100710026 Ga0070697_1007100261 110
53 3300005618 Ga0068864_100239062 Ga0068864_1002390622 110
54 3300006163 Ga0070715_10092532 Ga0070715_100925323 110
55 3300013104 Ga0157370_10021218 Ga0157370_100212184 110
56 3300014325 Ga0163163_10451513 Ga0163163_104515132 110
57 3300021361 Ga0213872_10016043 Ga0213872_100160434 110
58 3300021441 Ga0213871_10057033 Ga0213871_100570332 110
59 3300025905 Ga0207685_10116239 Ga0207685_101162392 110
60 3300025910 Ga0207684_10077537 Ga0207684_100775373 110
61 3300025915 Ga0207693_10531207 Ga0207693_105312071 110
62 3300025922 Ga0207646_10362838 Ga0207646_103628382 110
63 3300025924 Ga0207694_10036638 Ga0207694_100366383 110
64 3300025928 Ga0207700_10088735 Ga0207700_100887352 110
65 3300025941 Ga0207711_11551617 Ga0207711_115516172 110
66 3300026088 Ga0207641_12197163 Ga0207641_121971632 110
67 3300026095 Ga0207676_10164659 Ga0207676_101646593 110
68 3300035691 Ga0373931_0292160 Ga0373931_0292160_528_860 110
69 3300039438 Ga0436360_0005860 Ga0436360_0005860_1825_2160 110
70 3300039438 Ga0436360_0121263 Ga0436360_0121263_373_705 110
71 3300039447 Ga0436361_0815232 Ga0436361_0815232_69_407 110
72 3300039447 Ga0436361_1210990 Ga0436361_1210990_1208_1546 110
73 3300044842 Ga0466957_0132424 Ga0466957_0132424_551_883 110
74 3300045049 Ga0466959_0299165 Ga0466959_0299165_535_867 110
75 3300046506 Ga0495583_0433566 Ga0495583_0433566_109_441 110
76 3300047315 Ga0495581_0748840 Ga0495581_0748840_100_432 110
77 3300049570 Ga0501033_0842962 Ga0501033_0842962_262_594 110
78 3300049581 Ga0501047_0376627 Ga0501047_0376627_554_886 110
79 3300061734 Ga0530510_0220206 Ga0530510_0220206_1016_1348 110
80 3300005458 Ga0070681_10923141 Ga0070681_109231412 111
81 3300005530 Ga0070679_100261955 Ga0070679_1002619553 111
82 3300005530 Ga0070679_101433032 Ga0070679_1014330322 111
83 3300005563 Ga0068855_100773756 Ga0068855_1007737562 111
84 3300005614 Ga0068856_100163288 Ga0068856_1001632883 111
85 3300005614 Ga0068856_101133778 Ga0068856_1011337781 111
86 3300009094 Ga0111539_13002970 Ga0111539_130029702 111
87 3300025912 Ga0207707_10443693 Ga0207707_104436932 111
88 3300025921 Ga0207652_10207477 Ga0207652_102074772 111
89 3300026078 Ga0207702_10315974 Ga0207702_103159743 111
90 3300026078 Ga0207702_10994224 Ga0207702_109942242 111
91 3300028563 Ga0265319_1238336 Ga0265319_12383361 111
92 3300028800 Ga0265338_10055285 Ga0265338_100552854 111
93 3300031711 Ga0265314_10669920 Ga0265314_106699202 111
94 3300037312 Ga0395899_0210618 Ga0395899_0210618_430_765 111
95 3300037418 Ga0395900_0177633 Ga0395900_0177633_1257_1592 111
96 3300037471 Ga0395905_1390786 Ga0395905_1390786_181_516 111
97 3300048903 Ga0496100_0555221 Ga0496100_0555221_97_468 111
98 3300050491 nmdc:mga00v17_513547_c1 nmdc:mga00v17_513547_c1_219_599 111
99 3300005327 Ga0070658_10363061 Ga0070658_103630611 112
100 3300005355 Ga0070671_101743024 Ga0070671_1017430242 112
101 3300005577 Ga0068857_101740684 Ga0068857_1017406842 112
102 3300005841 Ga0068863_100693664 Ga0068863_1006936641 112
103 3300009094 Ga0111539_11069799 Ga0111539_110697992 112
104 3300009177 Ga0105248_11992892 Ga0105248_119928922 112
105 3300009553 Ga0105249_10333754 Ga0105249_103337543 112
106 3300014325 Ga0163163_10087715 Ga0163163_100877154 112
107 3300014325 Ga0163163_10420756 Ga0163163_104207562 112
108 3300014325 Ga0163163_10763788 Ga0163163_107637882 112
109 3300014325 Ga0163163_12977424 Ga0163163_129774242 112
110 3300025909 Ga0207705_10559407 Ga0207705_105594072 112
111 3300025932 Ga0207690_10193650 Ga0207690_101936503 112
112 3300026116 Ga0207674_10289306 Ga0207674_102893064 112
113 3300028573 Ga0265334_10069528 Ga0265334_100695282 112
114 3300028800 Ga0265338_10813827 Ga0265338_108138271 112
115 3300042006 Ga0439432_138300 Ga0439432_138300_355_693 112
116 3300044712 Ga0453684_0548771 Ga0453684_0548771_370_708 112
117 3300046471 Ga0495650_0326371 Ga0495650_0326371_52_390 112
118 3300046492 Ga0495585_0259162 Ga0495585_0259162_171_521 112
119 3300053090 Ga0500646_0074717 Ga0500646_0074717_362_715 112
120 3300053103 Ga0500555_001421 Ga0500555_001421_1288_1641 112
121 3300005341 Ga0070691_10008779 Ga0070691_100087792 113
122 3300005530 Ga0070679_100208109 Ga0070679_1002081093 113
123 3300005535 Ga0070684_101137454 Ga0070684_1011374542 113
124 3300005539 Ga0068853_100489140 Ga0068853_1004891403 113
125 3300005617 Ga0068859_100290563 Ga0068859_1002905632 113
126 3300006931 Ga0097620_100290570 Ga0097620_1002905703 113
127 3300009093 Ga0105240_10166085 Ga0105240_101660854 113
128 3300009093 Ga0105240_10398754 Ga0105240_103987541 113
129 3300009093 Ga0105240_10682349 Ga0105240_106823491 113
130 3300013104 Ga0157370_10197201 Ga0157370_101972013 113
131 3300013307 Ga0157372_12452129 Ga0157372_124521292 113
132 3300025911 Ga0207654_10247391 Ga0207654_102473912 113
133 3300025912 Ga0207707_11329512 Ga0207707_113295121 113
134 3300025913 Ga0207695_10000575 Ga0207695_1000057544 113
135 3300025917 Ga0207660_10542893 Ga0207660_105428932 113
136 3300025924 Ga0207694_10360836 Ga0207694_103608362 113
137 3300025949 Ga0207667_10041405 Ga0207667_100414055 113
138 3300037466 Ga0395898_0072857 Ga0395898_0072857_1618_1959 113
139 3300005347 Ga0070668_100043015 Ga0070668_1000430151 114
140 3300005548 Ga0070665_100094917 Ga0070665_1000949175 114
141 3300005844 Ga0068862_100061066 Ga0068862_1000610664 114
142 3300025972 Ga0207668_10022818 Ga0207668_100228184 114
143 3300028379 Ga0268266_10055599 Ga0268266_100555995 114
144 3300028380 Ga0268265_10007087 Ga0268265_100070874 114
145 3300003215 JGI25153J46596_10023107 JGI25153J46596_100231072 115
146 3300005327 Ga0070658_10726373 Ga0070658_107263732 115
147 3300005336 Ga0070680_100029429 Ga0070680_1000294294 115
148 3300005339 Ga0070660_100862979 Ga0070660_1008629792 115
149 3300005366 Ga0070659_100007132 Ga0070659_1000071328 115
150 3300005458 Ga0070681_10014751 Ga0070681_100147515 115
151 3300005530 Ga0070679_100014413 Ga0070679_10001441310 115
152 3300005539 Ga0068853_100268203 Ga0068853_1002682033 115
153 3300005539 Ga0068853_101867093 Ga0068853_1018670931 115
154 3300005563 Ga0068855_100147393 Ga0068855_1001473934 115
155 3300005577 Ga0068857_100250768 Ga0068857_1002507683 115
156 3300005844 Ga0068862_100001932 Ga0068862_10000193210 115
157 3300009093 Ga0105240_11161287 Ga0105240_111612872 115
158 3300009551 Ga0105238_10014386 Ga0105238_100143864 115
159 3300011119 Ga0105246_12358929 Ga0105246_123589291 115
160 3300014325 Ga0163163_10351214 Ga0163163_103512143 115
161 3300025909 Ga0207705_10045034 Ga0207705_100450344 115
162 3300025913 Ga0207695_10002640 Ga0207695_1000264024 115
163 3300025913 Ga0207695_10317507 Ga0207695_103175072 115
164 3300025917 Ga0207660_10000537 Ga0207660_1000053739 115
165 3300025919 Ga0207657_10006388 Ga0207657_100063887 115
166 3300025919 Ga0207657_10119001 Ga0207657_101190013 115
167 3300025921 Ga0207652_10059896 Ga0207652_100598962 115
168 3300025923 Ga0207681_10199226 Ga0207681_101992262 115
169 3300025932 Ga0207690_10087949 Ga0207690_100879494 115
170 3300025941 Ga0207711_10237448 Ga0207711_102374483 115
171 3300025949 Ga0207667_10090272 Ga0207667_100902724 115
172 3300025972 Ga0207668_10006361 Ga0207668_100063616 115
173 3300025986 Ga0207658_10092484 Ga0207658_100924843 115
174 3300026041 Ga0207639_10040401 Ga0207639_100404014 115
175 3300026041 Ga0207639_10199779 Ga0207639_101997793 115
176 3300026116 Ga0207674_10714623 Ga0207674_107146232 115
177 3300028380 Ga0268265_10014592 Ga0268265_100145923 115
178 3300038705 Ga0237819_00703 Ga0237819_00703_723_1106 115
179 3300048918 Ga0496115_0135312 Ga0496115_0135312_558_944 115
180 3300053119 Ga0500595_009848 Ga0500595_009848_2572_2976 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

24

70

0.98

PF12840

HTH_20

Helix-turn-helix domain

22

71

0.98

PF09339

HTH_IclR

IclR helix-turn-helix domain

29

72

0.95

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

24

69

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b1v-assembly1.cif.gz_A dtxr-like iron-dependent regulator ider complexed with cobalt 0.9737 37 65
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9277 11 98
2oqg-assembly1.cif.gz_B arsr-like transcriptional regulator from rhodococcus sp. rha1 0.9202 10 113
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.9175 9 98
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9016 8 94
ID Description Score Start End Superfamily
af_P0ACM9_1_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9315 37 67 1.10.10.10
4p96A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9277 37 64 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9277 11 98 1.10.10.10
2oqgA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9165 10 110 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9157 18 80 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1H1RYX0-F1-model_v4 DNA-binding transcriptional regulator, ArsR family 0.951 6 111 GO:0003677
GO:0003700
AF-E1RD06-F1-model_v4 Transcriptional regulator, ArsR family 0.9224 14 81 GO:0003700
GO:0016020
AF-A0A3D3FUB7-F1-model_v4 HTH arsR-type domain-containing protein 0.9215 10 86 GO:0003700
AF-A0A847K5K4-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9158 12 94 GO:0003700
AF-A0A3M1J2V1-F1-model_v4 Transcriptional regulator 0.9113 10 94 GO:0003700

Feature Viewer

pLDDT pTM Quality
90.11 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map