F276045

General Info

Members Datasets Scaffolds Average Seq Length
180 146 360 155

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0009960|Ga0466969_0009960_3123_3638
Length 171
Sequence MPKKIDLNAASTVTGSRYPSPYDEPCAGRFRRVLGDMAGLTQFGVNLTRLPPGCWSSQRHWHTAEDEFVFIVEGEVVLVTDSGEELLRAGDCAGFKAGAADGHHLQNRSDKDALVLEIGTRQPHEDEVLYPDIDLRIPKGRAGYVHNNGEPYADSRPRNPAAGSGRPSHAK

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
41 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
42 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
73 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
82 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
83 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
84 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
85 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
141 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
142 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
146 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5
Nodule 0.56
Rhizoplane 0.56
Rhizosphere 87.22
Stem 0
Stem Tuber 0
Unclassified 5.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0009960 3300044656 Bacteria 5040
2 rootL2_10157742 3300003322 Bacteria 1683
3 Ga0065704_10001648 3300005289 Bacteria 7326
4 Ga0070690_100990853 3300005330 Bacteria 662
5 Ga0070670_100022479 3300005331 Bacteria 5427
6 Ga0070670_101033622 3300005331 Bacteria 748
7 Ga0070680_100152810 3300005336 Bacteria 1938
8 Ga0070660_100031572 3300005339 Bacteria 3979
9 Ga0070661_100262362 3300005344 Bacteria 1336
10 Ga0070659_100110672 3300005366 Bacteria 2217
11 Ga0070667_100140945 3300005367 Bacteria 2111
12 Ga0070713_100488014 3300005436 Bacteria 1161
13 Ga0070694_100211691 3300005444 Bacteria 1450
14 Ga0070694_100533207 3300005444 Bacteria 938
15 Ga0070662_100821242 3300005457 Bacteria 791
16 Ga0070681_10002143 3300005458 Bacteria 17951
17 Ga0070681_11230836 3300005458 Bacteria 671
18 Ga0070679_100020386 3300005530 Bacteria 6463
19 Ga0068853_100025366 3300005539 Bacteria 4973
20 Ga0070672_100421189 3300005543 Bacteria 1147
21 Ga0070696_100216900 3300005546 Bacteria 1434
22 Ga0070665_100017197 3300005548 Bacteria 7255
23 Ga0070704_100171517 3300005549 Bacteria 1726
24 Ga0068855_100113728 3300005563 Bacteria 3104
25 Ga0068857_100084979 3300005577 Bacteria 2828
26 Ga0068857_101797797 3300005577 Bacteria 600
27 Ga0068860_100693990 3300005843 Unclassified 1027
28 Ga0068862_100160471 3300005844 Bacteria 2006
29 Ga0075367_10462081 3300006178 Bacteria 805
30 Ga0075366_10098298 3300006195 Bacteria 1756
31 Ga0068871_100364737 3300006358 Bacteria 1280
32 Ga0068871_100497406 3300006358 Unclassified 1098
33 Ga0075430_100302094 3300006846 Unclassified 1324
34 Ga0075431_100149234 3300006847 Bacteria 2408
35 Ga0105240_10097802 3300009093 Unclassified 3576
36 Ga0111539_11958575 3300009094 Bacteria 679
37 Ga0114129_10041846 3300009147 Bacteria 6451
38 Ga0114129_11872176 3300009147 Bacteria 728
39 Ga0105238_10216448 3300009551 Bacteria 1891
40 Ga0105249_10301747 3300009553 Bacteria 1607
41 Ga0157378_11510543 3300013297 Bacteria 716
42 Ga0163162_11635750 3300013306 Bacteria 735
43 Ga0163163_10167932 3300014325 Bacteria 2241
44 Ga0163163_11779409 3300014325 Unclassified 676
45 Ga0157380_11975151 3300014326 Bacteria 645
46 Ga0213876_10060123 3300021384 Bacteria 2005
47 Ga0209026_1011261 3300025250 Bacteria 1621
48 Ga0209233_1019915 3300025261 Bacteria 1771
49 Ga0209455_1009844 3300025272 Bacteria 2476
50 Ga0207692_10767766 3300025898 Unclassified 629
51 Ga0207647_10214543 3300025904 Bacteria 1110
52 Ga0207705_10000600 3300025909 Bacteria 30156
53 Ga0207707_10031034 3300025912 Bacteria 4675
54 Ga0207695_10309275 3300025913 Bacteria 1470
55 Ga0207693_10253758 3300025915 Bacteria 1380
56 Ga0207660_10035375 3300025917 Bacteria 3468
57 Ga0207657_10000381 3300025919 Bacteria 46762
58 Ga0207649_10238680 3300025920 Bacteria 1304
59 Ga0207649_10433105 3300025920 Bacteria 989
60 Ga0207652_10001952 3300025921 Bacteria 17849
61 Ga0207681_11046250 3300025923 Bacteria 685
62 Ga0207694_10256356 3300025924 Bacteria 1432
63 Ga0207659_10271844 3300025926 Bacteria 1383
64 Ga0207700_11134905 3300025928 Unclassified 698
65 Ga0207690_10013095 3300025932 Bacteria 4977
66 Ga0207706_10035571 3300025933 Bacteria 4427
67 Ga0207691_10389687 3300025940 Bacteria 1189
68 Ga0207667_10012181 3300025949 Bacteria 9932
69 Ga0207651_11055941 3300025960 Bacteria 727
70 Ga0207658_10200729 3300025986 Bacteria 1665
71 Ga0207639_10021176 3300026041 Bacteria 4666
72 Ga0207678_10124170 3300026067 Bacteria 2203
73 Ga0207674_10227016 3300026116 Bacteria 1815
74 Ga0207683_10073937 3300026121 Bacteria 3015
75 Ga0207698_10532197 3300026142 Bacteria 1149
76 Ga0268266_10208972 3300028379 Bacteria 1789
77 Ga0265327_10074173 3300031251 Bacteria 1695
78 Ga0307513_10003700 3300031456 Bacteria 20671
79 Ga0307513_10604917 3300031456 Unclassified 805
80 Ga0307415_101349690 3300032126 Bacteria 677
81 Ga0373941_0201742 3300035115 Bacteria 756
82 Ga0373960_0002030 3300035121 Bacteria 4553
83 Ga0373931_0005973 3300035691 Bacteria 5662
84 Ga0395899_0153381 3300037312 Bacteria 1631
85 Ga0395900_0191053 3300037418 Bacteria 2077
86 Ga0395900_0506719 3300037418 Bacteria 1156
87 Ga0395898_0259674 3300037466 Bacteria 1657
88 Ga0395905_1016491 3300037471 Bacteria 732
89 Ga0395901_1085103 3300038443 Bacteria 772
90 Ga0395901_1226853 3300038443 Bacteria 714
91 Ga0436365_0015539 3300039437 Bacteria 1497
92 Ga0436365_1550260 3300039437 Bacteria 1912
93 Ga0436361_0769203 3300039447 Bacteria 5000
94 Ga0451798_0561508 3300041458 Bacteria 576
95 Ga0439437_026860 3300042000 Bacteria 713
96 Ga0439432_131708 3300042006 Bacteria 738
97 Ga0439446_0089957 3300042156 Bacteria 960
98 Ga0451577_1464578 3300042876 Bacteria 604
99 Ga0466969_0010634 3300044656 Bacteria 4877
100 Ga0466969_0468487 3300044656 Bacteria 574
101 Ga0466966_0026102 3300044684 Bacteria 3814
102 Ga0466966_0050757 3300044684 Bacteria 2638
103 Ga0466966_0539843 3300044684 Bacteria 702
104 Ga0466961_0007639 3300044693 Bacteria 6884
105 Ga0466961_0400810 3300044693 Bacteria 833
106 Ga0466963_0171383 3300044694 Bacteria 1513
107 Ga0466963_0638152 3300044694 Bacteria 752
108 Ga0466964_0096155 3300044706 Bacteria 1297
109 Ga0466971_0561072 3300044719 Bacteria 567
110 Ga0466968_0039714 3300044735 Bacteria 1982
111 Ga0466970_0249820 3300044765 Bacteria 993
112 Ga0466957_0087108 3300044842 Bacteria 1952
113 Ga0466960_0618340 3300044901 Unclassified 644
114 Ga0466959_0005662 3300045049 Bacteria 8596
115 Ga0466959_0121884 3300045049 Bacteria 1853
116 Ga0466958_0319786 3300045836 Bacteria 997
117 Ga0466958_0402207 3300045836 Bacteria 884
118 Ga0466967_0154818 3300045976 Bacteria 2146
119 Ga0466967_0800789 3300045976 Bacteria 936
120 Ga0495638_0279048 3300046460 Unclassified 909
121 Ga0496116_0291500 3300048919 Bacteria 783
122 Ga0496118_0143508 3300048921 Bacteria 1508
123 Ga0496119_0260648 3300048922 Bacteria 870
124 Ga0496121_0058352 3300048924 Bacteria 3191
125 Ga0496125_0236830 3300048928 Bacteria 1162
126 Ga0501031_0219613 3300049568 Bacteria 1238
127 Ga0501032_0033068 3300049569 Bacteria 3545
128 Ga0501033_0391394 3300049570 Bacteria 970
129 Ga0501033_0471322 3300049570 Bacteria 871
130 Ga0501034_0000319 3300049571 Bacteria 84488
131 Ga0501034_0047113 3300049571 Bacteria 4354
132 Ga0501036_0136026 3300049572 Bacteria 2074
133 Ga0501036_0224838 3300049572 Bacteria 1575
134 Ga0501037_0022985 3300049573 Bacteria 4611
135 Ga0501037_0099676 3300049573 Bacteria 2098
136 Ga0501038_0443287 3300049574 Bacteria 999
137 Ga0501040_0006974 3300049576 Bacteria 7320
138 Ga0501041_0007716 3300049577 Bacteria 6315
139 Ga0501042_0576277 3300049578 Bacteria 818
140 Ga0501043_0001448 3300049579 Bacteria 20731
141 Ga0501046_0137978 3300049580 Bacteria 1846
142 Ga0501046_0205890 3300049580 Bacteria 1462
143 Ga0501047_0000079 3300049581 Bacteria 122998
144 Ga0501048_0011830 3300049582 Bacteria 6506
145 Ga0501048_0036406 3300049582 Bacteria 3538
146 Ga0501070_0013839 3300049586 Bacteria 6795
147 Ga0501070_0373575 3300049586 Bacteria 1155
148 Ga0501071_0809834 3300049587 Bacteria 722
149 Ga0501072_0031390 3300049588 Bacteria 4159
150 Ga0501073_0075452 3300049589 Bacteria 2347
151 Ga0501074_0006852 3300049590 Bacteria 8231
152 Ga0501076_0002433 3300049592 Bacteria 12776
153 Ga0501077_0610733 3300049593 Bacteria 700
154 Ga0501079_0056555 3300049741 Bacteria 3027
155 Ga0501080_0000069 3300049742 Bacteria 68222
156 Ga0501080_0031046 3300049742 Bacteria 4979
157 Ga0501081_0001511 3300049743 Bacteria 14287
158 Ga0501083_0000984 3300049744 Bacteria 18905
159 Ga0501083_0216236 3300049744 Bacteria 1249
160 Ga0501035_0655356 3300049822 Bacteria 851
161 Ga0501044_0054191 3300049823 Bacteria 4123
162 Ga0501044_0623088 3300049823 Bacteria 970
163 Ga0501044_0884884 3300049823 Bacteria 768
164 Ga0501044_1291366 3300049823 Bacteria 596
165 Ga0501045_0067805 3300049824 Bacteria 2621
166 nmdc:mga0k408_93870_c1 3300050493 Bacteria 1764
167 nmdc:mga06z11_411283_c1 3300050494 Bacteria 815
168 nmdc:mga05p37_37632_c1 3300050507 Bacteria 5933
169 nmdc:mga09592_14254_c1 3300050508 Bacteria 6488
170 nmdc:mga06r32_10853_c1 3300050510 Bacteria 8203
171 nmdc:mga08y16_1461121_c1 3300050511 Bacteria 645
172 nmdc:mga08y16_269326_c1 3300050511 Bacteria 1758
173 Ga0495601_0108077 3300053077 Bacteria 1800
174 Ga0500641_0054758 3300053096 Bacteria 1650
175 Ga0500556_0000121 3300053104 Bacteria 67560
176 Ga0500614_071206 3300053123 Bacteria 955
177 Ga0501084_0163428 3300054114 Bacteria 1878
178 Ga0501082_0083694 3300060353 Bacteria 2752
179 Ga0530510_0011030 3300061734 Bacteria 6339
180 2715500787 2713897090 Bacteria 3353799
181 Ga0466969_0009960
182 rootL2_10157742
183 Ga0065704_10001648
184 Ga0070690_100990853
185 Ga0070670_100022479
186 Ga0070670_101033622
187 Ga0070680_100152810
188 Ga0070660_100031572
189 Ga0070661_100262362
190 Ga0070659_100110672
191 Ga0070667_100140945
192 Ga0070713_100488014
193 Ga0070694_100211691
194 Ga0070694_100533207
195 Ga0070662_100821242
196 Ga0070681_10002143
197 Ga0070681_11230836
198 Ga0070679_100020386
199 Ga0068853_100025366
200 Ga0070672_100421189
201 Ga0070696_100216900
202 Ga0070665_100017197
203 Ga0070704_100171517
204 Ga0068855_100113728
205 Ga0068857_100084979
206 Ga0068857_101797797
207 Ga0068860_100693990
208 Ga0068862_100160471
209 Ga0075367_10462081
210 Ga0075366_10098298
211 Ga0068871_100364737
212 Ga0068871_100497406
213 Ga0075430_100302094
214 Ga0075431_100149234
215 Ga0105240_10097802
216 Ga0111539_11958575
217 Ga0114129_10041846
218 Ga0114129_11872176
219 Ga0105238_10216448
220 Ga0105249_10301747
221 Ga0157378_11510543
222 Ga0163162_11635750
223 Ga0163163_10167932
224 Ga0163163_11779409
225 Ga0157380_11975151
226 Ga0213876_10060123
227 Ga0209026_1011261
228 Ga0209233_1019915
229 Ga0209455_1009844
230 Ga0207692_10767766
231 Ga0207647_10214543
232 Ga0207705_10000600
233 Ga0207707_10031034
234 Ga0207695_10309275
235 Ga0207693_10253758
236 Ga0207660_10035375
237 Ga0207657_10000381
238 Ga0207649_10238680
239 Ga0207649_10433105
240 Ga0207652_10001952
241 Ga0207681_11046250
242 Ga0207694_10256356
243 Ga0207659_10271844
244 Ga0207700_11134905
245 Ga0207690_10013095
246 Ga0207706_10035571
247 Ga0207691_10389687
248 Ga0207667_10012181
249 Ga0207651_11055941
250 Ga0207658_10200729
251 Ga0207639_10021176
252 Ga0207678_10124170
253 Ga0207674_10227016
254 Ga0207683_10073937
255 Ga0207698_10532197
256 Ga0268266_10208972
257 Ga0265327_10074173
258 Ga0307513_10003700
259 Ga0307513_10604917
260 Ga0307415_101349690
261 Ga0373941_0201742
262 Ga0373960_0002030
263 Ga0373931_0005973
264 Ga0395899_0153381
265 Ga0395900_0191053
266 Ga0395900_0506719
267 Ga0395898_0259674
268 Ga0395905_1016491
269 Ga0395901_1085103
270 Ga0395901_1226853
271 Ga0436365_0015539
272 Ga0436365_1550260
273 Ga0436361_0769203
274 Ga0451798_0561508
275 Ga0439437_026860
276 Ga0439432_131708
277 Ga0439446_0089957
278 Ga0451577_1464578
279 Ga0466969_0010634
280 Ga0466969_0468487
281 Ga0466966_0026102
282 Ga0466966_0050757
283 Ga0466966_0539843
284 Ga0466961_0007639
285 Ga0466961_0400810
286 Ga0466963_0171383
287 Ga0466963_0638152
288 Ga0466964_0096155
289 Ga0466971_0561072
290 Ga0466968_0039714
291 Ga0466970_0249820
292 Ga0466957_0087108
293 Ga0466960_0618340
294 Ga0466959_0005662
295 Ga0466959_0121884
296 Ga0466958_0319786
297 Ga0466958_0402207
298 Ga0466967_0154818
299 Ga0466967_0800789
300 Ga0495638_0279048
301 Ga0496116_0291500
302 Ga0496118_0143508
303 Ga0496119_0260648
304 Ga0496121_0058352
305 Ga0496125_0236830
306 Ga0501031_0219613
307 Ga0501032_0033068
308 Ga0501033_0391394
309 Ga0501033_0471322
310 Ga0501034_0000319
311 Ga0501034_0047113
312 Ga0501036_0136026
313 Ga0501036_0224838
314 Ga0501037_0022985
315 Ga0501037_0099676
316 Ga0501038_0443287
317 Ga0501040_0006974
318 Ga0501041_0007716
319 Ga0501042_0576277
320 Ga0501043_0001448
321 Ga0501046_0137978
322 Ga0501046_0205890
323 Ga0501047_0000079
324 Ga0501048_0011830
325 Ga0501048_0036406
326 Ga0501070_0013839
327 Ga0501070_0373575
328 Ga0501071_0809834
329 Ga0501072_0031390
330 Ga0501073_0075452
331 Ga0501074_0006852
332 Ga0501076_0002433
333 Ga0501077_0610733
334 Ga0501079_0056555
335 Ga0501080_0000069
336 Ga0501080_0031046
337 Ga0501081_0001511
338 Ga0501083_0000984
339 Ga0501083_0216236
340 Ga0501035_0655356
341 Ga0501044_0054191
342 Ga0501044_0623088
343 Ga0501044_0884884
344 Ga0501044_1291366
345 Ga0501045_0067805
346 nmdc:mga0k408_93870_c1
347 nmdc:mga06z11_411283_c1
348 nmdc:mga05p37_37632_c1
349 nmdc:mga09592_14254_c1
350 nmdc:mga06r32_10853_c1
351 nmdc:mga08y16_1461121_c1
352 nmdc:mga08y16_269326_c1
353 Ga0495601_0108077
354 Ga0500641_0054758
355 Ga0500556_0000121
356 Ga0500614_071206
357 Ga0501084_0163428
358 Ga0501082_0083694
359 Ga0530510_0011030
360 2715500787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

46

119

0.96

PF05899

Cupin_3

EutQ-like cupin domain

52

113

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.93 41 119
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.9248 2 153
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.9132 2 153
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.8977 41 119
5uqp-assembly1.cif.gz_B the crystal structure of cupin protein from rhodococcus jostii rha1 0.8925 40 120
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9322 41 119 2.60.120.10
3l2hD01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9285 27 145 2.60.120.10
3i7dB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9185 2 153 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8957 41 120 2.60.120.10
3i7dB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8893 2 153 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1K2HRM8-F1-model_v4 Cupin domain-containing protein 0.9947 28 130 GO:0046872
AF-R0EQQ2-F1-model_v4 Cupin type-2 domain-containing protein 0.9919 1 153 GO:0046872
AF-A0A2T6KQ38-F1-model_v4 Cupin domain-containing protein 0.9918 44 120 GO:0046872
AF-T1CXE2-F1-model_v4 Cupin 2 conserved barrel domain protein 0.9916 1 151 GO:0046872
AF-A0A1R4G2V8-F1-model_v4 Cupin type-2 domain-containing protein 0.9914 1 151 GO:0046872

Map