F275723

General Info

Members Datasets Scaffolds Average Seq Length
180 152 178 307

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10012949|Ga0207687_100129492
Length 360
Sequence MVFALEDGVWNFAFAPRRNLESLCKRDRDCIVVRTVMKPLLFALCIVFAFADLGAQQTTWQPSQGHTQIPIWPGVAPDQPRVAGPEIATRRTKDNFVGGRPWTYISNVSQPTMTVYSPQGKNTGAAIVAFPGGGYKILAIDLEGTEVCDWLTAKGITCVLLKYRVPGELGYPIALEDAQRTLGLVRFHASEWHIDPHKIGVLGFSAGGHLAAAMSTHFARRLYPALDAADKESCRPDFAVVIYPGHLSFSAAERDARQGAKQFVLPHPPASGKALGLNPDLHITSQTPPTFLLQAEDDHVDNVNDSLAYYIALKNAGVPVEMHLYAQGGHAFGLRPTKFPITRWPQLVETWLGTLGIISE

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221638 Duganella sp. Root336D2 Isolate Unclassified
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
87 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
88 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
96 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
109 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0.56
Isolates 1.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.22
Nodule 0
Rhizoplane 5.56
Rhizosphere 69.44
Stem 0
Stem Tuber 0
Unclassified 12.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10028205 3300002067 Bacteria 1677
2 JGI25156J39149_1005449 3300002705 Bacteria 3665
3 JGI25162J39368_1000761 3300002737 Bacteria 21822
4 JGI25158J39367_1000202 3300002739 Bacteria 14210
5 JGI25157J39369_1000772 3300002741 Bacteria 16587
6 JGI25164J39214_1000837 3300002772 Bacteria 10652
7 JGI25152J39213_1000002 3300002773 Bacteria 219237
8 JGI25150J39212_1000036 3300002774 Bacteria 89785
9 JGI25165J46597_1000907 3300003214 Bacteria 20573
10 JGI25153J46596_10005080 3300003215 Bacteria 6958
11 rootH1_10059702 3300003316 Bacteria 4667
12 rootH1_10081181 3300003316 Bacteria 3395
13 rootL2_10040431 3300003322 Bacteria 3661
14 rootL2_10047956 3300003322 Bacteria 5561
15 Ga0055533_1000596 3300003756 Bacteria 12309
16 Ga0055535_1000261 3300003761 Bacteria 55503
17 Ga0055542_1000054 3300003762 Bacteria 171728
18 Ga0055524_1000105 3300003775 Bacteria 104121
19 Ga0070683_100301695 3300005329 Bacteria 1524
20 Ga0070680_100521959 3300005336 Bacteria 1017
21 Ga0068868_100071718 3300005338 Bacteria 2762
22 Ga0070671_100400981 3300005355 Bacteria 1173
23 Ga0070714_100149497 3300005435 Bacteria 2103
24 Ga0070681_10049057 3300005458 Bacteria 4217
25 Ga0070706_100101309 3300005467 Bacteria 2676
26 Ga0070707_100069138 3300005468 Bacteria 3399
27 Ga0070707_100096606 3300005468 Bacteria 2862
28 Ga0070698_100017570 3300005471 Bacteria 7538
29 Ga0070699_100005198 3300005518 Bacteria 11443
30 Ga0070679_100178012 3300005530 Unclassified 2099
31 Ga0070697_100239632 3300005536 Bacteria 1549
32 Ga0068853_100023966 3300005539 Bacteria 5115
33 Ga0068855_100772926 3300005563 Bacteria 1023
34 Ga0070664_100031153 3300005564 Bacteria 4453
35 Ga0068857_100263460 3300005577 Bacteria 1582
36 Ga0068856_100001175 3300005614 Bacteria 27552
37 Ga0068852_100103486 3300005616 Bacteria 2575
38 Ga0068852_100300069 3300005616 Bacteria 1555
39 Ga0070717_10022696 3300006028 Bacteria 4962
40 Ga0070716_100029893 3300006173 Bacteria 2951
41 Ga0097621_100003811 3300006237 Bacteria 10445
42 Ga0068871_100001820 3300006358 Bacteria 14389
43 Ga0075434_100418799 3300006871 Bacteria 1360
44 Ga0075436_100017678 3300006914 Bacteria 4881
45 Ga0075436_100108049 3300006914 Bacteria 1940
46 Ga0075435_100225301 3300007076 Bacteria 1592
47 Ga0099794_10056861 3300007265 Bacteria 1894
48 Ga0105240_10001969 3300009093 Bacteria 33947
49 Ga0105245_10019685 3300009098 Bacteria 5915
50 Ga0105241_10441485 3300009174 Bacteria 1149
51 Ga0105237_10000440 3300009545 Bacteria 59281
52 Ga0105237_10112494 3300009545 Bacteria 2715
53 Ga0105238_10061338 3300009551 Bacteria 3763
54 Ga0105238_10156953 3300009551 Bacteria 2250
55 Ga0105239_10000090 3300010375 Bacteria 127911
56 Ga0105239_10131719 3300010375 Bacteria 2782
57 Ga0157373_10030928 3300013100 Bacteria 3852
58 Ga0157371_10114852 3300013102 Bacteria 1912
59 Ga0157370_10004929 3300013104 Bacteria 15107
60 Ga0157370_10328059 3300013104 Bacteria 1411
61 Ga0157369_10067201 3300013105 Bacteria 3855
62 Ga0157369_10183644 3300013105 Bacteria 2200
63 Ga0157369_10209426 3300013105 Bacteria 2044
64 Ga0157374_10483064 3300013296 Bacteria 1242
65 Ga0157372_10432273 3300013307 Bacteria 1534
66 Ga0157375_10632445 3300013308 Bacteria 1227
67 Ga0157376_10223083 3300014969 Bacteria 1747
68 Ga0183368_1002 3300015687 Bacteria 1865598
69 Ga0213872_10060848 3300021361 Bacteria 1707
70 Ga0213872_10061754 3300021361 Bacteria 1694
71 Ga0209674_100014 3300025226 Bacteria 704989
72 Ga0209672_104540 3300025228 Bacteria 2557
73 Ga0207427_100107 3300025231 Bacteria 116422
74 Ga0209437_100039 3300025233 Bacteria 448321
75 Ga0209258_100045 3300025242 Bacteria 369941
76 Ga0207425_1000001 3300025245 Bacteria 2525432
77 Ga0209026_1000074 3300025250 Bacteria 203820
78 Ga0209148_1000052 3300025254 Bacteria 399449
79 Ga0209759_1000110 3300025256 Bacteria 144917
80 Ga0209129_1000001 3300025258 Bacteria 1452436
81 Ga0209233_1000224 3300025261 Bacteria 103605
82 Ga0209758_1000020 3300025297 Bacteria 734220
83 Ga0209256_1000028 3300025299 Bacteria 420213
84 Ga0207647_10018539 3300025904 Bacteria 4703
85 Ga0207684_10058268 3300025910 Bacteria 3277
86 Ga0207707_10083821 3300025912 Bacteria 2783
87 Ga0207695_10004667 3300025913 Bacteria 18566
88 Ga0207695_10017824 3300025913 Bacteria 8234
89 Ga0207695_10024599 3300025913 Bacteria 6767
90 Ga0207671_10000010 3300025914 Bacteria 568302
91 Ga0207671_10151903 3300025914 Bacteria 1789
92 Ga0207694_10025352 3300025924 Bacteria 4507
93 Ga0207694_10218367 3300025924 Bacteria 1554
94 Ga0207687_10012949 3300025927 Bacteria 5449
95 Ga0207700_10048902 3300025928 Bacteria 3143
96 Ga0207661_10203569 3300025944 Bacteria 1741
97 Ga0207679_10017216 3300025945 Bacteria 4817
98 Ga0207702_10009125 3300026078 Bacteria 8350
99 Ga0209588_1034160 3300027671 Bacteria 1633
100 Ga0316177_1198644 3300030731 Bacteria 1918
101 Ga0316182_1271934 3300030745 Bacteria 2331
102 Ga0265760_10015960 3300031090 Unclassified 2154
103 Ga0265340_10045004 3300031247 Bacteria 2158
104 Ga0265339_10000007 3300031249 Bacteria 241067
105 Ga0265316_10090262 3300031344 Bacteria 2338
106 Ga0307408_100011433 3300031548 Bacteria 5866
107 Ga0307406_10064914 3300031901 Bacteria 2371
108 Ga0307412_10276577 3300031911 Bacteria 1316
109 Ga0373929_0000021 3300035085 Bacteria 93871
110 Ga0373932_0001045 3300035112 Bacteria 7979
111 Ga0373956_0038864 3300035119 Unclassified 2107
112 Ga0373927_0003197 3300035695 Bacteria 11801
113 Ga0373925_0008645 3300037068 Bacteria 7419
114 Ga0373925_0144835 3300037068 Bacteria 1862
115 Ga0395899_0000309 3300037312 Bacteria 62448
116 Ga0395900_0000421 3300037418 Bacteria 61155
117 Ga0395898_0000305 3300037466 Bacteria 116565
118 Ga0395905_0498446 3300037471 Bacteria 1118
119 Ga0436364_1029568 3300037853 Bacteria 2071
120 Ga0395901_0095637 3300038443 Bacteria 3113
121 Ga0395901_0157799 3300038443 Bacteria 2382
122 Ga0436365_1039903 3300039437 Bacteria 3398
123 Ga0436361_0252809 3300039447 Bacteria 9911
124 Ga0451795_1117234 3300041456 Bacteria 1790
125 Ga0451807_0556232 3300041486 Bacteria 1775
126 Ga0466969_0046982 3300044656 Bacteria 2138
127 Ga0466966_0007595 3300044684 Bacteria 7184
128 Ga0466961_0003555 3300044693 Bacteria 9721
129 Ga0466961_0004132 3300044693 Bacteria 9068
130 Ga0466961_0086387 3300044693 Bacteria 1982
131 Ga0466964_0073503 3300044706 Bacteria 1451
132 Ga0466971_0024043 3300044719 Bacteria 2717
133 Ga0466970_0244024 3300044765 Bacteria 1005
134 Ga0466970_0244031 3300044765 Bacteria 1005
135 Ga0466959_0000936 3300045049 Bacteria 17317
136 Ga0451576_0447799 3300045051 Bacteria 1355
137 Ga0466958_0060799 3300045836 Bacteria 2300
138 Ga0466958_0164277 3300045836 Bacteria 1404
139 Ga0495629_0061854 3300046459 Bacteria 2616
140 Ga0495651_0012129 3300046462 Bacteria 6633
141 Ga0495582_0125033 3300046473 Bacteria 1451
142 Ga0495639_0073613 3300046475 Unclassified 1582
143 Ga0495594_0013117 3300046499 Bacteria 4321
144 Ga0495606_0037610 3300046507 Bacteria 3286
145 Ga0495628_0235853 3300046516 Bacteria 1370
146 Ga0495630_0067104 3300046517 Bacteria 2696
147 Ga0495652_0327923 3300046529 Bacteria 1104
148 Ga0495587_0058011 3300046536 Bacteria 2275
149 Ga0495645_0003649 3300046543 Bacteria 10457
150 Ga0495658_0033163 3300046683 Bacteria 2826
151 Ga0495613_0017732 3300046689 Bacteria 5305
152 Ga0495684_0111611 3300047471 Bacteria 2063
153 Ga0495602_0043088 3300048088 Bacteria 4107
154 Ga0496101_0044702 3300048904 Bacteria 3170
155 Ga0496104_0040235 3300048907 Bacteria 4381
156 Ga0496105_0001796 3300048908 Bacteria 15330
157 Ga0496106_0091568 3300048909 Bacteria 2348
158 Ga0496107_0039712 3300048910 Bacteria 3377
159 Ga0496109_0433550 3300048912 Bacteria 1242
160 Ga0496113_0001884 3300048916 Bacteria 11960
161 Ga0496115_0000565 3300048918 Bacteria 28778
162 Ga0496117_0002956 3300048920 Bacteria 20536
163 Ga0496118_0000779 3300048921 Bacteria 51068
164 Ga0496118_0002362 3300048921 Bacteria 25570
165 Ga0496119_0000218 3300048922 Bacteria 81458
166 Ga0496119_0003548 3300048922 Bacteria 16103
167 Ga0496120_0000322 3300048923 Bacteria 79400
168 Ga0496121_0000883 3300048924 Bacteria 54178
169 Ga0496121_0098941 3300048924 Bacteria 2255
170 Ga0496122_0055983 3300048925 Bacteria 2945
171 Ga0496126_0002101 3300048929 Bacteria 27893
172 Ga0496126_0030588 3300048929 Bacteria 5097
173 Ga0501279_001566 3300049775 Bacteria 3011
174 nmdc:mga0rr50_151266_c1 3300050513 Bacteria 1876
175 nmdc:mga0rr50_5317_c1 3300050513 Bacteria 7662
176 nmdc:mga08x19_313637_c1 3300050514 Bacteria 1091
177 Ga0466962_0084708 3300061719 Bacteria 1517
178 Ga0466962_0126269 3300061719 Bacteria 1235

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050513 nmdc:mga0rr50_5317_c1 nmdc:mga0rr50_5317_c1_3566_4381 263
2 3300050514 nmdc:mga08x19_313637_c1 nmdc:mga08x19_313637_c1_104_919 263
3 3300009093 Ga0105240_10001969 Ga0105240_1000196915 267
4 3300048904 Ga0496101_0044702 Ga0496101_0044702_344_1147 267
5 3300048907 Ga0496104_0040235 Ga0496104_0040235_527_1330 267
6 3300048908 Ga0496105_0001796 Ga0496105_0001796_10421_11224 267
7 3300048909 Ga0496106_0091568 Ga0496106_0091568_232_1035 267
8 3300048910 Ga0496107_0039712 Ga0496107_0039712_175_978 267
9 3300048920 Ga0496117_0002956 Ga0496117_0002956_3939_4742 267
10 3300048921 Ga0496118_0000779 Ga0496118_0000779_45357_46160 267
11 3300048921 Ga0496118_0002362 Ga0496118_0002362_2159_2962 267
12 3300048922 Ga0496119_0000218 Ga0496119_0000218_57345_58148 267
13 3300048923 Ga0496120_0000322 Ga0496120_0000322_31770_32573 267
14 3300048924 Ga0496121_0000883 Ga0496121_0000883_29349_30152 267
15 3300048924 Ga0496121_0098941 Ga0496121_0098941_234_1037 267
16 3300048929 Ga0496126_0002101 Ga0496126_0002101_7743_8546 267
17 3300002705 JGI25156J39149_1005449 JGI25156J39149_10054493 269
18 3300002741 JGI25157J39369_1000772 JGI25157J39369_10007723 269
19 3300025250 Ga0209026_1000074 Ga0209026_1000074125 269
20 3300025256 Ga0209759_1000110 Ga0209759_1000110125 269
21 3300037312 Ga0395899_0000309 Ga0395899_0000309_37838_38656 269
22 3300037418 Ga0395900_0000421 Ga0395900_0000421_20377_21195 269
23 3300037466 Ga0395898_0000305 Ga0395898_0000305_37838_38656 269
24 3300038443 Ga0395901_0157799 Ga0395901_0157799_728_1546 269
25 3300044765 Ga0466970_0244024 Ga0466970_0244024_96_914 269
26 3300044765 Ga0466970_0244031 Ga0466970_0244031_92_910 269
27 3300061719 Ga0466962_0126269 Ga0466962_0126269_41_859 269
28 iso_pu_bacteria 2643221554 2643791671 274
29 iso_pu_bacteria 2643221638 2644211303 274
30 3300031548 Ga0307408_100011433 Ga0307408_1000114335 277
31 3300031901 Ga0307406_10064914 Ga0307406_100649141 277
32 3300031911 Ga0307412_10276577 Ga0307412_102765771 277
33 3300044706 Ga0466964_0073503 Ga0466964_0073503_521_1417 277
34 3300002739 JGI25158J39367_1000202 JGI25158J39367_10002022 278
35 3300002773 JGI25152J39213_1000002 JGI25152J39213_100000283 278
36 3300002774 JGI25150J39212_1000036 JGI25150J39212_100003667 278
37 3300003215 JGI25153J46596_10005080 JGI25153J46596_100050802 278
38 3300003322 rootL2_10040431 rootL2_100404314 278
39 3300003775 Ga0055524_1000105 Ga0055524_100010552 278
40 3300025245 Ga0207425_1000001 Ga0207425_10000011198 278
41 3300025258 Ga0209129_1000001 Ga0209129_1000001375 278
42 3300025297 Ga0209758_1000020 Ga0209758_100002078 278
43 3300025299 Ga0209256_1000028 Ga0209256_100002853 278
44 3300030731 Ga0316177_1198644 Ga0316177_11986442 278
45 3300030745 Ga0316182_1271934 Ga0316182_12719342 278
46 3300049775 Ga0501279_001566 Ga0501279_001566_1113_2012 278
47 3300005468 Ga0070707_100096606 Ga0070707_1000966061 281
48 3300005471 Ga0070698_100017570 Ga0070698_1000175704 283
49 3300005518 Ga0070699_100005198 Ga0070699_1000051987 283
50 3300046459 Ga0495629_0061854 Ga0495629_0061854_395_1258 283
51 3300046499 Ga0495594_0013117 Ga0495594_0013117_2279_3142 283
52 3300046517 Ga0495630_0067104 Ga0495630_0067104_48_911 283
53 3300046683 Ga0495658_0033163 Ga0495658_0033163_587_1450 283
54 3300046689 Ga0495613_0017732 Ga0495613_0017732_1294_2157 283
55 3300047471 Ga0495684_0111611 Ga0495684_0111611_983_1846 283
56 3300039437 Ga0436365_1039903 Ga0436365_1039903_1895_2830 286
57 3300045051 Ga0451576_0447799 Ga0451576_0447799_174_1061 286
58 3300007265 Ga0099794_10056861 Ga0099794_100568612 287
59 3300027671 Ga0209588_1034160 Ga0209588_10341602 287
60 3300009551 Ga0105238_10156953 Ga0105238_101569531 289
61 3300035695 Ga0373927_0003197 Ga0373927_0003197_13_906 293
62 3300005355 Ga0070671_100400981 Ga0070671_1004009811 295
63 3300045836 Ga0466958_0164277 Ga0466958_0164277_30_917 295
64 3300005536 Ga0070697_100239632 Ga0070697_1002396321 296
65 3300006914 Ga0075436_100108049 Ga0075436_1001080493 297
66 3300013104 Ga0157370_10328059 Ga0157370_103280591 297
67 3300013105 Ga0157369_10183644 Ga0157369_101836443 297
68 3300031090 Ga0265760_10015960 Ga0265760_100159602 297
69 3300037471 Ga0395905_0498446 Ga0395905_0498446_17_919 297
70 3300046462 Ga0495651_0012129 Ga0495651_0012129_5248_6228 298
71 3300048088 Ga0495602_0043088 Ga0495602_0043088_2843_3823 298
72 3300048929 Ga0496126_0030588 Ga0496126_0030588_1054_1995 298
73 3300005338 Ga0068868_100071718 Ga0068868_1000717182 299
74 3300006028 Ga0070717_10022696 Ga0070717_100226964 299
75 3300013105 Ga0157369_10209426 Ga0157369_102094262 299
76 3300025924 Ga0207694_10218367 Ga0207694_102183672 299
77 3300005435 Ga0070714_100149497 Ga0070714_1001494971 300
78 3300009098 Ga0105245_10019685 Ga0105245_100196852 300
79 3300025927 Ga0207687_10012949 Ga0207687_100129492 300
80 3300025928 Ga0207700_10048902 Ga0207700_100489022 300
81 3300035119 Ga0373956_0038864 Ga0373956_0038864_1011_1982 300
82 3300037068 Ga0373925_0008645 Ga0373925_0008645_5509_6480 300
83 3300046473 Ga0495582_0125033 Ga0495582_0125033_354_1325 300
84 3300046475 Ga0495639_0073613 Ga0495639_0073613_475_1446 300
85 3300046516 Ga0495628_0235853 Ga0495628_0235853_97_1095 301
86 3300003316 rootH1_10081181 rootH1_100811812 302
87 3300003322 rootL2_10047956 rootL2_100479565 302
88 3300005563 Ga0068855_100772926 Ga0068855_1007729261 302
89 3300035112 Ga0373932_0001045 Ga0373932_0001045_1099_2016 302
90 3300006173 Ga0070716_100029893 Ga0070716_1000298933 304
91 3300035085 Ga0373929_0000021 Ga0373929_0000021_53921_54856 304
92 3300037068 Ga0373925_0144835 Ga0373925_0144835_48_998 304
93 3300037853 Ga0436364_1029568 Ga0436364_1029568_1110_2060 304
94 3300005564 Ga0070664_100031153 Ga0070664_1000311534 305
95 3300025945 Ga0207679_10017216 Ga0207679_100172164 305
96 3300005539 Ga0068853_100023966 Ga0068853_1000239662 306
97 3300005616 Ga0068852_100103486 Ga0068852_1001034862 306
98 3300025228 Ga0209672_104540 Ga0209672_1045402 306
99 3300044693 Ga0466961_0004132 Ga0466961_0004132_1539_2459 306
100 3300048912 Ga0496109_0433550 Ga0496109_0433550_157_1164 306
101 3300021361 Ga0213872_10060848 Ga0213872_100608482 307
102 3300021361 Ga0213872_10061754 Ga0213872_100617542 307
103 3300039447 Ga0436361_0252809 Ga0436361_0252809_1908_2843 307
104 3300046529 Ga0495652_0327923 Ga0495652_0327923_67_1086 307
105 3300046536 Ga0495587_0058011 Ga0495587_0058011_252_1271 307
106 3300046543 Ga0495645_0003649 Ga0495645_0003649_4465_5484 307
107 3300005329 Ga0070683_100301695 Ga0070683_1003016951 308
108 3300005336 Ga0070680_100521959 Ga0070680_1005219591 308
109 3300005458 Ga0070681_10049057 Ga0070681_100490572 308
110 3300005530 Ga0070679_100178012 Ga0070679_1001780122 308
111 3300005577 Ga0068857_100263460 Ga0068857_1002634602 308
112 3300005614 Ga0068856_100001175 Ga0068856_10000117516 308
113 3300005616 Ga0068852_100300069 Ga0068852_1003000692 308
114 3300006237 Ga0097621_100003811 Ga0097621_1000038119 308
115 3300006358 Ga0068871_100001820 Ga0068871_1000018203 308
116 3300009174 Ga0105241_10441485 Ga0105241_104414851 308
117 3300009545 Ga0105237_10112494 Ga0105237_101124941 308
118 3300009551 Ga0105238_10061338 Ga0105238_100613382 308
119 3300010375 Ga0105239_10131719 Ga0105239_101317192 308
120 3300013102 Ga0157371_10114852 Ga0157371_101148522 308
121 3300013104 Ga0157370_10004929 Ga0157370_100049295 308
122 3300013105 Ga0157369_10067201 Ga0157369_100672012 308
123 3300013296 Ga0157374_10483064 Ga0157374_104830641 308
124 3300013307 Ga0157372_10432273 Ga0157372_104322732 308
125 3300014969 Ga0157376_10223083 Ga0157376_102230832 308
126 3300025912 Ga0207707_10083821 Ga0207707_100838212 308
127 3300025913 Ga0207695_10017824 Ga0207695_100178245 308
128 3300025914 Ga0207671_10151903 Ga0207671_101519032 308
129 3300025924 Ga0207694_10025352 Ga0207694_100253523 308
130 3300025944 Ga0207661_10203569 Ga0207661_102035691 308
131 3300026078 Ga0207702_10009125 Ga0207702_100091256 308
132 3300009545 Ga0105237_10000440 Ga0105237_1000044053 309
133 3300025914 Ga0207671_10000010 Ga0207671_10000010411 309
134 3300031247 Ga0265340_10045004 Ga0265340_100450042 309
135 3300031249 Ga0265339_10000007 Ga0265339_1000000770 309
136 3300031344 Ga0265316_10090262 Ga0265316_100902623 309
137 3300013308 Ga0157375_10632445 Ga0157375_106324452 310
138 3300003761 Ga0055535_1000261 Ga0055535_100026122 311
139 3300003762 Ga0055542_1000054 Ga0055542_100005492 311
140 3300025242 Ga0209258_100045 Ga0209258_10004581 311
141 3300025254 Ga0209148_1000052 Ga0209148_100005281 311
142 3300010375 Ga0105239_10000090 Ga0105239_1000009025 312
143 3300025913 Ga0207695_10004667 Ga0207695_1000466715 312
144 3300025913 Ga0207695_10024599 Ga0207695_100245992 312
145 3300002737 JGI25162J39368_1000761 JGI25162J39368_10007619 313
146 3300002772 JGI25164J39214_1000837 JGI25164J39214_10008379 313
147 3300003214 JGI25165J46597_1000907 JGI25165J46597_100090713 313
148 3300003316 rootH1_10059702 rootH1_100597022 313
149 3300005467 Ga0070706_100101309 Ga0070706_1001013093 313
150 3300005468 Ga0070707_100069138 Ga0070707_1000691386 313
151 3300006914 Ga0075436_100017678 Ga0075436_1000176785 313
152 3300025231 Ga0207427_100107 Ga0207427_10010761 313
153 3300025233 Ga0209437_100039 Ga0209437_10003952 313
154 3300025261 Ga0209233_1000224 Ga0209233_100022431 313
155 3300025910 Ga0207684_10058268 Ga0207684_100582684 313
156 3300038443 Ga0395901_0095637 Ga0395901_0095637_1687_2628 313
157 3300041456 Ga0451795_1117234 Ga0451795_1117234_336_1325 313
158 3300041486 Ga0451807_0556232 Ga0451807_0556232_417_1406 313
159 3300050513 nmdc:mga0rr50_151266_c1 nmdc:mga0rr50_151266_c1_750_1727 313
160 3300002067 JGI24735J21928_10028205 JGI24735J21928_100282052 314
161 3300003756 Ga0055533_1000596 Ga0055533_10005967 314
162 3300006871 Ga0075434_100418799 Ga0075434_1004187992 314
163 3300007076 Ga0075435_100225301 Ga0075435_1002253012 314
164 3300013100 Ga0157373_10030928 Ga0157373_100309284 314
165 3300015687 Ga0183368_1002 Ga0183368_10021134 314
166 3300025226 Ga0209674_100014 Ga0209674_100014328 314
167 3300025904 Ga0207647_10018539 Ga0207647_100185394 314
168 3300044656 Ga0466969_0046982 Ga0466969_0046982_955_1902 314
169 3300044684 Ga0466966_0007595 Ga0466966_0007595_1838_2785 314
170 3300044693 Ga0466961_0003555 Ga0466961_0003555_3500_4453 314
171 3300044693 Ga0466961_0086387 Ga0466961_0086387_664_1611 314
172 3300044719 Ga0466971_0024043 Ga0466971_0024043_298_1245 314
173 3300045049 Ga0466959_0000936 Ga0466959_0000936_3764_4717 314
174 3300045836 Ga0466958_0060799 Ga0466958_0060799_1032_1979 314
175 3300046507 Ga0495606_0037610 Ga0495606_0037610_428_1393 314
176 3300048916 Ga0496113_0001884 Ga0496113_0001884_524_1468 314
177 3300048918 Ga0496115_0000565 Ga0496115_0000565_24653_25597 314
178 3300048922 Ga0496119_0003548 Ga0496119_0003548_7348_8340 314
179 3300048925 Ga0496122_0055983 Ga0496122_0055983_1558_2502 314
180 3300061719 Ga0466962_0084708 Ga0466962_0084708_191_1138 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

127

334

0.82

PF20434

BD-FAE

BD-FAE

100

313

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dwc-assembly4.cif.gz_D bacteroides thetaiotaomicron vpi5482 btaxe1 0.7856 75 307
6a6o-assembly1.cif.gz_A crystal structure of acetyl ester-xyloside bifunctional hydrolase from caldicellulosiruptor lactoaceticus 0.7839 20 311
4q3k-assembly1.cif.gz_B crystal structure of mgs-m1, an alpha/beta hydrolase enzyme from a medee basin deep-sea metagenome library 0.7787 50 308
6a6o-assembly1.cif.gz_A crystal structure of acetyl ester-xyloside bifunctional hydrolase from caldicellulosiruptor lactoaceticus 0.7784 20 311
7bfr-assembly1.cif.gz_A thermogutta terrifontis esterase 2 phosphorylated by paraoxon 0.7696 45 314
ID Description Score Start End Superfamily
af_A0A1D6EGD3_55_198_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8227 90 195 3.40.50.1820
af_P96402_114_379_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7726 74 295 3.40.50.1820
af_I6Y9F7_131_400_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.771 75 309 3.40.50.1820
5aobA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7679 70 314 3.40.50.1820
4q3kA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7668 48 308 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V7MM68-F1-model_v4 Peptidase S9 prolyl oligopeptidase catalytic domain-containing protein 0.9865 169 313 GO:0006508
GO:0008236
AF-A0A7V4PBV4-F1-model_v4 Alpha/beta hydrolase 0.9759 155 314 GO:0006508
GO:0008236
AF-A0A7X8GUD6-F1-model_v4 Alpha/beta hydrolase 0.9733 155 311 GO:0006508
GO:0008236
AF-A0A7W5PFH9-F1-model_v4 Acetyl esterase/lipase 0.9708 149 311 GO:0016787
AF-A0A2V9MTU8-F1-model_v4 Xylanase 0.9683 150 310 GO:0016798
GO:0045493

Feature Viewer

pLDDT pTM Quality
85.55 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map