F275610

General Info

Members Datasets Scaffolds Average Seq Length
180 124 178 324

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10370149|Ga0163162_103701492
Length 347
Sequence VSLEPETSSQPQATSSEPKKMLKADPDKIKIFTGRANPILAQRICDHLDVQLGRGKTELFPDGELIVKVDEDVRGRDCFIIQPTSHPINAHLMELFIWIDCLRRASASRVTAVIPYFGYARQDRKDEGRTPITAKLVANLLERAGADRVVSVDLHAAQVQGFFDIPVDHLSASPVLIKWFKTLKLSNRVFVSPDVGNVKRAQVYAGLLGGEICIIDKRRKSGKDTEAKNIIGEVEGKNVLMVDDMITTAGTVTEACKILKGHGVNEIYIAATHGVFAPPAMERLSKCDFTKLAVTDTIPIGDRANAIKDRLAVLSVAELLGEAIFRIHNNASVSALFKDEKGRAESE

Samples

Sample ID Description Type Environment
1 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
2 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
70 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
96 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
122 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.22
Metatranscriptomes 1.67
Isolates 1.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.11
Nodule 0
Rhizoplane 0.56
Rhizosphere 96.67
Stem 0
Stem Tuber 0
Unclassified 1.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10086594 3300005295 Bacteria 5390
2 Ga0070658_10000641 3300005327 Bacteria 30217
3 Ga0070658_10006240 3300005327 Bacteria 9657
4 Ga0070670_100081734 3300005331 Bacteria 2776
5 Ga0070670_100113073 3300005331 Bacteria 2340
6 Ga0070670_100121108 3300005331 Bacteria 2257
7 Ga0070666_10167164 3300005335 Bacteria 1539
8 Ga0070661_100070419 3300005344 Unclassified 2572
9 Ga0070675_100165803 3300005354 Bacteria 1902
10 Ga0070675_100220336 3300005354 Bacteria 1652
11 Ga0070671_100057464 3300005355 Bacteria 3238
12 Ga0070673_100376498 3300005364 Bacteria 1265
13 Ga0070659_100022053 3300005366 Bacteria 4860
14 Ga0070667_100007302 3300005367 Bacteria 9189
15 Ga0070711_100001454 3300005439 Bacteria 13018
16 Ga0070706_100159500 3300005467 Bacteria 2106
17 Ga0070698_100302849 3300005471 Bacteria 1529
18 Ga0070665_100000046 3300005548 Bacteria 271885
19 Ga0070665_100001162 3300005548 Bacteria 32364
20 Ga0068855_100109374 3300005563 Bacteria 3174
21 Ga0068855_100112321 3300005563 Bacteria 3127
22 Ga0068855_100125769 3300005563 Unclassified 2931
23 Ga0068855_100551878 3300005563 Bacteria 1247
24 Ga0068857_100017402 3300005577 Bacteria 6298
25 Ga0068854_100024404 3300005578 Bacteria 4140
26 Ga0068852_100456214 3300005616 Bacteria 1266
27 Ga0068859_100505465 3300005617 Bacteria 1304
28 Ga0068863_100080320 3300005841 Bacteria 3089
29 Ga0068858_100189709 3300005842 Bacteria 1942
30 Ga0068860_100173527 3300005843 Bacteria 2083
31 Ga0081455_10166503 3300005937 Bacteria 1683
32 Ga0081539_10009883 3300005985 Bacteria 7868
33 Ga0070717_10180908 3300006028 Bacteria 1838
34 Ga0075362_10046997 3300006177 Bacteria 1921
35 Ga0075428_100016681 3300006844 Bacteria 8110
36 Ga0075431_100034395 3300006847 Bacteria 5220
37 Ga0097620_100505475 3300006931 Bacteria 1304
38 Ga0105240_10149164 3300009093 Bacteria 2787
39 Ga0111539_10002017 3300009094 Bacteria 27101
40 Ga0105241_10129016 3300009174 Bacteria 2045
41 Ga0105248_10297933 3300009177 Bacteria 1816
42 Ga0105248_10517931 3300009177 Bacteria 1345
43 Ga0105238_10007696 3300009551 Bacteria 10773
44 Ga0105238_10073565 3300009551 Bacteria 3412
45 Ga0105239_10045440 3300010375 Bacteria 4813
46 Ga0105239_10051892 3300010375 Bacteria 4496
47 Ga0157370_10167661 3300013104 Unclassified 2042
48 Ga0157369_10094165 3300013105 Bacteria 3197
49 Ga0157369_10236497 3300013105 Unclassified 1909
50 Ga0157374_10426566 3300013296 Bacteria 1325
51 Ga0163162_10370149 3300013306 Bacteria 1566
52 Ga0157372_10065241 3300013307 Bacteria 4087
53 Ga0157372_10088199 3300013307 Bacteria 3522
54 Ga0157372_10215321 3300013307 Bacteria 2226
55 Ga0157372_10343656 3300013307 Bacteria 1738
56 Ga0157379_10119187 3300014968 Bacteria 2374
57 Ga0207680_10153610 3300025903 Bacteria 1537
58 Ga0207705_10005939 3300025909 Bacteria 9082
59 Ga0207705_10009730 3300025909 Bacteria 6993
60 Ga0207684_10131614 3300025910 Bacteria 2147
61 Ga0207695_10000211 3300025913 Bacteria 156467
62 Ga0207695_10114724 3300025913 Bacteria 2668
63 Ga0207649_10033245 3300025920 Bacteria 3080
64 Ga0207650_10026183 3300025925 Bacteria 4157
65 Ga0207650_10093813 3300025925 Bacteria 2298
66 Ga0207687_10031414 3300025927 Bacteria 3588
67 Ga0207664_10117471 3300025929 Bacteria 2221
68 Ga0207644_10043617 3300025931 Bacteria 3184
69 Ga0207690_10024713 3300025932 Bacteria 3765
70 Ga0207670_10107976 3300025936 Bacteria 2000
71 Ga0207691_10011591 3300025940 Bacteria 8465
72 Ga0207661_10135963 3300025944 Bacteria 2111
73 Ga0207667_10077093 3300025949 Bacteria 3458
74 Ga0207667_10118154 3300025949 Bacteria 2732
75 Ga0207667_10138426 3300025949 Bacteria 2506
76 Ga0207651_10233779 3300025960 Bacteria 1494
77 Ga0207640_10305203 3300025981 Unclassified 1261
78 Ga0207658_10465913 3300025986 Bacteria 1121
79 Ga0207703_10316966 3300026035 Bacteria 1427
80 Ga0207702_10482398 3300026078 Bacteria 1207
81 Ga0207674_10000651 3300026116 Bacteria 45182
82 Ga0207698_10354077 3300026142 Bacteria 1388
83 Ga0207428_10033905 3300027907 Bacteria 4187
84 Ga0268266_10000164 3300028379 Bacteria 123070
85 Ga0268266_10000395 3300028379 Bacteria 66128
86 Ga0268264_10038790 3300028381 Bacteria 3933
87 Ga0268264_10138403 3300028381 Bacteria 2168
88 Ga0265338_10062339 3300028800 Bacteria 3259
89 Ga0265332_10123170 3300031238 Bacteria 1089
90 Ga0265320_10032916 3300031240 Bacteria 2650
91 Ga0265339_10011550 3300031249 Bacteria 5430
92 Ga0265327_10001799 3300031251 Bacteria 25157
93 Ga0265316_10000016 3300031344 Bacteria 198693
94 Ga0307408_100277920 3300031548 Bacteria 1393
95 Ga0265314_10098724 3300031711 Bacteria 1882
96 Ga0307413_10018723 3300031824 Bacteria 3641
97 Ga0307410_10008691 3300031852 Bacteria 5648
98 Ga0307409_100001751 3300031995 Bacteria 10962
99 Ga0307409_100053355 3300031995 Bacteria 3106
100 Ga0307414_10279061 3300032004 Bacteria 1403
101 Ga0307411_10100130 3300032005 Bacteria 2047
102 Ga0307411_10337748 3300032005 Bacteria 1223
103 Ga0316593_10046981 3300032168 Bacteria 1450
104 Ga0316582_0087766 3300036647 Bacteria 2042
105 Ga0395900_0170913 3300037418 Bacteria 2213
106 Ga0395898_0202972 3300037466 Bacteria 1892
107 Ga0395905_0263838 3300037471 Bacteria 1608
108 Ga0395901_0016587 3300038443 Bacteria 7506
109 Ga0436363_0029752 3300039450 Bacteria 1145
110 Ga0436362_1196195 3300039453 Bacteria 1075
111 Ga0451577_0000011 3300042876 Bacteria 597389
112 Ga0451577_0003059 3300042876 Bacteria 18968
113 Ga0451577_0147053 3300042876 Bacteria 2119
114 Ga0451577_0185316 3300042876 Bacteria 1877
115 Ga0451577_0335163 3300042876 Bacteria 1372
116 Ga0451577_0349509 3300042876 Bacteria 1341
117 Ga0451577_0416439 3300042876 Bacteria 1220
118 Ga0453683_0000024 3300044673 Bacteria 263554
119 Ga0453683_0000064 3300044673 Bacteria 168322
120 Ga0453683_0010763 3300044673 Bacteria 6056
121 Ga0453683_0053025 3300044673 Bacteria 2538
122 Ga0453684_0000087 3300044712 Bacteria 395597
123 Ga0453684_0002090 3300044712 Bacteria 50591
124 Ga0453684_0172053 3300044712 Bacteria 2551
125 Ga0451576_0001908 3300045051 Bacteria 33406
126 Ga0451576_0006227 3300045051 Bacteria 14693
127 Ga0451576_0225358 3300045051 Bacteria 1957
128 Ga0451576_0254916 3300045051 Bacteria 1834
129 Ga0495592_0151138 3300046454 Bacteria 1606
130 Ga0495608_0150496 3300046511 Bacteria 1483
131 Ga0495630_0001667 3300046517 Bacteria 15452
132 Ga0495665_0017696 3300046531 Bacteria 3832
133 Ga0495667_0031683 3300046559 Bacteria 3547
134 Ga0495613_0035480 3300046689 Bacteria 3700
135 Ga0495624_0041265 3300046690 Bacteria 2952
136 Ga0495674_0143648 3300047319 Bacteria 2004
137 Ga0495680_0115407 3300047322 Bacteria 1987
138 Ga0495680_0193100 3300047322 Bacteria 1464
139 Ga0495675_0183043 3300047444 Unclassified 1282
140 Ga0495684_0004765 3300047471 Bacteria 10602
141 Ga0495684_0032813 3300047471 Bacteria 3989
142 Ga0496109_0418901 3300048912 Bacteria 1265
143 Ga0501033_0185419 3300049570 Bacteria 1491
144 Ga0501034_0001447 3300049571 Bacteria 31489
145 Ga0501034_0001546 3300049571 Bacteria 30225
146 Ga0501034_0002131 3300049571 Bacteria 24586
147 Ga0501034_0003698 3300049571 Bacteria 17269
148 Ga0501034_0019788 3300049571 Bacteria 6881
149 Ga0501034_0023365 3300049571 Bacteria 6300
150 Ga0501034_0238611 3300049571 Bacteria 1765
151 Ga0501034_0453521 3300049571 Bacteria 1200
152 Ga0501036_0118566 3300049572 Bacteria 2235
153 Ga0501038_0005549 3300049574 Bacteria 11716
154 Ga0501042_0117928 3300049578 Bacteria 1911
155 Ga0501043_0000351 3300049579 Bacteria 41929
156 Ga0501043_0072587 3300049579 Bacteria 2704
157 Ga0501046_0000020 3300049580 Bacteria 218268
158 Ga0501047_0072281 3300049581 Bacteria 3320
159 Ga0501047_0091407 3300049581 Bacteria 2921
160 Ga0501048_0034004 3300049582 Bacteria 3680
161 Ga0501073_0023242 3300049589 Bacteria 4454
162 Ga0501080_0002086 3300049742 Bacteria 17356
163 Ga0501083_0000005 3300049744 Bacteria 206200
164 Ga0501083_0010269 3300049744 Bacteria 6597
165 Ga0501083_0156652 3300049744 Bacteria 1491
166 Ga0501035_0064488 3300049822 Bacteria 3256
167 Ga0501044_0002290 3300049823 Bacteria 21807
168 Ga0501044_0010913 3300049823 Bacteria 9861
169 Ga0501044_0071412 3300049823 Bacteria 3530
170 Ga0501044_0155879 3300049823 Bacteria 2263
171 Ga0501044_0522417 3300049823 Bacteria 1087
172 Ga0501045_0096022 3300049824 Bacteria 2193
173 nmdc:mga08y16_1087_c1 3300050511 Bacteria 26773
174 nmdc:mga08y16_94373_c1 3300050511 Bacteria 3116
175 Ga0500616_0000186 3300053153 Bacteria 102009
176 Ga0587079_004350 3300059647 Bacteria 1922
177 Ga0587071_004071 3300060344 Bacteria 2151
178 Ga0501082_0232599 3300060353 Bacteria 1604

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047322 Ga0495680_0115407 Ga0495680_0115407_716_1723 288
2 3300005355 Ga0070671_100057464 Ga0070671_1000574642 293
3 3300025931 Ga0207644_10043617 Ga0207644_100436172 293
4 3300048912 Ga0496109_0418901 Ga0496109_0418901_61_1050 293
5 3300005354 Ga0070675_100165803 Ga0070675_1001658031 300
6 3300025940 Ga0207691_10011591 Ga0207691_100115912 300
7 3300042876 Ga0451577_0349509 Ga0451577_0349509_365_1324 302
8 3300044673 Ga0453683_0010763 Ga0453683_0010763_867_1826 302
9 3300045051 Ga0451576_0006227 Ga0451576_0006227_8239_9198 302
10 3300042876 Ga0451577_0335163 Ga0451577_0335163_376_1335 303
11 3300045051 Ga0451576_0001908 Ga0451576_0001908_10131_11102 305
12 3300009177 Ga0105248_10517931 Ga0105248_105179312 308
13 3300025936 Ga0207670_10107976 Ga0207670_101079762 308
14 3300026078 Ga0207702_10482398 Ga0207702_104823981 311
15 3300042876 Ga0451577_0416439 Ga0451577_0416439_229_1170 311
16 3300044712 Ga0453684_0172053 Ga0453684_0172053_781_1722 311
17 iso_pu_bacteria 2836160341 2836161685 311
18 3300006177 Ga0075362_10046997 Ga0075362_100469972 312
19 3300042876 Ga0451577_0003059 Ga0451577_0003059_106_1047 312
20 3300005439 Ga0070711_100001454 Ga0070711_1000014548 313
21 3300025927 Ga0207687_10031414 Ga0207687_100314143 313
22 3300036647 Ga0316582_0087766 Ga0316582_0087766_937_1911 313
23 3300005937 Ga0081455_10166503 Ga0081455_101665032 314
24 3300006847 Ga0075431_100034395 Ga0075431_1000343953 314
25 3300049571 Ga0501034_0019788 Ga0501034_0019788_4858_5802 314
26 iso_pu_bacteria 2687453341 2688394361 314
27 3300005327 Ga0070658_10000641 Ga0070658_1000064115 315
28 3300005563 Ga0068855_100112321 Ga0068855_1001123212 315
29 3300009551 Ga0105238_10007696 Ga0105238_100076967 315
30 3300010375 Ga0105239_10051892 Ga0105239_100518923 315
31 3300013296 Ga0157374_10426566 Ga0157374_104265661 315
32 3300025909 Ga0207705_10009730 Ga0207705_100097301 315
33 3300025949 Ga0207667_10077093 Ga0207667_100770934 315
34 3300031251 Ga0265327_10001799 Ga0265327_100017998 315
35 3300031344 Ga0265316_10000016 Ga0265316_10000016101 315
36 3300005563 Ga0068855_100125769 Ga0068855_1001257692 316
37 3300005578 Ga0068854_100024404 Ga0068854_1000244045 316
38 3300006844 Ga0075428_100016681 Ga0075428_1000166812 316
39 3300025949 Ga0207667_10118154 Ga0207667_101181542 316
40 3300025981 Ga0207640_10305203 Ga0207640_103052032 316
41 3300028800 Ga0265338_10062339 Ga0265338_100623393 316
42 3300031238 Ga0265332_10123170 Ga0265332_101231701 316
43 3300031249 Ga0265339_10011550 Ga0265339_100115508 316
44 3300032168 Ga0316593_10046981 Ga0316593_100469812 316
45 3300013104 Ga0157370_10167661 Ga0157370_101676613 317
46 3300013105 Ga0157369_10236497 Ga0157369_102364971 317
47 3300026142 Ga0207698_10354077 Ga0207698_103540772 317
48 3300031995 Ga0307409_100053355 Ga0307409_1000533552 317
49 3300039450 Ga0436363_0029752 Ga0436363_0029752_111_1064 317
50 3300039453 Ga0436362_1196195 Ga0436362_1196195_41_1006 317
51 3300042876 Ga0451577_0000011 Ga0451577_0000011_162611_163573 317
52 3300042876 Ga0451577_0147053 Ga0451577_0147053_1090_2052 317
53 3300044673 Ga0453683_0000024 Ga0453683_0000024_56827_57789 317
54 3300044673 Ga0453683_0000064 Ga0453683_0000064_73444_74406 317
55 3300044673 Ga0453683_0053025 Ga0453683_0053025_166_1128 317
56 3300044712 Ga0453684_0000087 Ga0453684_0000087_184514_185476 317
57 3300044712 Ga0453684_0002090 Ga0453684_0002090_21781_22743 317
58 3300045051 Ga0451576_0225358 Ga0451576_0225358_400_1362 317
59 3300045051 Ga0451576_0254916 Ga0451576_0254916_535_1494 317
60 3300049571 Ga0501034_0453521 Ga0501034_0453521_32_988 317
61 3300005327 Ga0070658_10006240 Ga0070658_100062402 318
62 3300005331 Ga0070670_100081734 Ga0070670_1000817343 318
63 3300005331 Ga0070670_100121108 Ga0070670_1001211083 318
64 3300005335 Ga0070666_10167164 Ga0070666_101671641 318
65 3300005344 Ga0070661_100070419 Ga0070661_1000704193 318
66 3300005364 Ga0070673_100376498 Ga0070673_1003764982 318
67 3300005366 Ga0070659_100022053 Ga0070659_1000220535 318
68 3300005367 Ga0070667_100007302 Ga0070667_10000730210 318
69 3300005467 Ga0070706_100159500 Ga0070706_1001595002 318
70 3300005548 Ga0070665_100001162 Ga0070665_10000116229 318
71 3300005563 Ga0068855_100109374 Ga0068855_1001093744 318
72 3300005563 Ga0068855_100551878 Ga0068855_1005518781 318
73 3300005577 Ga0068857_100017402 Ga0068857_1000174029 318
74 3300005616 Ga0068852_100456214 Ga0068852_1004562141 318
75 3300005841 Ga0068863_100080320 Ga0068863_1000803203 318
76 3300005843 Ga0068860_100173527 Ga0068860_1001735271 318
77 3300005985 Ga0081539_10009883 Ga0081539_100098834 318
78 3300006028 Ga0070717_10180908 Ga0070717_101809082 318
79 3300009093 Ga0105240_10149164 Ga0105240_101491644 318
80 3300009174 Ga0105241_10129016 Ga0105241_101290162 318
81 3300009177 Ga0105248_10297933 Ga0105248_102979331 318
82 3300009551 Ga0105238_10073565 Ga0105238_100735652 318
83 3300010375 Ga0105239_10045440 Ga0105239_100454402 318
84 3300013105 Ga0157369_10094165 Ga0157369_100941654 318
85 3300013306 Ga0163162_10370149 Ga0163162_103701492 318
86 3300013307 Ga0157372_10065241 Ga0157372_100652414 318
87 3300013307 Ga0157372_10088199 Ga0157372_100881993 318
88 3300013307 Ga0157372_10215321 Ga0157372_102153212 318
89 3300013307 Ga0157372_10343656 Ga0157372_103436562 318
90 3300014968 Ga0157379_10119187 Ga0157379_101191872 318
91 3300025903 Ga0207680_10153610 Ga0207680_101536101 318
92 3300025909 Ga0207705_10005939 Ga0207705_1000593911 318
93 3300025910 Ga0207684_10131614 Ga0207684_101316142 318
94 3300025913 Ga0207695_10000211 Ga0207695_1000021119 318
95 3300025913 Ga0207695_10114724 Ga0207695_101147244 318
96 3300025920 Ga0207649_10033245 Ga0207649_100332453 318
97 3300025925 Ga0207650_10093813 Ga0207650_100938133 318
98 3300025929 Ga0207664_10117471 Ga0207664_101174713 318
99 3300025932 Ga0207690_10024713 Ga0207690_100247132 318
100 3300025944 Ga0207661_10135963 Ga0207661_101359632 318
101 3300025949 Ga0207667_10138426 Ga0207667_101384263 318
102 3300025960 Ga0207651_10233779 Ga0207651_102337792 318
103 3300025986 Ga0207658_10465913 Ga0207658_104659131 318
104 3300026116 Ga0207674_10000651 Ga0207674_1000065128 318
105 3300028379 Ga0268266_10000395 Ga0268266_1000039529 318
106 3300028381 Ga0268264_10038790 Ga0268264_100387902 318
107 3300028381 Ga0268264_10138403 Ga0268264_101384031 318
108 3300031548 Ga0307408_100277920 Ga0307408_1002779201 318
109 3300031824 Ga0307413_10018723 Ga0307413_100187234 318
110 3300031852 Ga0307410_10008691 Ga0307410_100086915 318
111 3300031995 Ga0307409_100001751 Ga0307409_10000175110 318
112 3300032005 Ga0307411_10100130 Ga0307411_101001302 318
113 3300037418 Ga0395900_0170913 Ga0395900_0170913_758_1732 318
114 3300037466 Ga0395898_0202972 Ga0395898_0202972_43_1029 318
115 3300037471 Ga0395905_0263838 Ga0395905_0263838_498_1481 318
116 3300038443 Ga0395901_0016587 Ga0395901_0016587_4840_5814 318
117 3300042876 Ga0451577_0185316 Ga0451577_0185316_315_1304 318
118 3300046454 Ga0495592_0151138 Ga0495592_0151138_486_1463 318
119 3300046511 Ga0495608_0150496 Ga0495608_0150496_360_1337 318
120 3300046517 Ga0495630_0001667 Ga0495630_0001667_8573_9550 318
121 3300046531 Ga0495665_0017696 Ga0495665_0017696_1612_2589 318
122 3300046559 Ga0495667_0031683 Ga0495667_0031683_776_1807 318
123 3300046689 Ga0495613_0035480 Ga0495613_0035480_36_1067 318
124 3300046690 Ga0495624_0041265 Ga0495624_0041265_860_1837 318
125 3300047319 Ga0495674_0143648 Ga0495674_0143648_517_1494 318
126 3300047322 Ga0495680_0193100 Ga0495680_0193100_300_1331 318
127 3300047444 Ga0495675_0183043 Ga0495675_0183043_52_1035 318
128 3300047471 Ga0495684_0004765 Ga0495684_0004765_9604_10581 318
129 3300047471 Ga0495684_0032813 Ga0495684_0032813_369_1400 318
130 3300049571 Ga0501034_0002131 Ga0501034_0002131_6636_7610 318
131 3300049571 Ga0501034_0003698 Ga0501034_0003698_8377_9339 318
132 3300049571 Ga0501034_0023365 Ga0501034_0023365_2140_3102 318
133 3300049581 Ga0501047_0072281 Ga0501047_0072281_1034_2014 318
134 3300049742 Ga0501080_0002086 Ga0501080_0002086_7383_8363 318
135 3300049823 Ga0501044_0010913 Ga0501044_0010913_3943_4923 318
136 3300049823 Ga0501044_0155879 Ga0501044_0155879_1145_2125 318
137 3300050511 nmdc:mga08y16_94373_c1 nmdc:mga08y16_94373_c1_680_1663 318
138 3300059647 Ga0587079_004350 Ga0587079_004350_623_1603 318
139 3300060344 Ga0587071_004071 Ga0587071_004071_320_1300 318
140 3300005331 Ga0070670_100113073 Ga0070670_1001130732 320
141 3300005354 Ga0070675_100220336 Ga0070675_1002203362 320
142 3300005471 Ga0070698_100302849 Ga0070698_1003028491 320
143 3300005548 Ga0070665_100000046 Ga0070665_100000046242 320
144 3300005617 Ga0068859_100505465 Ga0068859_1005054652 320
145 3300005842 Ga0068858_100189709 Ga0068858_1001897091 320
146 3300006931 Ga0097620_100505475 Ga0097620_1005054751 320
147 3300009094 Ga0111539_10002017 Ga0111539_1000201723 320
148 3300025925 Ga0207650_10026183 Ga0207650_100261833 320
149 3300026035 Ga0207703_10316966 Ga0207703_103169661 320
150 3300027907 Ga0207428_10033905 Ga0207428_100339056 320
151 3300028379 Ga0268266_10000164 Ga0268266_1000016467 320
152 3300031240 Ga0265320_10032916 Ga0265320_100329162 320
153 3300031711 Ga0265314_10098724 Ga0265314_100987242 320
154 3300032004 Ga0307414_10279061 Ga0307414_102790612 320
155 3300032005 Ga0307411_10337748 Ga0307411_103377482 320
156 3300049570 Ga0501033_0185419 Ga0501033_0185419_407_1399 320
157 3300049571 Ga0501034_0001447 Ga0501034_0001447_18010_19011 320
158 3300049571 Ga0501034_0001546 Ga0501034_0001546_322_1314 320
159 3300049571 Ga0501034_0238611 Ga0501034_0238611_278_1258 320
160 3300049572 Ga0501036_0118566 Ga0501036_0118566_1110_2102 320
161 3300049574 Ga0501038_0005549 Ga0501038_0005549_920_1912 320
162 3300049578 Ga0501042_0117928 Ga0501042_0117928_574_1554 320
163 3300049579 Ga0501043_0000351 Ga0501043_0000351_15328_16308 320
164 3300049579 Ga0501043_0072587 Ga0501043_0072587_188_1180 320
165 3300049580 Ga0501046_0000020 Ga0501046_0000020_47550_48530 320
166 3300049581 Ga0501047_0091407 Ga0501047_0091407_12_992 320
167 3300049582 Ga0501048_0034004 Ga0501048_0034004_341_1321 320
168 3300049589 Ga0501073_0023242 Ga0501073_0023242_2224_3207 320
169 3300049744 Ga0501083_0000005 Ga0501083_0000005_175380_176360 320
170 3300049744 Ga0501083_0010269 Ga0501083_0010269_4755_5738 320
171 3300049744 Ga0501083_0156652 Ga0501083_0156652_396_1379 320
172 3300049822 Ga0501035_0064488 Ga0501035_0064488_231_1223 320
173 3300049823 Ga0501044_0002290 Ga0501044_0002290_5754_6731 320
174 3300049823 Ga0501044_0071412 Ga0501044_0071412_335_1315 320
175 3300049823 Ga0501044_0522417 Ga0501044_0522417_77_1069 320
176 3300049824 Ga0501045_0096022 Ga0501045_0096022_1051_2031 320
177 3300050511 nmdc:mga08y16_1087_c1 nmdc:mga08y16_1087_c1_22852_23835 320
178 3300053153 Ga0500616_0000186 Ga0500616_0000186_39092_40108 320
179 3300060353 Ga0501082_0232599 Ga0501082_0232599_118_1101 320
180 3300005295 Ga0065707_10086594 Ga0065707_100865942 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13793

Pribosyltran_N

N-terminal domain of ribose phosphate pyrophosphokinase

29

145

0.99

PF14572

Pribosyl_synth

Phosphoribosyl synthetase-associated domain

217

338

0.92

PF00156

Pribosyltran

Phosphoribosyl transferase domain

175

298

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dah-assembly1.cif.gz_B 2.3 a crystal structure of ribose-phosphate pyrophosphokinase from burkholderia pseudomallei 0.9636 7 316
3dah-assembly1.cif.gz_A 2.3 a crystal structure of ribose-phosphate pyrophosphokinase from burkholderia pseudomallei 0.9622 7 312
3dah-assembly1.cif.gz_C 2.3 a crystal structure of ribose-phosphate pyrophosphokinase from burkholderia pseudomallei 0.9597 7 309
1dku-assembly1.cif.gz_A crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation. 0.9593 6 316
1dku-assembly1.cif.gz_A crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation. 0.9562 6 316
ID Description Score Start End Superfamily
af_P0A717_3_154_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9672 6 154 3.40.50.2020
af_P9WKE3_10_163_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9585 5 157 3.40.50.2020
1dkuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9575 151 293 3.40.50.2020
af_Q2G0S2_14_197_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9546 10 190 3.40.50.2020
af_Q5A4X7_6_146_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9505 10 149 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A7V2UKQ2-F1-model_v4 Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) 0.9936 6 95 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164
GO:0016301
AF-A0A7S0N5G1-F1-model_v4 ribose-phosphate diphosphokinase (EC 2.7.6.1) 0.9895 6 88 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164
GO:0016301
AF-A0A3S2B403-F1-model_v4 Phosphoribosylpyrophosphate synthetase 0.9884 8 94 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164
AF-A0A0B8Q225-F1-model_v4 deleted 0.987 4 96
AF-A0A520HHJ7-F1-model_v4 Phosphoribosylpyrophosphate synthetase 0.9864 8 93 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164

Feature Viewer

pLDDT pTM Quality
89.18 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map