F275610
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 180 | 124 | 178 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10370149|Ga0163162_103701492 |
| Length | 347 |
| Sequence | VSLEPETSSQPQATSSEPKKMLKADPDKIKIFTGRANPILAQRICDHLDVQLGRGKTELFPDGELIVKVDEDVRGRDCFIIQPTSHPINAHLMELFIWIDCLRRASASRVTAVIPYFGYARQDRKDEGRTPITAKLVANLLERAGADRVVSVDLHAAQVQGFFDIPVDHLSASPVLIKWFKTLKLSNRVFVSPDVGNVKRAQVYAGLLGGEICIIDKRRKSGKDTEAKNIIGEVEGKNVLMVDDMITTAGTVTEACKILKGHGVNEIYIAATHGVFAPPAMERLSKCDFTKLAVTDTIPIGDRANAIKDRLAVLSVAELLGEAIFRIHNNASVSALFKDEKGRAESE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2687453341 | Pirellula sp. SH-Sr6A | Isolate | Unclassified |
| 2 | 2836160341 | Unclassified Planctomycetes Bin 134 | Isolate | Unclassified |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 18 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 19 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 20 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 21 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 22 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 23 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 24 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 25 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 27 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 29 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 30 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 31 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 66 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 69 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 70 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 71 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 72 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 73 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 74 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 75 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 76 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 77 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 78 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 79 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 80 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 81 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 82 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 83 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 84 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 85 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 86 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 87 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 88 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 89 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 90 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 91 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 92 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 93 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 105 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 106 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 107 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 108 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 109 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 110 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 121 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 122 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.22 |
| Metatranscriptomes | 1.67 |
| Isolates | 1.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.11 |
| Nodule | 0 |
| Rhizoplane | 0.56 |
| Rhizosphere | 96.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10086594 | 3300005295 | Bacteria | 5390 |
| 2 | Ga0070658_10000641 | 3300005327 | Bacteria | 30217 |
| 3 | Ga0070658_10006240 | 3300005327 | Bacteria | 9657 |
| 4 | Ga0070670_100081734 | 3300005331 | Bacteria | 2776 |
| 5 | Ga0070670_100113073 | 3300005331 | Bacteria | 2340 |
| 6 | Ga0070670_100121108 | 3300005331 | Bacteria | 2257 |
| 7 | Ga0070666_10167164 | 3300005335 | Bacteria | 1539 |
| 8 | Ga0070661_100070419 | 3300005344 | Unclassified | 2572 |
| 9 | Ga0070675_100165803 | 3300005354 | Bacteria | 1902 |
| 10 | Ga0070675_100220336 | 3300005354 | Bacteria | 1652 |
| 11 | Ga0070671_100057464 | 3300005355 | Bacteria | 3238 |
| 12 | Ga0070673_100376498 | 3300005364 | Bacteria | 1265 |
| 13 | Ga0070659_100022053 | 3300005366 | Bacteria | 4860 |
| 14 | Ga0070667_100007302 | 3300005367 | Bacteria | 9189 |
| 15 | Ga0070711_100001454 | 3300005439 | Bacteria | 13018 |
| 16 | Ga0070706_100159500 | 3300005467 | Bacteria | 2106 |
| 17 | Ga0070698_100302849 | 3300005471 | Bacteria | 1529 |
| 18 | Ga0070665_100000046 | 3300005548 | Bacteria | 271885 |
| 19 | Ga0070665_100001162 | 3300005548 | Bacteria | 32364 |
| 20 | Ga0068855_100109374 | 3300005563 | Bacteria | 3174 |
| 21 | Ga0068855_100112321 | 3300005563 | Bacteria | 3127 |
| 22 | Ga0068855_100125769 | 3300005563 | Unclassified | 2931 |
| 23 | Ga0068855_100551878 | 3300005563 | Bacteria | 1247 |
| 24 | Ga0068857_100017402 | 3300005577 | Bacteria | 6298 |
| 25 | Ga0068854_100024404 | 3300005578 | Bacteria | 4140 |
| 26 | Ga0068852_100456214 | 3300005616 | Bacteria | 1266 |
| 27 | Ga0068859_100505465 | 3300005617 | Bacteria | 1304 |
| 28 | Ga0068863_100080320 | 3300005841 | Bacteria | 3089 |
| 29 | Ga0068858_100189709 | 3300005842 | Bacteria | 1942 |
| 30 | Ga0068860_100173527 | 3300005843 | Bacteria | 2083 |
| 31 | Ga0081455_10166503 | 3300005937 | Bacteria | 1683 |
| 32 | Ga0081539_10009883 | 3300005985 | Bacteria | 7868 |
| 33 | Ga0070717_10180908 | 3300006028 | Bacteria | 1838 |
| 34 | Ga0075362_10046997 | 3300006177 | Bacteria | 1921 |
| 35 | Ga0075428_100016681 | 3300006844 | Bacteria | 8110 |
| 36 | Ga0075431_100034395 | 3300006847 | Bacteria | 5220 |
| 37 | Ga0097620_100505475 | 3300006931 | Bacteria | 1304 |
| 38 | Ga0105240_10149164 | 3300009093 | Bacteria | 2787 |
| 39 | Ga0111539_10002017 | 3300009094 | Bacteria | 27101 |
| 40 | Ga0105241_10129016 | 3300009174 | Bacteria | 2045 |
| 41 | Ga0105248_10297933 | 3300009177 | Bacteria | 1816 |
| 42 | Ga0105248_10517931 | 3300009177 | Bacteria | 1345 |
| 43 | Ga0105238_10007696 | 3300009551 | Bacteria | 10773 |
| 44 | Ga0105238_10073565 | 3300009551 | Bacteria | 3412 |
| 45 | Ga0105239_10045440 | 3300010375 | Bacteria | 4813 |
| 46 | Ga0105239_10051892 | 3300010375 | Bacteria | 4496 |
| 47 | Ga0157370_10167661 | 3300013104 | Unclassified | 2042 |
| 48 | Ga0157369_10094165 | 3300013105 | Bacteria | 3197 |
| 49 | Ga0157369_10236497 | 3300013105 | Unclassified | 1909 |
| 50 | Ga0157374_10426566 | 3300013296 | Bacteria | 1325 |
| 51 | Ga0163162_10370149 | 3300013306 | Bacteria | 1566 |
| 52 | Ga0157372_10065241 | 3300013307 | Bacteria | 4087 |
| 53 | Ga0157372_10088199 | 3300013307 | Bacteria | 3522 |
| 54 | Ga0157372_10215321 | 3300013307 | Bacteria | 2226 |
| 55 | Ga0157372_10343656 | 3300013307 | Bacteria | 1738 |
| 56 | Ga0157379_10119187 | 3300014968 | Bacteria | 2374 |
| 57 | Ga0207680_10153610 | 3300025903 | Bacteria | 1537 |
| 58 | Ga0207705_10005939 | 3300025909 | Bacteria | 9082 |
| 59 | Ga0207705_10009730 | 3300025909 | Bacteria | 6993 |
| 60 | Ga0207684_10131614 | 3300025910 | Bacteria | 2147 |
| 61 | Ga0207695_10000211 | 3300025913 | Bacteria | 156467 |
| 62 | Ga0207695_10114724 | 3300025913 | Bacteria | 2668 |
| 63 | Ga0207649_10033245 | 3300025920 | Bacteria | 3080 |
| 64 | Ga0207650_10026183 | 3300025925 | Bacteria | 4157 |
| 65 | Ga0207650_10093813 | 3300025925 | Bacteria | 2298 |
| 66 | Ga0207687_10031414 | 3300025927 | Bacteria | 3588 |
| 67 | Ga0207664_10117471 | 3300025929 | Bacteria | 2221 |
| 68 | Ga0207644_10043617 | 3300025931 | Bacteria | 3184 |
| 69 | Ga0207690_10024713 | 3300025932 | Bacteria | 3765 |
| 70 | Ga0207670_10107976 | 3300025936 | Bacteria | 2000 |
| 71 | Ga0207691_10011591 | 3300025940 | Bacteria | 8465 |
| 72 | Ga0207661_10135963 | 3300025944 | Bacteria | 2111 |
| 73 | Ga0207667_10077093 | 3300025949 | Bacteria | 3458 |
| 74 | Ga0207667_10118154 | 3300025949 | Bacteria | 2732 |
| 75 | Ga0207667_10138426 | 3300025949 | Bacteria | 2506 |
| 76 | Ga0207651_10233779 | 3300025960 | Bacteria | 1494 |
| 77 | Ga0207640_10305203 | 3300025981 | Unclassified | 1261 |
| 78 | Ga0207658_10465913 | 3300025986 | Bacteria | 1121 |
| 79 | Ga0207703_10316966 | 3300026035 | Bacteria | 1427 |
| 80 | Ga0207702_10482398 | 3300026078 | Bacteria | 1207 |
| 81 | Ga0207674_10000651 | 3300026116 | Bacteria | 45182 |
| 82 | Ga0207698_10354077 | 3300026142 | Bacteria | 1388 |
| 83 | Ga0207428_10033905 | 3300027907 | Bacteria | 4187 |
| 84 | Ga0268266_10000164 | 3300028379 | Bacteria | 123070 |
| 85 | Ga0268266_10000395 | 3300028379 | Bacteria | 66128 |
| 86 | Ga0268264_10038790 | 3300028381 | Bacteria | 3933 |
| 87 | Ga0268264_10138403 | 3300028381 | Bacteria | 2168 |
| 88 | Ga0265338_10062339 | 3300028800 | Bacteria | 3259 |
| 89 | Ga0265332_10123170 | 3300031238 | Bacteria | 1089 |
| 90 | Ga0265320_10032916 | 3300031240 | Bacteria | 2650 |
| 91 | Ga0265339_10011550 | 3300031249 | Bacteria | 5430 |
| 92 | Ga0265327_10001799 | 3300031251 | Bacteria | 25157 |
| 93 | Ga0265316_10000016 | 3300031344 | Bacteria | 198693 |
| 94 | Ga0307408_100277920 | 3300031548 | Bacteria | 1393 |
| 95 | Ga0265314_10098724 | 3300031711 | Bacteria | 1882 |
| 96 | Ga0307413_10018723 | 3300031824 | Bacteria | 3641 |
| 97 | Ga0307410_10008691 | 3300031852 | Bacteria | 5648 |
| 98 | Ga0307409_100001751 | 3300031995 | Bacteria | 10962 |
| 99 | Ga0307409_100053355 | 3300031995 | Bacteria | 3106 |
| 100 | Ga0307414_10279061 | 3300032004 | Bacteria | 1403 |
| 101 | Ga0307411_10100130 | 3300032005 | Bacteria | 2047 |
| 102 | Ga0307411_10337748 | 3300032005 | Bacteria | 1223 |
| 103 | Ga0316593_10046981 | 3300032168 | Bacteria | 1450 |
| 104 | Ga0316582_0087766 | 3300036647 | Bacteria | 2042 |
| 105 | Ga0395900_0170913 | 3300037418 | Bacteria | 2213 |
| 106 | Ga0395898_0202972 | 3300037466 | Bacteria | 1892 |
| 107 | Ga0395905_0263838 | 3300037471 | Bacteria | 1608 |
| 108 | Ga0395901_0016587 | 3300038443 | Bacteria | 7506 |
| 109 | Ga0436363_0029752 | 3300039450 | Bacteria | 1145 |
| 110 | Ga0436362_1196195 | 3300039453 | Bacteria | 1075 |
| 111 | Ga0451577_0000011 | 3300042876 | Bacteria | 597389 |
| 112 | Ga0451577_0003059 | 3300042876 | Bacteria | 18968 |
| 113 | Ga0451577_0147053 | 3300042876 | Bacteria | 2119 |
| 114 | Ga0451577_0185316 | 3300042876 | Bacteria | 1877 |
| 115 | Ga0451577_0335163 | 3300042876 | Bacteria | 1372 |
| 116 | Ga0451577_0349509 | 3300042876 | Bacteria | 1341 |
| 117 | Ga0451577_0416439 | 3300042876 | Bacteria | 1220 |
| 118 | Ga0453683_0000024 | 3300044673 | Bacteria | 263554 |
| 119 | Ga0453683_0000064 | 3300044673 | Bacteria | 168322 |
| 120 | Ga0453683_0010763 | 3300044673 | Bacteria | 6056 |
| 121 | Ga0453683_0053025 | 3300044673 | Bacteria | 2538 |
| 122 | Ga0453684_0000087 | 3300044712 | Bacteria | 395597 |
| 123 | Ga0453684_0002090 | 3300044712 | Bacteria | 50591 |
| 124 | Ga0453684_0172053 | 3300044712 | Bacteria | 2551 |
| 125 | Ga0451576_0001908 | 3300045051 | Bacteria | 33406 |
| 126 | Ga0451576_0006227 | 3300045051 | Bacteria | 14693 |
| 127 | Ga0451576_0225358 | 3300045051 | Bacteria | 1957 |
| 128 | Ga0451576_0254916 | 3300045051 | Bacteria | 1834 |
| 129 | Ga0495592_0151138 | 3300046454 | Bacteria | 1606 |
| 130 | Ga0495608_0150496 | 3300046511 | Bacteria | 1483 |
| 131 | Ga0495630_0001667 | 3300046517 | Bacteria | 15452 |
| 132 | Ga0495665_0017696 | 3300046531 | Bacteria | 3832 |
| 133 | Ga0495667_0031683 | 3300046559 | Bacteria | 3547 |
| 134 | Ga0495613_0035480 | 3300046689 | Bacteria | 3700 |
| 135 | Ga0495624_0041265 | 3300046690 | Bacteria | 2952 |
| 136 | Ga0495674_0143648 | 3300047319 | Bacteria | 2004 |
| 137 | Ga0495680_0115407 | 3300047322 | Bacteria | 1987 |
| 138 | Ga0495680_0193100 | 3300047322 | Bacteria | 1464 |
| 139 | Ga0495675_0183043 | 3300047444 | Unclassified | 1282 |
| 140 | Ga0495684_0004765 | 3300047471 | Bacteria | 10602 |
| 141 | Ga0495684_0032813 | 3300047471 | Bacteria | 3989 |
| 142 | Ga0496109_0418901 | 3300048912 | Bacteria | 1265 |
| 143 | Ga0501033_0185419 | 3300049570 | Bacteria | 1491 |
| 144 | Ga0501034_0001447 | 3300049571 | Bacteria | 31489 |
| 145 | Ga0501034_0001546 | 3300049571 | Bacteria | 30225 |
| 146 | Ga0501034_0002131 | 3300049571 | Bacteria | 24586 |
| 147 | Ga0501034_0003698 | 3300049571 | Bacteria | 17269 |
| 148 | Ga0501034_0019788 | 3300049571 | Bacteria | 6881 |
| 149 | Ga0501034_0023365 | 3300049571 | Bacteria | 6300 |
| 150 | Ga0501034_0238611 | 3300049571 | Bacteria | 1765 |
| 151 | Ga0501034_0453521 | 3300049571 | Bacteria | 1200 |
| 152 | Ga0501036_0118566 | 3300049572 | Bacteria | 2235 |
| 153 | Ga0501038_0005549 | 3300049574 | Bacteria | 11716 |
| 154 | Ga0501042_0117928 | 3300049578 | Bacteria | 1911 |
| 155 | Ga0501043_0000351 | 3300049579 | Bacteria | 41929 |
| 156 | Ga0501043_0072587 | 3300049579 | Bacteria | 2704 |
| 157 | Ga0501046_0000020 | 3300049580 | Bacteria | 218268 |
| 158 | Ga0501047_0072281 | 3300049581 | Bacteria | 3320 |
| 159 | Ga0501047_0091407 | 3300049581 | Bacteria | 2921 |
| 160 | Ga0501048_0034004 | 3300049582 | Bacteria | 3680 |
| 161 | Ga0501073_0023242 | 3300049589 | Bacteria | 4454 |
| 162 | Ga0501080_0002086 | 3300049742 | Bacteria | 17356 |
| 163 | Ga0501083_0000005 | 3300049744 | Bacteria | 206200 |
| 164 | Ga0501083_0010269 | 3300049744 | Bacteria | 6597 |
| 165 | Ga0501083_0156652 | 3300049744 | Bacteria | 1491 |
| 166 | Ga0501035_0064488 | 3300049822 | Bacteria | 3256 |
| 167 | Ga0501044_0002290 | 3300049823 | Bacteria | 21807 |
| 168 | Ga0501044_0010913 | 3300049823 | Bacteria | 9861 |
| 169 | Ga0501044_0071412 | 3300049823 | Bacteria | 3530 |
| 170 | Ga0501044_0155879 | 3300049823 | Bacteria | 2263 |
| 171 | Ga0501044_0522417 | 3300049823 | Bacteria | 1087 |
| 172 | Ga0501045_0096022 | 3300049824 | Bacteria | 2193 |
| 173 | nmdc:mga08y16_1087_c1 | 3300050511 | Bacteria | 26773 |
| 174 | nmdc:mga08y16_94373_c1 | 3300050511 | Bacteria | 3116 |
| 175 | Ga0500616_0000186 | 3300053153 | Bacteria | 102009 |
| 176 | Ga0587079_004350 | 3300059647 | Bacteria | 1922 |
| 177 | Ga0587071_004071 | 3300060344 | Bacteria | 2151 |
| 178 | Ga0501082_0232599 | 3300060353 | Bacteria | 1604 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047322 | Ga0495680_0115407 | Ga0495680_0115407_716_1723 | 288 |
| 2 | 3300005355 | Ga0070671_100057464 | Ga0070671_1000574642 | 293 |
| 3 | 3300025931 | Ga0207644_10043617 | Ga0207644_100436172 | 293 |
| 4 | 3300048912 | Ga0496109_0418901 | Ga0496109_0418901_61_1050 | 293 |
| 5 | 3300005354 | Ga0070675_100165803 | Ga0070675_1001658031 | 300 |
| 6 | 3300025940 | Ga0207691_10011591 | Ga0207691_100115912 | 300 |
| 7 | 3300042876 | Ga0451577_0349509 | Ga0451577_0349509_365_1324 | 302 |
| 8 | 3300044673 | Ga0453683_0010763 | Ga0453683_0010763_867_1826 | 302 |
| 9 | 3300045051 | Ga0451576_0006227 | Ga0451576_0006227_8239_9198 | 302 |
| 10 | 3300042876 | Ga0451577_0335163 | Ga0451577_0335163_376_1335 | 303 |
| 11 | 3300045051 | Ga0451576_0001908 | Ga0451576_0001908_10131_11102 | 305 |
| 12 | 3300009177 | Ga0105248_10517931 | Ga0105248_105179312 | 308 |
| 13 | 3300025936 | Ga0207670_10107976 | Ga0207670_101079762 | 308 |
| 14 | 3300026078 | Ga0207702_10482398 | Ga0207702_104823981 | 311 |
| 15 | 3300042876 | Ga0451577_0416439 | Ga0451577_0416439_229_1170 | 311 |
| 16 | 3300044712 | Ga0453684_0172053 | Ga0453684_0172053_781_1722 | 311 |
| 17 | iso_pu_bacteria | 2836160341 | 2836161685 | 311 |
| 18 | 3300006177 | Ga0075362_10046997 | Ga0075362_100469972 | 312 |
| 19 | 3300042876 | Ga0451577_0003059 | Ga0451577_0003059_106_1047 | 312 |
| 20 | 3300005439 | Ga0070711_100001454 | Ga0070711_1000014548 | 313 |
| 21 | 3300025927 | Ga0207687_10031414 | Ga0207687_100314143 | 313 |
| 22 | 3300036647 | Ga0316582_0087766 | Ga0316582_0087766_937_1911 | 313 |
| 23 | 3300005937 | Ga0081455_10166503 | Ga0081455_101665032 | 314 |
| 24 | 3300006847 | Ga0075431_100034395 | Ga0075431_1000343953 | 314 |
| 25 | 3300049571 | Ga0501034_0019788 | Ga0501034_0019788_4858_5802 | 314 |
| 26 | iso_pu_bacteria | 2687453341 | 2688394361 | 314 |
| 27 | 3300005327 | Ga0070658_10000641 | Ga0070658_1000064115 | 315 |
| 28 | 3300005563 | Ga0068855_100112321 | Ga0068855_1001123212 | 315 |
| 29 | 3300009551 | Ga0105238_10007696 | Ga0105238_100076967 | 315 |
| 30 | 3300010375 | Ga0105239_10051892 | Ga0105239_100518923 | 315 |
| 31 | 3300013296 | Ga0157374_10426566 | Ga0157374_104265661 | 315 |
| 32 | 3300025909 | Ga0207705_10009730 | Ga0207705_100097301 | 315 |
| 33 | 3300025949 | Ga0207667_10077093 | Ga0207667_100770934 | 315 |
| 34 | 3300031251 | Ga0265327_10001799 | Ga0265327_100017998 | 315 |
| 35 | 3300031344 | Ga0265316_10000016 | Ga0265316_10000016101 | 315 |
| 36 | 3300005563 | Ga0068855_100125769 | Ga0068855_1001257692 | 316 |
| 37 | 3300005578 | Ga0068854_100024404 | Ga0068854_1000244045 | 316 |
| 38 | 3300006844 | Ga0075428_100016681 | Ga0075428_1000166812 | 316 |
| 39 | 3300025949 | Ga0207667_10118154 | Ga0207667_101181542 | 316 |
| 40 | 3300025981 | Ga0207640_10305203 | Ga0207640_103052032 | 316 |
| 41 | 3300028800 | Ga0265338_10062339 | Ga0265338_100623393 | 316 |
| 42 | 3300031238 | Ga0265332_10123170 | Ga0265332_101231701 | 316 |
| 43 | 3300031249 | Ga0265339_10011550 | Ga0265339_100115508 | 316 |
| 44 | 3300032168 | Ga0316593_10046981 | Ga0316593_100469812 | 316 |
| 45 | 3300013104 | Ga0157370_10167661 | Ga0157370_101676613 | 317 |
| 46 | 3300013105 | Ga0157369_10236497 | Ga0157369_102364971 | 317 |
| 47 | 3300026142 | Ga0207698_10354077 | Ga0207698_103540772 | 317 |
| 48 | 3300031995 | Ga0307409_100053355 | Ga0307409_1000533552 | 317 |
| 49 | 3300039450 | Ga0436363_0029752 | Ga0436363_0029752_111_1064 | 317 |
| 50 | 3300039453 | Ga0436362_1196195 | Ga0436362_1196195_41_1006 | 317 |
| 51 | 3300042876 | Ga0451577_0000011 | Ga0451577_0000011_162611_163573 | 317 |
| 52 | 3300042876 | Ga0451577_0147053 | Ga0451577_0147053_1090_2052 | 317 |
| 53 | 3300044673 | Ga0453683_0000024 | Ga0453683_0000024_56827_57789 | 317 |
| 54 | 3300044673 | Ga0453683_0000064 | Ga0453683_0000064_73444_74406 | 317 |
| 55 | 3300044673 | Ga0453683_0053025 | Ga0453683_0053025_166_1128 | 317 |
| 56 | 3300044712 | Ga0453684_0000087 | Ga0453684_0000087_184514_185476 | 317 |
| 57 | 3300044712 | Ga0453684_0002090 | Ga0453684_0002090_21781_22743 | 317 |
| 58 | 3300045051 | Ga0451576_0225358 | Ga0451576_0225358_400_1362 | 317 |
| 59 | 3300045051 | Ga0451576_0254916 | Ga0451576_0254916_535_1494 | 317 |
| 60 | 3300049571 | Ga0501034_0453521 | Ga0501034_0453521_32_988 | 317 |
| 61 | 3300005327 | Ga0070658_10006240 | Ga0070658_100062402 | 318 |
| 62 | 3300005331 | Ga0070670_100081734 | Ga0070670_1000817343 | 318 |
| 63 | 3300005331 | Ga0070670_100121108 | Ga0070670_1001211083 | 318 |
| 64 | 3300005335 | Ga0070666_10167164 | Ga0070666_101671641 | 318 |
| 65 | 3300005344 | Ga0070661_100070419 | Ga0070661_1000704193 | 318 |
| 66 | 3300005364 | Ga0070673_100376498 | Ga0070673_1003764982 | 318 |
| 67 | 3300005366 | Ga0070659_100022053 | Ga0070659_1000220535 | 318 |
| 68 | 3300005367 | Ga0070667_100007302 | Ga0070667_10000730210 | 318 |
| 69 | 3300005467 | Ga0070706_100159500 | Ga0070706_1001595002 | 318 |
| 70 | 3300005548 | Ga0070665_100001162 | Ga0070665_10000116229 | 318 |
| 71 | 3300005563 | Ga0068855_100109374 | Ga0068855_1001093744 | 318 |
| 72 | 3300005563 | Ga0068855_100551878 | Ga0068855_1005518781 | 318 |
| 73 | 3300005577 | Ga0068857_100017402 | Ga0068857_1000174029 | 318 |
| 74 | 3300005616 | Ga0068852_100456214 | Ga0068852_1004562141 | 318 |
| 75 | 3300005841 | Ga0068863_100080320 | Ga0068863_1000803203 | 318 |
| 76 | 3300005843 | Ga0068860_100173527 | Ga0068860_1001735271 | 318 |
| 77 | 3300005985 | Ga0081539_10009883 | Ga0081539_100098834 | 318 |
| 78 | 3300006028 | Ga0070717_10180908 | Ga0070717_101809082 | 318 |
| 79 | 3300009093 | Ga0105240_10149164 | Ga0105240_101491644 | 318 |
| 80 | 3300009174 | Ga0105241_10129016 | Ga0105241_101290162 | 318 |
| 81 | 3300009177 | Ga0105248_10297933 | Ga0105248_102979331 | 318 |
| 82 | 3300009551 | Ga0105238_10073565 | Ga0105238_100735652 | 318 |
| 83 | 3300010375 | Ga0105239_10045440 | Ga0105239_100454402 | 318 |
| 84 | 3300013105 | Ga0157369_10094165 | Ga0157369_100941654 | 318 |
| 85 | 3300013306 | Ga0163162_10370149 | Ga0163162_103701492 | 318 |
| 86 | 3300013307 | Ga0157372_10065241 | Ga0157372_100652414 | 318 |
| 87 | 3300013307 | Ga0157372_10088199 | Ga0157372_100881993 | 318 |
| 88 | 3300013307 | Ga0157372_10215321 | Ga0157372_102153212 | 318 |
| 89 | 3300013307 | Ga0157372_10343656 | Ga0157372_103436562 | 318 |
| 90 | 3300014968 | Ga0157379_10119187 | Ga0157379_101191872 | 318 |
| 91 | 3300025903 | Ga0207680_10153610 | Ga0207680_101536101 | 318 |
| 92 | 3300025909 | Ga0207705_10005939 | Ga0207705_1000593911 | 318 |
| 93 | 3300025910 | Ga0207684_10131614 | Ga0207684_101316142 | 318 |
| 94 | 3300025913 | Ga0207695_10000211 | Ga0207695_1000021119 | 318 |
| 95 | 3300025913 | Ga0207695_10114724 | Ga0207695_101147244 | 318 |
| 96 | 3300025920 | Ga0207649_10033245 | Ga0207649_100332453 | 318 |
| 97 | 3300025925 | Ga0207650_10093813 | Ga0207650_100938133 | 318 |
| 98 | 3300025929 | Ga0207664_10117471 | Ga0207664_101174713 | 318 |
| 99 | 3300025932 | Ga0207690_10024713 | Ga0207690_100247132 | 318 |
| 100 | 3300025944 | Ga0207661_10135963 | Ga0207661_101359632 | 318 |
| 101 | 3300025949 | Ga0207667_10138426 | Ga0207667_101384263 | 318 |
| 102 | 3300025960 | Ga0207651_10233779 | Ga0207651_102337792 | 318 |
| 103 | 3300025986 | Ga0207658_10465913 | Ga0207658_104659131 | 318 |
| 104 | 3300026116 | Ga0207674_10000651 | Ga0207674_1000065128 | 318 |
| 105 | 3300028379 | Ga0268266_10000395 | Ga0268266_1000039529 | 318 |
| 106 | 3300028381 | Ga0268264_10038790 | Ga0268264_100387902 | 318 |
| 107 | 3300028381 | Ga0268264_10138403 | Ga0268264_101384031 | 318 |
| 108 | 3300031548 | Ga0307408_100277920 | Ga0307408_1002779201 | 318 |
| 109 | 3300031824 | Ga0307413_10018723 | Ga0307413_100187234 | 318 |
| 110 | 3300031852 | Ga0307410_10008691 | Ga0307410_100086915 | 318 |
| 111 | 3300031995 | Ga0307409_100001751 | Ga0307409_10000175110 | 318 |
| 112 | 3300032005 | Ga0307411_10100130 | Ga0307411_101001302 | 318 |
| 113 | 3300037418 | Ga0395900_0170913 | Ga0395900_0170913_758_1732 | 318 |
| 114 | 3300037466 | Ga0395898_0202972 | Ga0395898_0202972_43_1029 | 318 |
| 115 | 3300037471 | Ga0395905_0263838 | Ga0395905_0263838_498_1481 | 318 |
| 116 | 3300038443 | Ga0395901_0016587 | Ga0395901_0016587_4840_5814 | 318 |
| 117 | 3300042876 | Ga0451577_0185316 | Ga0451577_0185316_315_1304 | 318 |
| 118 | 3300046454 | Ga0495592_0151138 | Ga0495592_0151138_486_1463 | 318 |
| 119 | 3300046511 | Ga0495608_0150496 | Ga0495608_0150496_360_1337 | 318 |
| 120 | 3300046517 | Ga0495630_0001667 | Ga0495630_0001667_8573_9550 | 318 |
| 121 | 3300046531 | Ga0495665_0017696 | Ga0495665_0017696_1612_2589 | 318 |
| 122 | 3300046559 | Ga0495667_0031683 | Ga0495667_0031683_776_1807 | 318 |
| 123 | 3300046689 | Ga0495613_0035480 | Ga0495613_0035480_36_1067 | 318 |
| 124 | 3300046690 | Ga0495624_0041265 | Ga0495624_0041265_860_1837 | 318 |
| 125 | 3300047319 | Ga0495674_0143648 | Ga0495674_0143648_517_1494 | 318 |
| 126 | 3300047322 | Ga0495680_0193100 | Ga0495680_0193100_300_1331 | 318 |
| 127 | 3300047444 | Ga0495675_0183043 | Ga0495675_0183043_52_1035 | 318 |
| 128 | 3300047471 | Ga0495684_0004765 | Ga0495684_0004765_9604_10581 | 318 |
| 129 | 3300047471 | Ga0495684_0032813 | Ga0495684_0032813_369_1400 | 318 |
| 130 | 3300049571 | Ga0501034_0002131 | Ga0501034_0002131_6636_7610 | 318 |
| 131 | 3300049571 | Ga0501034_0003698 | Ga0501034_0003698_8377_9339 | 318 |
| 132 | 3300049571 | Ga0501034_0023365 | Ga0501034_0023365_2140_3102 | 318 |
| 133 | 3300049581 | Ga0501047_0072281 | Ga0501047_0072281_1034_2014 | 318 |
| 134 | 3300049742 | Ga0501080_0002086 | Ga0501080_0002086_7383_8363 | 318 |
| 135 | 3300049823 | Ga0501044_0010913 | Ga0501044_0010913_3943_4923 | 318 |
| 136 | 3300049823 | Ga0501044_0155879 | Ga0501044_0155879_1145_2125 | 318 |
| 137 | 3300050511 | nmdc:mga08y16_94373_c1 | nmdc:mga08y16_94373_c1_680_1663 | 318 |
| 138 | 3300059647 | Ga0587079_004350 | Ga0587079_004350_623_1603 | 318 |
| 139 | 3300060344 | Ga0587071_004071 | Ga0587071_004071_320_1300 | 318 |
| 140 | 3300005331 | Ga0070670_100113073 | Ga0070670_1001130732 | 320 |
| 141 | 3300005354 | Ga0070675_100220336 | Ga0070675_1002203362 | 320 |
| 142 | 3300005471 | Ga0070698_100302849 | Ga0070698_1003028491 | 320 |
| 143 | 3300005548 | Ga0070665_100000046 | Ga0070665_100000046242 | 320 |
| 144 | 3300005617 | Ga0068859_100505465 | Ga0068859_1005054652 | 320 |
| 145 | 3300005842 | Ga0068858_100189709 | Ga0068858_1001897091 | 320 |
| 146 | 3300006931 | Ga0097620_100505475 | Ga0097620_1005054751 | 320 |
| 147 | 3300009094 | Ga0111539_10002017 | Ga0111539_1000201723 | 320 |
| 148 | 3300025925 | Ga0207650_10026183 | Ga0207650_100261833 | 320 |
| 149 | 3300026035 | Ga0207703_10316966 | Ga0207703_103169661 | 320 |
| 150 | 3300027907 | Ga0207428_10033905 | Ga0207428_100339056 | 320 |
| 151 | 3300028379 | Ga0268266_10000164 | Ga0268266_1000016467 | 320 |
| 152 | 3300031240 | Ga0265320_10032916 | Ga0265320_100329162 | 320 |
| 153 | 3300031711 | Ga0265314_10098724 | Ga0265314_100987242 | 320 |
| 154 | 3300032004 | Ga0307414_10279061 | Ga0307414_102790612 | 320 |
| 155 | 3300032005 | Ga0307411_10337748 | Ga0307411_103377482 | 320 |
| 156 | 3300049570 | Ga0501033_0185419 | Ga0501033_0185419_407_1399 | 320 |
| 157 | 3300049571 | Ga0501034_0001447 | Ga0501034_0001447_18010_19011 | 320 |
| 158 | 3300049571 | Ga0501034_0001546 | Ga0501034_0001546_322_1314 | 320 |
| 159 | 3300049571 | Ga0501034_0238611 | Ga0501034_0238611_278_1258 | 320 |
| 160 | 3300049572 | Ga0501036_0118566 | Ga0501036_0118566_1110_2102 | 320 |
| 161 | 3300049574 | Ga0501038_0005549 | Ga0501038_0005549_920_1912 | 320 |
| 162 | 3300049578 | Ga0501042_0117928 | Ga0501042_0117928_574_1554 | 320 |
| 163 | 3300049579 | Ga0501043_0000351 | Ga0501043_0000351_15328_16308 | 320 |
| 164 | 3300049579 | Ga0501043_0072587 | Ga0501043_0072587_188_1180 | 320 |
| 165 | 3300049580 | Ga0501046_0000020 | Ga0501046_0000020_47550_48530 | 320 |
| 166 | 3300049581 | Ga0501047_0091407 | Ga0501047_0091407_12_992 | 320 |
| 167 | 3300049582 | Ga0501048_0034004 | Ga0501048_0034004_341_1321 | 320 |
| 168 | 3300049589 | Ga0501073_0023242 | Ga0501073_0023242_2224_3207 | 320 |
| 169 | 3300049744 | Ga0501083_0000005 | Ga0501083_0000005_175380_176360 | 320 |
| 170 | 3300049744 | Ga0501083_0010269 | Ga0501083_0010269_4755_5738 | 320 |
| 171 | 3300049744 | Ga0501083_0156652 | Ga0501083_0156652_396_1379 | 320 |
| 172 | 3300049822 | Ga0501035_0064488 | Ga0501035_0064488_231_1223 | 320 |
| 173 | 3300049823 | Ga0501044_0002290 | Ga0501044_0002290_5754_6731 | 320 |
| 174 | 3300049823 | Ga0501044_0071412 | Ga0501044_0071412_335_1315 | 320 |
| 175 | 3300049823 | Ga0501044_0522417 | Ga0501044_0522417_77_1069 | 320 |
| 176 | 3300049824 | Ga0501045_0096022 | Ga0501045_0096022_1051_2031 | 320 |
| 177 | 3300050511 | nmdc:mga08y16_1087_c1 | nmdc:mga08y16_1087_c1_22852_23835 | 320 |
| 178 | 3300053153 | Ga0500616_0000186 | Ga0500616_0000186_39092_40108 | 320 |
| 179 | 3300060353 | Ga0501082_0232599 | Ga0501082_0232599_118_1101 | 320 |
| 180 | 3300005295 | Ga0065707_10086594 | Ga0065707_100865942 | 321 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dah-assembly1.cif.gz_B | 2.3 a crystal structure of ribose-phosphate pyrophosphokinase from burkholderia pseudomallei | 0.9636 | 7 | 316 |
| 3dah-assembly1.cif.gz_A | 2.3 a crystal structure of ribose-phosphate pyrophosphokinase from burkholderia pseudomallei | 0.9622 | 7 | 312 |
| 3dah-assembly1.cif.gz_C | 2.3 a crystal structure of ribose-phosphate pyrophosphokinase from burkholderia pseudomallei | 0.9597 | 7 | 309 |
| 1dku-assembly1.cif.gz_A | crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation. | 0.9593 | 6 | 316 |
| 1dku-assembly1.cif.gz_A | crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation. | 0.9562 | 6 | 316 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A717_3_154_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9672 | 6 | 154 | 3.40.50.2020 |
| af_P9WKE3_10_163_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9585 | 5 | 157 | 3.40.50.2020 |
| 1dkuA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9575 | 151 | 293 | 3.40.50.2020 |
| af_Q2G0S2_14_197_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9546 | 10 | 190 | 3.40.50.2020 |
| af_Q5A4X7_6_146_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9505 | 10 | 149 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V2UKQ2-F1-model_v4 | Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) | 0.9936 | 6 | 95 |
GO:0000287
GO:0002189 GO:0004749 GO:0005737 GO:0006015 GO:0006164 GO:0016301 |
| AF-A0A7S0N5G1-F1-model_v4 | ribose-phosphate diphosphokinase (EC 2.7.6.1) | 0.9895 | 6 | 88 |
GO:0000287
GO:0002189 GO:0004749 GO:0005737 GO:0006015 GO:0006164 GO:0016301 |
| AF-A0A3S2B403-F1-model_v4 | Phosphoribosylpyrophosphate synthetase | 0.9884 | 8 | 94 |
GO:0000287
GO:0002189 GO:0004749 GO:0005737 GO:0006015 GO:0006164 |
| AF-A0A0B8Q225-F1-model_v4 | deleted | 0.987 | 4 | 96 |
|
| AF-A0A520HHJ7-F1-model_v4 | Phosphoribosylpyrophosphate synthetase | 0.9864 | 8 | 93 |
GO:0000287
GO:0002189 GO:0004749 GO:0005737 GO:0006015 GO:0006164 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar