F275296

General Info

Members Datasets Scaffolds Average Seq Length
180 133 360 298

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100478691|Ga0068863_1004786912
Length 326
Sequence MAPADDPPRQGPMNWLSNFVRPKLQALVRKTEVPENLWHKCQVCGQMIFHRELEANLRVCTHCGHHMRIGVQRRLELLFDDGDFQRIELPRSEPDPLKFRDKKRYSDRLRESQARTGEPDAVIVAHGKMGGIGVVIAAFNFDFMGGSMGTAVGEGLIAAARLAVLQEAPLIAIPASGGARMQEGILSLMQMPRTIIAVDEVKDAGLPYIVLLTDPTTGGVSASFAMLGDIAIAEPGAVIGFAGARVIEETIREKLPEGFQRAEYLLQHGMVDLVVPRRDLRDKLIAIVTLLRNPGPAAPVVPLDGSGGPPPEIIDVPAQLPGPSAE

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
28 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
29 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
30 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
46 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
47 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
48 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
58 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
59 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
60 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
72 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
73 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
74 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
75 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
91 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
96 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
127 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
131 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
132 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
133 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.89
Nodule 0
Rhizoplane 0.56
Rhizosphere 89.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100478691 3300005841 Bacteria 1224
2 Ga0055536_1034421 3300003781 Bacteria 1279
3 Ga0070671_100062879 3300005355 Bacteria 3090
4 Ga0070674_100105695 3300005356 Bacteria 2059
5 Ga0070714_100007802 3300005435 Bacteria 8337
6 Ga0070713_100139487 3300005436 Bacteria 2146
7 Ga0070694_100172520 3300005444 Bacteria 1594
8 Ga0070708_100091025 3300005445 Bacteria 2777
9 Ga0070708_100263303 3300005445 Bacteria 1621
10 Ga0070681_10066234 3300005458 Bacteria 3581
11 Ga0070706_100126930 3300005467 Bacteria 2379
12 Ga0070707_100006823 3300005468 Bacteria 10576
13 Ga0070698_100104911 3300005471 Bacteria 2796
14 Ga0070679_100231353 3300005530 Bacteria 1808
15 Ga0070697_100052370 3300005536 Bacteria 3316
16 Ga0068853_100296737 3300005539 Bacteria 1493
17 Ga0068856_100566864 3300005614 Bacteria 1157
18 Ga0068861_100023125 3300005719 Bacteria 4481
19 Ga0068862_100224010 3300005844 Bacteria 1704
20 Ga0075436_100211259 3300006914 Bacteria 1376
21 Ga0105238_10339917 3300009551 Bacteria 1489
22 Ga0105030_101755 3300009987 Bacteria 1913
23 Ga0157370_10032575 3300013104 Bacteria 5088
24 Ga0157369_10013799 3300013105 Bacteria 9132
25 Ga0157369_10560207 3300013105 Bacteria 1181
26 Ga0157372_10533670 3300013307 Bacteria 1368
27 Ga0157380_10035057 3300014326 Bacteria 3874
28 Ga0157379_10346359 3300014968 Bacteria 1360
29 Ga0213873_10009246 3300021358 Bacteria 2040
30 Ga0213872_10000787 3300021361 Bacteria 23207
31 Ga0213872_10000884 3300021361 Bacteria 21651
32 Ga0213872_10007922 3300021361 Bacteria 5182
33 Ga0213872_10061597 3300021361 Bacteria 1696
34 Ga0213875_10054379 3300021388 Bacteria 1875
35 Ga0209148_1000484 3300025254 Bacteria 41477
36 Ga0209455_1000832 3300025272 Bacteria 16654
37 Ga0209676_1000269 3300025292 Bacteria 108375
38 Ga0209564_1034805 3300025295 Bacteria 1470
39 Ga0209050_1022934 3300025298 Bacteria 2217
40 Ga0207684_10097443 3300025910 Bacteria 2511
41 Ga0207707_10007274 3300025912 Bacteria 9638
42 Ga0207707_10056496 3300025912 Bacteria 3415
43 Ga0207652_10184356 3300025921 Bacteria 1876
44 Ga0207652_10303830 3300025921 Bacteria 1440
45 Ga0207681_10472030 3300025923 Bacteria 1023
46 Ga0207700_10377206 3300025928 Bacteria 1239
47 Ga0207664_10010757 3300025929 Bacteria 6472
48 Ga0207644_10217655 3300025931 Bacteria 1512
49 Ga0207639_10201659 3300026041 Bacteria 1707
50 Ga0207641_10349951 3300026088 Bacteria 1408
51 Ga0207675_100116692 3300026118 Bacteria 2523
52 Ga0265338_10095782 3300028800 Bacteria 2437
53 Ga0265325_10087387 3300031241 Bacteria 1541
54 Ga0265339_10012037 3300031249 Bacteria 5302
55 Ga0265331_10002461 3300031250 Bacteria 12529
56 Ga0265327_10000070 3300031251 Bacteria 217350
57 Ga0265327_10000292 3300031251 Bacteria 97787
58 Ga0265313_10000545 3300031595 Bacteria 39280
59 Ga0265314_10028680 3300031711 Bacteria 4147
60 Ga0265314_10069794 3300031711 Bacteria 2357
61 Ga0265342_10012491 3300031712 Bacteria 5750
62 Ga0307413_10041702 3300031824 Bacteria 2690
63 Ga0307407_10027496 3300031903 Bacteria 3028
64 Ga0307409_100494633 3300031995 Bacteria 1189
65 Ga0307416_100087044 3300032002 Bacteria 2666
66 Ga0307416_100606616 3300032002 Bacteria 1175
67 Ga0373923_0073854 3300035111 Bacteria 1469
68 Ga0373956_0088755 3300035119 Bacteria 1425
69 Ga0373955_0216938 3300035172 Bacteria 1142
70 Ga0373935_0124300 3300035692 Bacteria 1727
71 Ga0373947_0089730 3300035725 Bacteria 1915
72 Ga0373937_0030838 3300036401 Bacteria 4856
73 Ga0373937_0033125 3300036401 Bacteria 4690
74 Ga0373937_0036645 3300036401 Bacteria 4470
75 Ga0373937_0050589 3300036401 Bacteria 3806
76 Ga0373925_0087556 3300037068 Bacteria 2377
77 Ga0373925_0194580 3300037068 Bacteria 1610
78 Ga0373925_0281817 3300037068 Bacteria 1339
79 Ga0395899_0000983 3300037312 Bacteria 26284
80 Ga0395900_0001992 3300037418 Bacteria 23054
81 Ga0395900_0430719 3300037418 Bacteria 1278
82 Ga0395898_0001363 3300037466 Bacteria 35174
83 Ga0395905_0227392 3300037471 Bacteria 1745
84 Ga0436364_0358649 3300037853 Bacteria 15613
85 Ga0436364_1057208 3300037853 Bacteria 9165
86 Ga0436364_1230720 3300037853 Bacteria 3468
87 Ga0436364_1392595 3300037853 Bacteria 2636
88 Ga0436364_1561834 3300037853 Bacteria 1544
89 Ga0395901_0002638 3300038443 Bacteria 18119
90 Ga0436365_0541972 3300039437 Bacteria 2125
91 Ga0436365_1413502 3300039437 Bacteria 1608
92 Ga0436360_0001715 3300039438 Bacteria 1943
93 Ga0436360_0016813 3300039438 Bacteria 3835
94 Ga0436360_0264666 3300039438 Bacteria 2152
95 Ga0436361_0011952 3300039447 Bacteria 12686
96 Ga0436361_0361031 3300039447 Bacteria 7238
97 Ga0436361_0682023 3300039447 Bacteria 36494
98 Ga0436361_0963613 3300039447 Bacteria 4150
99 Ga0436362_0395899 3300039453 Bacteria 2310
100 Ga0451577_0192832 3300042876 Bacteria 1838
101 Ga0466966_0022111 3300044684 Bacteria 4176
102 Ga0453684_0000204 3300044712 Bacteria 258105
103 Ga0453684_0001066 3300044712 Bacteria 87216
104 Ga0453684_0052353 3300044712 Bacteria 5340
105 Ga0453684_0120350 3300044712 Bacteria 3171
106 Ga0466957_0031318 3300044842 Bacteria 3178
107 Ga0466957_0179044 3300044842 Bacteria 1384
108 Ga0451576_0001285 3300045051 Bacteria 43656
109 Ga0451576_0002096 3300045051 Bacteria 31090
110 Ga0451576_0058615 3300045051 Bacteria 4023
111 Ga0466958_0034408 3300045836 Bacteria 3022
112 Ga0466967_0162060 3300045976 Bacteria 2100
113 Ga0495592_0067685 3300046454 Bacteria 2609
114 Ga0495653_0103960 3300046463 Bacteria 2053
115 Ga0495608_0115075 3300046511 Bacteria 1727
116 Ga0495652_0148813 3300046529 Bacteria 1832
117 Ga0495640_0075784 3300046533 Bacteria 2246
118 Ga0495645_0131668 3300046543 Bacteria 1752
119 Ga0495667_0018751 3300046559 Bacteria 4670
120 Ga0495634_0049954 3300046642 Bacteria 2810
121 Ga0495657_0169723 3300046675 Bacteria 1344
122 Ga0495599_0111108 3300046678 Bacteria 1707
123 Ga0495600_0045661 3300046809 Bacteria 2859
124 Ga0495604_0107002 3300047317 Bacteria 2045
125 Ga0495680_0091798 3300047322 Bacteria 2276
126 Ga0495680_0108645 3300047322 Bacteria 2058
127 Ga0496112_0372395 3300048915 Bacteria 1370
128 Ga0496119_0013907 3300048922 Bacteria 6349
129 Ga0496126_0262152 3300048929 Bacteria 1437
130 Ga0501032_0000047 3300049569 Bacteria 108107
131 Ga0501032_0016136 3300049569 Bacteria 5257
132 Ga0501033_0001674 3300049570 Bacteria 19374
133 Ga0501033_0101043 3300049570 Bacteria 2104
134 Ga0501034_0000001 3300049571 Bacteria 2184493
135 Ga0501034_0027130 3300049571 Bacteria 5826
136 Ga0501036_0019810 3300049572 Bacteria 5649
137 Ga0501036_0024934 3300049572 Bacteria 5044
138 Ga0501037_0024716 3300049573 Bacteria 4442
139 Ga0501038_0021327 3300049574 Bacteria 5815
140 Ga0501039_0000001 3300049575 Bacteria 449008
141 Ga0501039_0070540 3300049575 Bacteria 2714
142 Ga0501043_0003979 3300049579 Bacteria 12103
143 Ga0501046_0030895 3300049580 Bacteria 4346
144 Ga0501047_0053871 3300049581 Bacteria 3891
145 Ga0501047_0140539 3300049581 Bacteria 2293
146 Ga0501048_0054913 3300049582 Bacteria 2829
147 Ga0501067_0025569 3300049583 Bacteria 3272
148 Ga0501068_0009346 3300049584 Bacteria 5481
149 Ga0501068_0148695 3300049584 Bacteria 1471
150 Ga0501069_0003782 3300049585 Bacteria 7788
151 Ga0501070_0008229 3300049586 Bacteria 8819
152 Ga0501071_0133226 3300049587 Bacteria 1847
153 Ga0501072_0294009 3300049588 Bacteria 1291
154 Ga0501073_0016093 3300049589 Bacteria 5422
155 Ga0501074_0056466 3300049590 Bacteria 2829
156 Ga0501074_0142778 3300049590 Bacteria 1712
157 Ga0501076_0003835 3300049592 Bacteria 10589
158 Ga0501076_0324820 3300049592 Bacteria 1262
159 Ga0501077_0060247 3300049593 Bacteria 2409
160 Ga0501079_0026838 3300049741 Bacteria 4416
161 Ga0501079_0158516 3300049741 Bacteria 1764
162 Ga0501080_0016291 3300049742 Bacteria 6862
163 Ga0501081_0169882 3300049743 Bacteria 1574
164 Ga0501083_0009689 3300049744 Bacteria 6804
165 Ga0501083_0257313 3300049744 Bacteria 1136
166 Ga0501035_0014304 3300049822 Bacteria 7325
167 Ga0501044_0005661 3300049823 Bacteria 13854
168 Ga0501045_0042092 3300049824 Bacteria 3325
169 Ga0495601_0001859 3300053077 Bacteria 11761
170 Ga0495619_0009294 3300053085 Bacteria 6207
171 Ga0495619_0434951 3300053085 Bacteria 905
172 Ga0500642_0025161 3300053130 Bacteria 2415
173 Ga0501084_0031522 3300054114 Bacteria 4432
174 Ga0501084_0091171 3300054114 Bacteria 2559
175 Ga0501082_0009975 3300060353 Bacteria 8188
176 Ga0501082_0095061 3300060353 Bacteria 2575
177 Ga0530510_0022531 3300061734 Bacteria 4488
178 2524611054 2524023250 Bacteria 5457705
179 2883292047 2883291878 Bacteria 5894118
180 2883355056 2883354860 Bacteria 5865246
181 Ga0068863_100478691
182 Ga0055536_1034421
183 Ga0070671_100062879
184 Ga0070674_100105695
185 Ga0070714_100007802
186 Ga0070713_100139487
187 Ga0070694_100172520
188 Ga0070708_100091025
189 Ga0070708_100263303
190 Ga0070681_10066234
191 Ga0070706_100126930
192 Ga0070707_100006823
193 Ga0070698_100104911
194 Ga0070679_100231353
195 Ga0070697_100052370
196 Ga0068853_100296737
197 Ga0068856_100566864
198 Ga0068861_100023125
199 Ga0068862_100224010
200 Ga0075436_100211259
201 Ga0105238_10339917
202 Ga0105030_101755
203 Ga0157370_10032575
204 Ga0157369_10013799
205 Ga0157369_10560207
206 Ga0157372_10533670
207 Ga0157380_10035057
208 Ga0157379_10346359
209 Ga0213873_10009246
210 Ga0213872_10000787
211 Ga0213872_10000884
212 Ga0213872_10007922
213 Ga0213872_10061597
214 Ga0213875_10054379
215 Ga0209148_1000484
216 Ga0209455_1000832
217 Ga0209676_1000269
218 Ga0209564_1034805
219 Ga0209050_1022934
220 Ga0207684_10097443
221 Ga0207707_10007274
222 Ga0207707_10056496
223 Ga0207652_10184356
224 Ga0207652_10303830
225 Ga0207681_10472030
226 Ga0207700_10377206
227 Ga0207664_10010757
228 Ga0207644_10217655
229 Ga0207639_10201659
230 Ga0207641_10349951
231 Ga0207675_100116692
232 Ga0265338_10095782
233 Ga0265325_10087387
234 Ga0265339_10012037
235 Ga0265331_10002461
236 Ga0265327_10000070
237 Ga0265327_10000292
238 Ga0265313_10000545
239 Ga0265314_10028680
240 Ga0265314_10069794
241 Ga0265342_10012491
242 Ga0307413_10041702
243 Ga0307407_10027496
244 Ga0307409_100494633
245 Ga0307416_100087044
246 Ga0307416_100606616
247 Ga0373923_0073854
248 Ga0373956_0088755
249 Ga0373955_0216938
250 Ga0373935_0124300
251 Ga0373947_0089730
252 Ga0373937_0030838
253 Ga0373937_0033125
254 Ga0373937_0036645
255 Ga0373937_0050589
256 Ga0373925_0087556
257 Ga0373925_0194580
258 Ga0373925_0281817
259 Ga0395899_0000983
260 Ga0395900_0001992
261 Ga0395900_0430719
262 Ga0395898_0001363
263 Ga0395905_0227392
264 Ga0436364_0358649
265 Ga0436364_1057208
266 Ga0436364_1230720
267 Ga0436364_1392595
268 Ga0436364_1561834
269 Ga0395901_0002638
270 Ga0436365_0541972
271 Ga0436365_1413502
272 Ga0436360_0001715
273 Ga0436360_0016813
274 Ga0436360_0264666
275 Ga0436361_0011952
276 Ga0436361_0361031
277 Ga0436361_0682023
278 Ga0436361_0963613
279 Ga0436362_0395899
280 Ga0451577_0192832
281 Ga0466966_0022111
282 Ga0453684_0000204
283 Ga0453684_0001066
284 Ga0453684_0052353
285 Ga0453684_0120350
286 Ga0466957_0031318
287 Ga0466957_0179044
288 Ga0451576_0001285
289 Ga0451576_0002096
290 Ga0451576_0058615
291 Ga0466958_0034408
292 Ga0466967_0162060
293 Ga0495592_0067685
294 Ga0495653_0103960
295 Ga0495608_0115075
296 Ga0495652_0148813
297 Ga0495640_0075784
298 Ga0495645_0131668
299 Ga0495667_0018751
300 Ga0495634_0049954
301 Ga0495657_0169723
302 Ga0495599_0111108
303 Ga0495600_0045661
304 Ga0495604_0107002
305 Ga0495680_0091798
306 Ga0495680_0108645
307 Ga0496112_0372395
308 Ga0496119_0013907
309 Ga0496126_0262152
310 Ga0501032_0000047
311 Ga0501032_0016136
312 Ga0501033_0001674
313 Ga0501033_0101043
314 Ga0501034_0000001
315 Ga0501034_0027130
316 Ga0501036_0019810
317 Ga0501036_0024934
318 Ga0501037_0024716
319 Ga0501038_0021327
320 Ga0501039_0000001
321 Ga0501039_0070540
322 Ga0501043_0003979
323 Ga0501046_0030895
324 Ga0501047_0053871
325 Ga0501047_0140539
326 Ga0501048_0054913
327 Ga0501067_0025569
328 Ga0501068_0009346
329 Ga0501068_0148695
330 Ga0501069_0003782
331 Ga0501070_0008229
332 Ga0501071_0133226
333 Ga0501072_0294009
334 Ga0501073_0016093
335 Ga0501074_0056466
336 Ga0501074_0142778
337 Ga0501076_0003835
338 Ga0501076_0324820
339 Ga0501077_0060247
340 Ga0501079_0026838
341 Ga0501079_0158516
342 Ga0501080_0016291
343 Ga0501081_0169882
344 Ga0501083_0009689
345 Ga0501083_0257313
346 Ga0501035_0014304
347 Ga0501044_0005661
348 Ga0501045_0042092
349 Ga0495601_0001859
350 Ga0495619_0009294
351 Ga0495619_0434951
352 Ga0500642_0025161
353 Ga0501084_0031522
354 Ga0501084_0091171
355 Ga0501082_0009975
356 Ga0501082_0095061
357 Ga0530510_0022531
358 2524611054
359 2883292047
360 2883355056

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17848

zf-ACC

Acetyl-CoA carboxylase zinc finger domain

38

63

1

PF01039

Carboxyl_trans

Carboxyl transferase domain

71

290

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9i-assembly1.cif.gz_D crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9076 27 278
2f9i-assembly1.cif.gz_D crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.8875 27 278
5kdr-assembly1.cif.gz_B-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.8865 27 278
2f9y-assembly1.cif.gz_B-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.8799 27 280
5kdr-assembly1.cif.gz_B-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.8669 27 278
ID Description Score Start End Superfamily
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9022 26 278 3.90.226.10
5kdrB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8865 27 278 3.90.226.10
af_I1N8M8_265_595_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8835 178 200 3.20.20.80
2f9yB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8799 27 280 3.90.226.10
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8761 26 278 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A800ETI3-F1-model_v4 Acetyl-CoA carboxylase carboxyl transferase subunit beta 0.9637 190 280 GO:0003989
GO:0006633
GO:0009317
GO:0016740
GO:2001295
AF-A0A2V9ITX8-F1-model_v4 Acetyl-CoA carboxylase carboxyl transferase subunit beta 0.9578 195 280 GO:0003989
GO:0006633
GO:0009317
GO:0016740
GO:2001295
AF-I1YL57-F1-model_v4 Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2) 0.9536 201 280 GO:0003989
GO:0006633
GO:0009329
GO:0016740
GO:2001295
AF-A0A0F9DJE1-F1-model_v4 CoA carboxyltransferase N-terminal domain-containing protein 0.9532 176 281 GO:0003989
GO:0006633
GO:0009317
GO:2001295
AF-A0A3D2ST18-F1-model_v4 Acetyl-CoA carboxylase carboxyl transferase subunit beta 0.9527 187 280 GO:0003989
GO:0006633
GO:0009329
GO:0016740
GO:2001295

Map