F275267

General Info

Members Datasets Scaffolds Average Seq Length
180 117 180 200

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100084303|Ga0070664_1000843032
Length 224
Sequence VSTSYAPPVQRLVSELSKLPGIGNRTAQRLAFHILRASGEDAFALAEAIREVKEKIGLCEVCFNLTDEPRCRICQDPRRDHGVICVVEEPSDVIPMERTHEYQGVYHVLGGALSPIEGIDPEDLKIGELLARVVPGAKSVDGEAGAMTSANGAGSDAPEVREVVLATNPTTTGEATALHIAEELRTRAPALTVTRLASGLPVGSDLEYADEVTLGKAFAGRRSL

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
8 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
9 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
10 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
11 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
51 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
52 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
53 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
54 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
74 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
75 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
114 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
115 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
116 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
117 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 1.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.33
Rhizosphere 83.89
Stem 0
Stem Tuber 0
Unclassified 7.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10244545 3300005328 Bacteria 1195
2 Ga0070714_100100082 3300005435 Bacteria 2552
3 Ga0070714_100101326 3300005435 Bacteria 2537
4 Ga0070714_100105049 3300005435 Bacteria 2493
5 Ga0070714_100138347 3300005435 Bacteria 2183
6 Ga0070713_100062738 3300005436 Bacteria 3113
7 Ga0070713_100108561 3300005436 Bacteria 2416
8 Ga0070713_100149859 3300005436 Bacteria 2074
9 Ga0070694_100170733 3300005444 Bacteria 1602
10 Ga0070708_100013766 3300005445 Bacteria 6637
11 Ga0070707_100009321 3300005468 Bacteria 9111
12 Ga0070707_100047701 3300005468 Bacteria 4100
13 Ga0070695_100027660 3300005545 Bacteria 3515
14 Ga0070704_100340371 3300005549 Unclassified 1263
15 Ga0070704_100611019 3300005549 Bacteria 959
16 Ga0070664_100084303 3300005564 Bacteria 2743
17 Ga0068861_100103771 3300005719 Unclassified 2267
18 Ga0068862_100144899 3300005844 Bacteria 2111
19 Ga0068862_100460811 3300005844 Unclassified 1200
20 Ga0081455_10004899 3300005937 Bacteria 14838
21 Ga0081538_10005012 3300005981 Bacteria 12061
22 Ga0081538_10047823 3300005981 Bacteria 2618
23 Ga0081540_1002959 3300005983 Bacteria 13617
24 Ga0081540_1062633 3300005983 Bacteria 1765
25 Ga0081539_10029196 3300005985 Bacteria 3451
26 Ga0070717_10013355 3300006028 Bacteria 6290
27 Ga0070717_10078388 3300006028 Bacteria 2769
28 Ga0070716_100004048 3300006173 Bacteria 6958
29 Ga0070712_100420241 3300006175 Bacteria 1108
30 Ga0075428_100259890 3300006844 Bacteria 1870
31 Ga0075433_10021913 3300006852 Bacteria 5361
32 Ga0075434_100113673 3300006871 Bacteria 2719
33 Ga0075429_100198243 3300006880 Bacteria 1759
34 Ga0105240_11113165 3300009093 Bacteria 840
35 Ga0105240_11194672 3300009093 Bacteria 806
36 Ga0111539_10068700 3300009094 Bacteria 4184
37 Ga0111539_10177233 3300009094 Bacteria 2490
38 Ga0111539_10553507 3300009094 Bacteria 1340
39 Ga0105245_10195035 3300009098 Bacteria 1942
40 Ga0105245_11666695 3300009098 Bacteria 690
41 Ga0114129_10063364 3300009147 Bacteria 5162
42 Ga0114129_10506127 3300009147 Bacteria 1577
43 Ga0105242_10651605 3300009176 Bacteria 1024
44 Ga0105237_10003537 3300009545 Bacteria 18517
45 Ga0105238_10511160 3300009551 Bacteria 1203
46 Ga0105249_11009905 3300009553 Bacteria 901
47 Ga0163162_10801643 3300013306 Bacteria 1059
48 Ga0163161_10706643 3300017792 Bacteria 840
49 Ga0206353_10394340 3300020082 Bacteria 1583
50 Ga0206353_11117694 3300020082 Bacteria 1139
51 Ga0206353_11142209 3300020082 Bacteria 1152
52 Ga0213873_10068753 3300021358 Bacteria 972
53 Ga0213873_10076350 3300021358 Bacteria 931
54 Ga0213876_10003706 3300021384 Bacteria 8666
55 Ga0213876_10076483 3300021384 Bacteria 1768
56 Ga0213875_10084884 3300021388 Bacteria 1477
57 Ga0207699_10308840 3300025906 Bacteria 1106
58 Ga0207671_10001620 3300025914 Bacteria 25619
59 Ga0207663_10041488 3300025916 Bacteria 2804
60 Ga0207663_10080907 3300025916 Bacteria 2126
61 Ga0207681_10266296 3300025923 Bacteria 1344
62 Ga0207681_10580341 3300025923 Unclassified 925
63 Ga0207687_10164647 3300025927 Bacteria 1705
64 Ga0207700_10261292 3300025928 Bacteria 1483
65 Ga0207700_10362746 3300025928 Bacteria 1264
66 Ga0207700_10678494 3300025928 Bacteria 919
67 Ga0207664_10030758 3300025929 Bacteria 4102
68 Ga0207664_10282584 3300025929 Bacteria 1456
69 Ga0207664_10418308 3300025929 Bacteria 1194
70 Ga0207686_10384863 3300025934 Bacteria 1065
71 Ga0207709_10176839 3300025935 Bacteria 1503
72 Ga0207679_10246740 3300025945 Bacteria 1516
73 Ga0207668_10119655 3300025972 Unclassified 1992
74 Ga0207668_10750699 3300025972 Bacteria 861
75 Ga0207677_10284697 3300026023 Bacteria 1358
76 Ga0268265_10810534 3300028380 Unclassified 913
77 Ga0265326_10000837 3300028558 Bacteria 11312
78 Ga0265319_1000322 3300028563 Bacteria 35581
79 Ga0265318_10000252 3300028577 Bacteria 46575
80 Ga0265322_10108836 3300028654 Bacteria 788
81 Ga0265336_10000001 3300028666 Bacteria 916179
82 Ga0265338_10000004 3300028800 Bacteria 644793
83 Ga0265338_10099477 3300028800 Bacteria 2375
84 Ga0265324_10004000 3300029957 Bacteria 6797
85 Ga0265320_10025964 3300031240 Bacteria 3073
86 Ga0265320_10097388 3300031240 Bacteria 1357
87 Ga0265340_10000002 3300031247 Bacteria 711693
88 Ga0265339_10073760 3300031249 Bacteria 1814
89 Ga0265327_10025594 3300031251 Bacteria 3438
90 Ga0265316_10123381 3300031344 Bacteria 1955
91 Ga0265342_10045086 3300031712 Bacteria 2656
92 Ga0307416_100141573 3300032002 Bacteria 2187
93 Ga0307414_10145287 3300032004 Bacteria 1863
94 Ga0307415_100021638 3300032126 Bacteria 3958
95 Ga0307415_100045640 3300032126 Bacteria 2939
96 Ga0373943_0658397 3300035170 Bacteria 619
97 Ga0373925_0158577 3300037068 Bacteria 1781
98 Ga0395900_0260823 3300037418 Bacteria 1731
99 Ga0395900_0650568 3300037418 Bacteria 991
100 Ga0395900_0681889 3300037418 Bacteria 962
101 Ga0395905_0325624 3300037471 Bacteria 1427
102 Ga0436364_0188384 3300037853 Bacteria 1142
103 Ga0436364_0818351 3300037853 Bacteria 741
104 Ga0436364_0972810 3300037853 Bacteria 1550
105 Ga0395901_0150117 3300038443 Bacteria 2449
106 Ga0395901_0671370 3300038443 Bacteria 1037
107 Ga0436365_0395588 3300039437 Bacteria 13955
108 Ga0436365_0969934 3300039437 Bacteria 6774
109 Ga0436365_1126585 3300039437 Bacteria 4895
110 Ga0436365_1501073 3300039437 Bacteria 1247
111 Ga0436365_1916134 3300039437 Bacteria 696
112 Ga0436365_1929325 3300039437 Bacteria 1170
113 Ga0436363_0338810 3300039450 Bacteria 1098
114 Ga0436363_0800975 3300039450 Bacteria 722
115 Ga0436362_0143016 3300039453 Bacteria 1686
116 Ga0436362_0667433 3300039453 Bacteria 1718
117 Ga0436362_0871071 3300039453 Bacteria 2122
118 Ga0466969_0024548 3300044656 Bacteria 3101
119 Ga0466966_0164339 3300044684 Bacteria 1351
120 Ga0466961_0001294 3300044693 Bacteria 15444
121 Ga0466963_0007290 3300044694 Bacteria 6594
122 Ga0466963_0043588 3300044694 Bacteria 2951
123 Ga0466963_0308963 3300044694 Bacteria 1112
124 Ga0466963_0343935 3300044694 Bacteria 1050
125 Ga0466959_0028474 3300045049 Bacteria 4143
126 Ga0466958_0048409 3300045836 Bacteria 2569
127 Ga0466958_0049410 3300045836 Bacteria 2545
128 Ga0466958_0079219 3300045836 Bacteria 2020
129 Ga0466958_0510349 3300045836 Bacteria 780
130 Ga0466958_0545029 3300045836 Bacteria 754
131 Ga0466958_0609189 3300045836 Bacteria 710
132 Ga0466967_0004730 3300045976 Bacteria 9260
133 Ga0466967_0041085 3300045976 Bacteria 3985
134 Ga0466967_0208054 3300045976 Bacteria 1855
135 Ga0495641_0035881 3300046461 Bacteria 2333
136 Ga0495651_0154594 3300046462 Bacteria 1650
137 Ga0495653_0020781 3300046463 Bacteria 5318
138 Ga0495582_0194063 3300046473 Bacteria 1159
139 Ga0495618_0001054 3300046514 Bacteria 18809
140 Ga0495630_0000386 3300046517 Bacteria 34684
141 Ga0495586_0347897 3300046535 Bacteria 851
142 Ga0495645_0000121 3300046543 Bacteria 52863
143 Ga0495657_0000008 3300046675 Bacteria 221090
144 Ga0495581_0374593 3300047315 Bacteria 831
145 Ga0495676_0028674 3300047321 Bacteria 4750
146 Ga0495676_0312072 3300047321 Bacteria 1058
147 Ga0495684_0246990 3300047471 Bacteria 1299
148 Ga0496100_0031136 3300048903 Bacteria 3314
149 Ga0496101_0528132 3300048904 Bacteria 933
150 Ga0496103_0542039 3300048906 Bacteria 743
151 Ga0496104_0000001 3300048907 Bacteria 711867
152 Ga0496104_0383946 3300048907 Bacteria 1317
153 Ga0496107_0087849 3300048910 Bacteria 2270
154 Ga0496109_0358956 3300048912 Bacteria 1377
155 Ga0496110_0007903 3300048913 Bacteria 8520
156 Ga0496110_0106677 3300048913 Bacteria 2514
157 Ga0496111_0000769 3300048914 Bacteria 17119
158 Ga0496111_0130789 3300048914 Bacteria 1857
159 Ga0496113_0564819 3300048916 Bacteria 912
160 Ga0496115_0000034 3300048918 Bacteria 135380
161 Ga0496115_0000240 3300048918 Bacteria 49737
162 Ga0496115_0903573 3300048918 Bacteria 681
163 Ga0501047_0445713 3300049581 Bacteria 1124
164 Ga0501068_0769864 3300049584 Bacteria 631
165 Ga0501076_0026533 3300049592 Bacteria 4489
166 Ga0501081_0702669 3300049743 Bacteria 759
167 Ga0501035_0017112 3300049822 Bacteria 6680
168 nmdc:mga05p37_541776_c1 3300050507 Bacteria 1327
169 nmdc:mga09592_344873_c1 3300050508 Bacteria 1289
170 nmdc:mga08y16_769951_c1 3300050511 Bacteria 957
171 nmdc:mga08y16_86268_c1 3300050511 Bacteria 3271
172 nmdc:mga0n895_112423_c1 3300050512 Bacteria 2740
173 Ga0495601_0627112 3300053077 Bacteria 689
174 Ga0495612_0000107 3300053078 Bacteria 35645
175 Ga0495612_0258593 3300053078 Bacteria 775
176 Ga0495619_0122663 3300053085 Bacteria 1782
177 Ga0495619_0243096 3300053085 Bacteria 1247
178 Ga0501084_0320743 3300054114 Bacteria 1309
179 Ga0466962_0052700 3300061719 Bacteria 1944
180 Ga0466962_0190376 3300061719 Bacteria 1001

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10145287 Ga0307414_101452873 165
2 3300032126 Ga0307415_100045640 Ga0307415_1000456403 165
3 3300005981 Ga0081538_10005012 Ga0081538_100050128 166
4 3300009147 Ga0114129_10063364 Ga0114129_100633644 178
5 3300050507 nmdc:mga05p37_541776_c1 nmdc:mga05p37_541776_c1_134_682 178
6 3300049581 Ga0501047_0445713 Ga0501047_0445713_401_1015 185
7 3300049822 Ga0501035_0017112 Ga0501035_0017112_90_704 185
8 3300005444 Ga0070694_100170733 Ga0070694_1001707333 187
9 3300005545 Ga0070695_100027660 Ga0070695_1000276604 187
10 3300005549 Ga0070704_100611019 Ga0070704_1006110192 187
11 3300006852 Ga0075433_10021913 Ga0075433_100219134 187
12 3300009147 Ga0114129_10506127 Ga0114129_105061271 187
13 3300046462 Ga0495651_0154594 Ga0495651_0154594_821_1399 187
14 3300046463 Ga0495653_0020781 Ga0495653_0020781_1941_2519 187
15 3300046514 Ga0495618_0001054 Ga0495618_0001054_18193_18771 187
16 3300046543 Ga0495645_0000121 Ga0495645_0000121_45049_45627 187
17 3300053078 Ga0495612_0000107 Ga0495612_0000107_107_685 187
18 3300053085 Ga0495619_0122663 Ga0495619_0122663_137_715 187
19 3300009094 Ga0111539_10068700 Ga0111539_100687004 188
20 3300035170 Ga0373943_0658397 Ga0373943_0658397_19_606 188
21 3300039437 Ga0436365_0395588 Ga0436365_0395588_7878_8453 188
22 3300039437 Ga0436365_1126585 Ga0436365_1126585_1225_1800 188
23 3300039453 Ga0436362_0667433 Ga0436362_0667433_758_1333 188
24 3300054114 Ga0501084_0320743 Ga0501084_0320743_348_920 188
25 3300061719 Ga0466962_0052700 Ga0466962_0052700_1302_1892 188
26 3300025934 Ga0207686_10384863 Ga0207686_103848632 191
27 3300048903 Ga0496100_0031136 Ga0496100_0031136_2092_2691 191
28 3300048904 Ga0496101_0528132 Ga0496101_0528132_247_846 191
29 3300048918 Ga0496115_0000240 Ga0496115_0000240_29745_30395 191
30 3300028800 Ga0265338_10099477 Ga0265338_100994773 193
31 3300005445 Ga0070708_100013766 Ga0070708_1000137664 194
32 3300005468 Ga0070707_100009321 Ga0070707_1000093215 194
33 3300005468 Ga0070707_100047701 Ga0070707_1000477012 194
34 3300006844 Ga0075428_100259890 Ga0075428_1002598903 194
35 3300006880 Ga0075429_100198243 Ga0075429_1001982433 194
36 3300025914 Ga0207671_10001620 Ga0207671_1000162010 194
37 3300046535 Ga0495586_0347897 Ga0495586_0347897_121_723 194
38 3300049592 Ga0501076_0026533 Ga0501076_0026533_62_664 194
39 3300050508 nmdc:mga09592_344873_c1 nmdc:mga09592_344873_c1_231_833 194
40 3300005937 Ga0081455_10004899 Ga0081455_1000489914 195
41 3300005981 Ga0081538_10047823 Ga0081538_100478233 195
42 3300005983 Ga0081540_1002959 Ga0081540_10029593 195
43 3300006028 Ga0070717_10013355 Ga0070717_100133555 195
44 3300009098 Ga0105245_10195035 Ga0105245_101950352 195
45 3300009098 Ga0105245_11666695 Ga0105245_116666951 195
46 3300009545 Ga0105237_10003537 Ga0105237_1000353717 195
47 3300009553 Ga0105249_11009905 Ga0105249_110099052 195
48 3300013306 Ga0163162_10801643 Ga0163162_108016431 195
49 3300020082 Ga0206353_10394340 Ga0206353_103943401 195
50 3300025927 Ga0207687_10164647 Ga0207687_101646473 195
51 3300025972 Ga0207668_10750699 Ga0207668_107506991 195
52 3300037418 Ga0395900_0260823 Ga0395900_0260823_680_1270 195
53 3300037418 Ga0395900_0650568 Ga0395900_0650568_319_909 195
54 3300037418 Ga0395900_0681889 Ga0395900_0681889_103_693 195
55 3300037471 Ga0395905_0325624 Ga0395905_0325624_525_1115 195
56 3300038443 Ga0395901_0150117 Ga0395901_0150117_713_1303 195
57 3300039437 Ga0436365_1916134 Ga0436365_1916134_33_644 195
58 3300045976 Ga0466967_0004730 Ga0466967_0004730_8093_8689 195
59 3300048906 Ga0496103_0542039 Ga0496103_0542039_49_639 195
60 3300048907 Ga0496104_0383946 Ga0496104_0383946_503_1093 195
61 3300048910 Ga0496107_0087849 Ga0496107_0087849_1346_1936 195
62 3300048912 Ga0496109_0358956 Ga0496109_0358956_188_778 195
63 3300048913 Ga0496110_0106677 Ga0496110_0106677_733_1323 195
64 3300048914 Ga0496111_0130789 Ga0496111_0130789_266_856 195
65 3300048916 Ga0496113_0564819 Ga0496113_0564819_161_751 195
66 3300005328 Ga0070676_10244545 Ga0070676_102445451 196
67 3300005435 Ga0070714_100100082 Ga0070714_1001000822 196
68 3300005435 Ga0070714_100101326 Ga0070714_1001013263 196
69 3300005435 Ga0070714_100105049 Ga0070714_1001050493 196
70 3300005435 Ga0070714_100138347 Ga0070714_1001383472 196
71 3300005436 Ga0070713_100062738 Ga0070713_1000627383 196
72 3300005436 Ga0070713_100108561 Ga0070713_1001085612 196
73 3300005436 Ga0070713_100149859 Ga0070713_1001498593 196
74 3300005549 Ga0070704_100340371 Ga0070704_1003403712 196
75 3300005564 Ga0070664_100084303 Ga0070664_1000843032 196
76 3300005719 Ga0068861_100103771 Ga0068861_1001037712 196
77 3300005844 Ga0068862_100144899 Ga0068862_1001448992 196
78 3300005844 Ga0068862_100460811 Ga0068862_1004608113 196
79 3300005983 Ga0081540_1062633 Ga0081540_10626332 196
80 3300005985 Ga0081539_10029196 Ga0081539_100291962 196
81 3300006028 Ga0070717_10078388 Ga0070717_100783882 196
82 3300006173 Ga0070716_100004048 Ga0070716_1000040483 196
83 3300006175 Ga0070712_100420241 Ga0070712_1004202411 196
84 3300006871 Ga0075434_100113673 Ga0075434_1001136733 196
85 3300009093 Ga0105240_11113165 Ga0105240_111131651 196
86 3300009093 Ga0105240_11194672 Ga0105240_111946721 196
87 3300009094 Ga0111539_10177233 Ga0111539_101772332 196
88 3300009094 Ga0111539_10553507 Ga0111539_105535073 196
89 3300009176 Ga0105242_10651605 Ga0105242_106516052 196
90 3300009551 Ga0105238_10511160 Ga0105238_105111602 196
91 3300017792 Ga0163161_10706643 Ga0163161_107066432 196
92 3300020082 Ga0206353_11117694 Ga0206353_111176942 196
93 3300020082 Ga0206353_11142209 Ga0206353_111422092 196
94 3300021358 Ga0213873_10068753 Ga0213873_100687531 196
95 3300021358 Ga0213873_10076350 Ga0213873_100763501 196
96 3300021384 Ga0213876_10003706 Ga0213876_100037063 196
97 3300021384 Ga0213876_10076483 Ga0213876_100764832 196
98 3300021388 Ga0213875_10084884 Ga0213875_100848841 196
99 3300025906 Ga0207699_10308840 Ga0207699_103088402 196
100 3300025916 Ga0207663_10041488 Ga0207663_100414882 196
101 3300025916 Ga0207663_10080907 Ga0207663_100809072 196
102 3300025923 Ga0207681_10266296 Ga0207681_102662962 196
103 3300025923 Ga0207681_10580341 Ga0207681_105803412 196
104 3300025928 Ga0207700_10261292 Ga0207700_102612922 196
105 3300025928 Ga0207700_10362746 Ga0207700_103627462 196
106 3300025928 Ga0207700_10678494 Ga0207700_106784941 196
107 3300025929 Ga0207664_10030758 Ga0207664_100307583 196
108 3300025929 Ga0207664_10282584 Ga0207664_102825842 196
109 3300025929 Ga0207664_10418308 Ga0207664_104183082 196
110 3300025935 Ga0207709_10176839 Ga0207709_101768392 196
111 3300025945 Ga0207679_10246740 Ga0207679_102467403 196
112 3300025972 Ga0207668_10119655 Ga0207668_101196553 196
113 3300026023 Ga0207677_10284697 Ga0207677_102846971 196
114 3300028380 Ga0268265_10810534 Ga0268265_108105342 196
115 3300028558 Ga0265326_10000837 Ga0265326_1000083713 196
116 3300028563 Ga0265319_1000322 Ga0265319_100032214 196
117 3300028577 Ga0265318_10000252 Ga0265318_100002523 196
118 3300028654 Ga0265322_10108836 Ga0265322_101088362 196
119 3300028666 Ga0265336_10000001 Ga0265336_10000001563 196
120 3300028800 Ga0265338_10000004 Ga0265338_10000004320 196
121 3300029957 Ga0265324_10004000 Ga0265324_100040008 196
122 3300031240 Ga0265320_10025964 Ga0265320_100259642 196
123 3300031240 Ga0265320_10097388 Ga0265320_100973882 196
124 3300031247 Ga0265340_10000002 Ga0265340_10000002320 196
125 3300031249 Ga0265339_10073760 Ga0265339_100737603 196
126 3300031251 Ga0265327_10025594 Ga0265327_100255942 196
127 3300031344 Ga0265316_10123381 Ga0265316_101233812 196
128 3300031712 Ga0265342_10045086 Ga0265342_100450863 196
129 3300032002 Ga0307416_100141573 Ga0307416_1001415734 196
130 3300032126 Ga0307415_100021638 Ga0307415_1000216382 196
131 3300037068 Ga0373925_0158577 Ga0373925_0158577_675_1298 196
132 3300037853 Ga0436364_0188384 Ga0436364_0188384_19_630 196
133 3300037853 Ga0436364_0818351 Ga0436364_0818351_90_689 196
134 3300037853 Ga0436364_0972810 Ga0436364_0972810_160_759 196
135 3300038443 Ga0395901_0671370 Ga0395901_0671370_302_901 196
136 3300039437 Ga0436365_0969934 Ga0436365_0969934_139_738 196
137 3300039437 Ga0436365_1501073 Ga0436365_1501073_77_676 196
138 3300039437 Ga0436365_1929325 Ga0436365_1929325_28_627 196
139 3300039450 Ga0436363_0338810 Ga0436363_0338810_489_1088 196
140 3300039450 Ga0436363_0800975 Ga0436363_0800975_38_637 196
141 3300039453 Ga0436362_0143016 Ga0436362_0143016_726_1325 196
142 3300039453 Ga0436362_0871071 Ga0436362_0871071_249_848 196
143 3300044656 Ga0466969_0024548 Ga0466969_0024548_1115_1813 196
144 3300044684 Ga0466966_0164339 Ga0466966_0164339_344_949 196
145 3300044693 Ga0466961_0001294 Ga0466961_0001294_10583_11182 196
146 3300044694 Ga0466963_0007290 Ga0466963_0007290_1017_1616 196
147 3300044694 Ga0466963_0043588 Ga0466963_0043588_961_1566 196
148 3300044694 Ga0466963_0308963 Ga0466963_0308963_287_892 196
149 3300044694 Ga0466963_0343935 Ga0466963_0343935_12_617 196
150 3300045049 Ga0466959_0028474 Ga0466959_0028474_2300_2899 196
151 3300045836 Ga0466958_0048409 Ga0466958_0048409_1284_1889 196
152 3300045836 Ga0466958_0049410 Ga0466958_0049410_650_1249 196
153 3300045836 Ga0466958_0079219 Ga0466958_0079219_513_1124 196
154 3300045836 Ga0466958_0510349 Ga0466958_0510349_147_752 196
155 3300045836 Ga0466958_0545029 Ga0466958_0545029_48_647 196
156 3300045836 Ga0466958_0609189 Ga0466958_0609189_70_669 196
157 3300045976 Ga0466967_0041085 Ga0466967_0041085_2854_3453 196
158 3300045976 Ga0466967_0208054 Ga0466967_0208054_594_1193 196
159 3300046461 Ga0495641_0035881 Ga0495641_0035881_678_1268 196
160 3300046473 Ga0495582_0194063 Ga0495582_0194063_212_835 196
161 3300046517 Ga0495630_0000386 Ga0495630_0000386_29827_30438 196
162 3300046675 Ga0495657_0000008 Ga0495657_0000008_35371_35982 196
163 3300047315 Ga0495581_0374593 Ga0495581_0374593_102_725 196
164 3300047321 Ga0495676_0028674 Ga0495676_0028674_712_1335 196
165 3300047321 Ga0495676_0312072 Ga0495676_0312072_36_626 196
166 3300047471 Ga0495684_0246990 Ga0495684_0246990_581_1192 196
167 3300048907 Ga0496104_0000001 Ga0496104_0000001_102122_102751 196
168 3300048913 Ga0496110_0007903 Ga0496110_0007903_4144_4773 196
169 3300048914 Ga0496111_0000769 Ga0496111_0000769_13485_14114 196
170 3300048918 Ga0496115_0000034 Ga0496115_0000034_106761_107435 196
171 3300048918 Ga0496115_0903573 Ga0496115_0903573_19_618 196
172 3300049584 Ga0501068_0769864 Ga0501068_0769864_15_614 196
173 3300049743 Ga0501081_0702669 Ga0501081_0702669_57_656 196
174 3300050511 nmdc:mga08y16_769951_c1 nmdc:mga08y16_769951_c1_343_942 196
175 3300050511 nmdc:mga08y16_86268_c1 nmdc:mga08y16_86268_c1_407_1006 196
176 3300050512 nmdc:mga0n895_112423_c1 nmdc:mga0n895_112423_c1_2051_2656 196
177 3300053077 Ga0495601_0627112 Ga0495601_0627112_60_671 196
178 3300053078 Ga0495612_0258593 Ga0495612_0258593_31_636 196
179 3300053085 Ga0495619_0243096 Ga0495619_0243096_198_815 196
180 3300061719 Ga0466962_0190376 Ga0466962_0190376_147_746 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21175

RecR_C

RecR, C-terminal

199

222

0.99

PF02132

RecR_ZnF

RecR, Cys4-zinc finger motif

56

76

0.96

PF21176

RecR_HhH

RecR, helix-hairpin-helix

9

53

0.96

PF13662

Toprim_4

Toprim domain

82

197

0.94

PF01751

Toprim

Toprim domain

83

196

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9385 79 169
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9287 79 169
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.9048 17 196
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.8969 17 196
4o6o-assembly1.cif.gz_B structural and functional studies the characterization of cys4 zinc-finger motif in the recombination mediator protein recr 0.822 1 194
ID Description Score Start End Superfamily
3vdpC01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 0.9762 1 51 1.10.8.420
3vdpB01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 0.9759 3 51 1.10.8.420
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9758 76 196 3.40.1360.10
3vdpA01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 0.9743 1 51 1.10.8.420
af_P9WHI3_76_174_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.97 76 168 3.40.1360.10
ID Description Score Start End GO Terms
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.9741 70 171 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A3D0TKE5-F1-model_v4 Recombination protein RecR 0.9634 49 171 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-W1XYN8-F1-model_v4 Recombination protein RecR 0.9624 38 151 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-W4U8H3-F1-model_v4 deleted 0.955 48 143
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.9467 70 171 GO:0003677
GO:0006281
GO:0006310
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.8 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map