F275267
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 180 | 117 | 180 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300005564|Ga0070664_100084303|Ga0070664_1000843032 |
| Length | 224 |
| Sequence | VSTSYAPPVQRLVSELSKLPGIGNRTAQRLAFHILRASGEDAFALAEAIREVKEKIGLCEVCFNLTDEPRCRICQDPRRDHGVICVVEEPSDVIPMERTHEYQGVYHVLGGALSPIEGIDPEDLKIGELLARVVPGAKSVDGEAGAMTSANGAGSDAPEVREVVLATNPTTTGEATALHIAEELRTRAPALTVTRLASGLPVGSDLEYADEVTLGKAFAGRRSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 4 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 11 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 12 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 13 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 14 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 15 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 16 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 20 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 21 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 22 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 23 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 34 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 35 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 36 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 37 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 51 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 52 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 53 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 54 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 55 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 56 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 57 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 58 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 59 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 60 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 61 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 62 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 63 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 64 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 65 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 66 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 67 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 68 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 69 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 70 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 71 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 72 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 73 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 74 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 75 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 76 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 77 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 78 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 79 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 80 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 81 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 82 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 95 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 96 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 97 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 98 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 99 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 100 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 101 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 102 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 103 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 104 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 105 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 106 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 107 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 108 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 109 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 110 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 111 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 112 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 113 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.33 |
| Metatranscriptomes | 1.67 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.33 |
| Rhizosphere | 83.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10244545 | 3300005328 | Bacteria | 1195 |
| 2 | Ga0070714_100100082 | 3300005435 | Bacteria | 2552 |
| 3 | Ga0070714_100101326 | 3300005435 | Bacteria | 2537 |
| 4 | Ga0070714_100105049 | 3300005435 | Bacteria | 2493 |
| 5 | Ga0070714_100138347 | 3300005435 | Bacteria | 2183 |
| 6 | Ga0070713_100062738 | 3300005436 | Bacteria | 3113 |
| 7 | Ga0070713_100108561 | 3300005436 | Bacteria | 2416 |
| 8 | Ga0070713_100149859 | 3300005436 | Bacteria | 2074 |
| 9 | Ga0070694_100170733 | 3300005444 | Bacteria | 1602 |
| 10 | Ga0070708_100013766 | 3300005445 | Bacteria | 6637 |
| 11 | Ga0070707_100009321 | 3300005468 | Bacteria | 9111 |
| 12 | Ga0070707_100047701 | 3300005468 | Bacteria | 4100 |
| 13 | Ga0070695_100027660 | 3300005545 | Bacteria | 3515 |
| 14 | Ga0070704_100340371 | 3300005549 | Unclassified | 1263 |
| 15 | Ga0070704_100611019 | 3300005549 | Bacteria | 959 |
| 16 | Ga0070664_100084303 | 3300005564 | Bacteria | 2743 |
| 17 | Ga0068861_100103771 | 3300005719 | Unclassified | 2267 |
| 18 | Ga0068862_100144899 | 3300005844 | Bacteria | 2111 |
| 19 | Ga0068862_100460811 | 3300005844 | Unclassified | 1200 |
| 20 | Ga0081455_10004899 | 3300005937 | Bacteria | 14838 |
| 21 | Ga0081538_10005012 | 3300005981 | Bacteria | 12061 |
| 22 | Ga0081538_10047823 | 3300005981 | Bacteria | 2618 |
| 23 | Ga0081540_1002959 | 3300005983 | Bacteria | 13617 |
| 24 | Ga0081540_1062633 | 3300005983 | Bacteria | 1765 |
| 25 | Ga0081539_10029196 | 3300005985 | Bacteria | 3451 |
| 26 | Ga0070717_10013355 | 3300006028 | Bacteria | 6290 |
| 27 | Ga0070717_10078388 | 3300006028 | Bacteria | 2769 |
| 28 | Ga0070716_100004048 | 3300006173 | Bacteria | 6958 |
| 29 | Ga0070712_100420241 | 3300006175 | Bacteria | 1108 |
| 30 | Ga0075428_100259890 | 3300006844 | Bacteria | 1870 |
| 31 | Ga0075433_10021913 | 3300006852 | Bacteria | 5361 |
| 32 | Ga0075434_100113673 | 3300006871 | Bacteria | 2719 |
| 33 | Ga0075429_100198243 | 3300006880 | Bacteria | 1759 |
| 34 | Ga0105240_11113165 | 3300009093 | Bacteria | 840 |
| 35 | Ga0105240_11194672 | 3300009093 | Bacteria | 806 |
| 36 | Ga0111539_10068700 | 3300009094 | Bacteria | 4184 |
| 37 | Ga0111539_10177233 | 3300009094 | Bacteria | 2490 |
| 38 | Ga0111539_10553507 | 3300009094 | Bacteria | 1340 |
| 39 | Ga0105245_10195035 | 3300009098 | Bacteria | 1942 |
| 40 | Ga0105245_11666695 | 3300009098 | Bacteria | 690 |
| 41 | Ga0114129_10063364 | 3300009147 | Bacteria | 5162 |
| 42 | Ga0114129_10506127 | 3300009147 | Bacteria | 1577 |
| 43 | Ga0105242_10651605 | 3300009176 | Bacteria | 1024 |
| 44 | Ga0105237_10003537 | 3300009545 | Bacteria | 18517 |
| 45 | Ga0105238_10511160 | 3300009551 | Bacteria | 1203 |
| 46 | Ga0105249_11009905 | 3300009553 | Bacteria | 901 |
| 47 | Ga0163162_10801643 | 3300013306 | Bacteria | 1059 |
| 48 | Ga0163161_10706643 | 3300017792 | Bacteria | 840 |
| 49 | Ga0206353_10394340 | 3300020082 | Bacteria | 1583 |
| 50 | Ga0206353_11117694 | 3300020082 | Bacteria | 1139 |
| 51 | Ga0206353_11142209 | 3300020082 | Bacteria | 1152 |
| 52 | Ga0213873_10068753 | 3300021358 | Bacteria | 972 |
| 53 | Ga0213873_10076350 | 3300021358 | Bacteria | 931 |
| 54 | Ga0213876_10003706 | 3300021384 | Bacteria | 8666 |
| 55 | Ga0213876_10076483 | 3300021384 | Bacteria | 1768 |
| 56 | Ga0213875_10084884 | 3300021388 | Bacteria | 1477 |
| 57 | Ga0207699_10308840 | 3300025906 | Bacteria | 1106 |
| 58 | Ga0207671_10001620 | 3300025914 | Bacteria | 25619 |
| 59 | Ga0207663_10041488 | 3300025916 | Bacteria | 2804 |
| 60 | Ga0207663_10080907 | 3300025916 | Bacteria | 2126 |
| 61 | Ga0207681_10266296 | 3300025923 | Bacteria | 1344 |
| 62 | Ga0207681_10580341 | 3300025923 | Unclassified | 925 |
| 63 | Ga0207687_10164647 | 3300025927 | Bacteria | 1705 |
| 64 | Ga0207700_10261292 | 3300025928 | Bacteria | 1483 |
| 65 | Ga0207700_10362746 | 3300025928 | Bacteria | 1264 |
| 66 | Ga0207700_10678494 | 3300025928 | Bacteria | 919 |
| 67 | Ga0207664_10030758 | 3300025929 | Bacteria | 4102 |
| 68 | Ga0207664_10282584 | 3300025929 | Bacteria | 1456 |
| 69 | Ga0207664_10418308 | 3300025929 | Bacteria | 1194 |
| 70 | Ga0207686_10384863 | 3300025934 | Bacteria | 1065 |
| 71 | Ga0207709_10176839 | 3300025935 | Bacteria | 1503 |
| 72 | Ga0207679_10246740 | 3300025945 | Bacteria | 1516 |
| 73 | Ga0207668_10119655 | 3300025972 | Unclassified | 1992 |
| 74 | Ga0207668_10750699 | 3300025972 | Bacteria | 861 |
| 75 | Ga0207677_10284697 | 3300026023 | Bacteria | 1358 |
| 76 | Ga0268265_10810534 | 3300028380 | Unclassified | 913 |
| 77 | Ga0265326_10000837 | 3300028558 | Bacteria | 11312 |
| 78 | Ga0265319_1000322 | 3300028563 | Bacteria | 35581 |
| 79 | Ga0265318_10000252 | 3300028577 | Bacteria | 46575 |
| 80 | Ga0265322_10108836 | 3300028654 | Bacteria | 788 |
| 81 | Ga0265336_10000001 | 3300028666 | Bacteria | 916179 |
| 82 | Ga0265338_10000004 | 3300028800 | Bacteria | 644793 |
| 83 | Ga0265338_10099477 | 3300028800 | Bacteria | 2375 |
| 84 | Ga0265324_10004000 | 3300029957 | Bacteria | 6797 |
| 85 | Ga0265320_10025964 | 3300031240 | Bacteria | 3073 |
| 86 | Ga0265320_10097388 | 3300031240 | Bacteria | 1357 |
| 87 | Ga0265340_10000002 | 3300031247 | Bacteria | 711693 |
| 88 | Ga0265339_10073760 | 3300031249 | Bacteria | 1814 |
| 89 | Ga0265327_10025594 | 3300031251 | Bacteria | 3438 |
| 90 | Ga0265316_10123381 | 3300031344 | Bacteria | 1955 |
| 91 | Ga0265342_10045086 | 3300031712 | Bacteria | 2656 |
| 92 | Ga0307416_100141573 | 3300032002 | Bacteria | 2187 |
| 93 | Ga0307414_10145287 | 3300032004 | Bacteria | 1863 |
| 94 | Ga0307415_100021638 | 3300032126 | Bacteria | 3958 |
| 95 | Ga0307415_100045640 | 3300032126 | Bacteria | 2939 |
| 96 | Ga0373943_0658397 | 3300035170 | Bacteria | 619 |
| 97 | Ga0373925_0158577 | 3300037068 | Bacteria | 1781 |
| 98 | Ga0395900_0260823 | 3300037418 | Bacteria | 1731 |
| 99 | Ga0395900_0650568 | 3300037418 | Bacteria | 991 |
| 100 | Ga0395900_0681889 | 3300037418 | Bacteria | 962 |
| 101 | Ga0395905_0325624 | 3300037471 | Bacteria | 1427 |
| 102 | Ga0436364_0188384 | 3300037853 | Bacteria | 1142 |
| 103 | Ga0436364_0818351 | 3300037853 | Bacteria | 741 |
| 104 | Ga0436364_0972810 | 3300037853 | Bacteria | 1550 |
| 105 | Ga0395901_0150117 | 3300038443 | Bacteria | 2449 |
| 106 | Ga0395901_0671370 | 3300038443 | Bacteria | 1037 |
| 107 | Ga0436365_0395588 | 3300039437 | Bacteria | 13955 |
| 108 | Ga0436365_0969934 | 3300039437 | Bacteria | 6774 |
| 109 | Ga0436365_1126585 | 3300039437 | Bacteria | 4895 |
| 110 | Ga0436365_1501073 | 3300039437 | Bacteria | 1247 |
| 111 | Ga0436365_1916134 | 3300039437 | Bacteria | 696 |
| 112 | Ga0436365_1929325 | 3300039437 | Bacteria | 1170 |
| 113 | Ga0436363_0338810 | 3300039450 | Bacteria | 1098 |
| 114 | Ga0436363_0800975 | 3300039450 | Bacteria | 722 |
| 115 | Ga0436362_0143016 | 3300039453 | Bacteria | 1686 |
| 116 | Ga0436362_0667433 | 3300039453 | Bacteria | 1718 |
| 117 | Ga0436362_0871071 | 3300039453 | Bacteria | 2122 |
| 118 | Ga0466969_0024548 | 3300044656 | Bacteria | 3101 |
| 119 | Ga0466966_0164339 | 3300044684 | Bacteria | 1351 |
| 120 | Ga0466961_0001294 | 3300044693 | Bacteria | 15444 |
| 121 | Ga0466963_0007290 | 3300044694 | Bacteria | 6594 |
| 122 | Ga0466963_0043588 | 3300044694 | Bacteria | 2951 |
| 123 | Ga0466963_0308963 | 3300044694 | Bacteria | 1112 |
| 124 | Ga0466963_0343935 | 3300044694 | Bacteria | 1050 |
| 125 | Ga0466959_0028474 | 3300045049 | Bacteria | 4143 |
| 126 | Ga0466958_0048409 | 3300045836 | Bacteria | 2569 |
| 127 | Ga0466958_0049410 | 3300045836 | Bacteria | 2545 |
| 128 | Ga0466958_0079219 | 3300045836 | Bacteria | 2020 |
| 129 | Ga0466958_0510349 | 3300045836 | Bacteria | 780 |
| 130 | Ga0466958_0545029 | 3300045836 | Bacteria | 754 |
| 131 | Ga0466958_0609189 | 3300045836 | Bacteria | 710 |
| 132 | Ga0466967_0004730 | 3300045976 | Bacteria | 9260 |
| 133 | Ga0466967_0041085 | 3300045976 | Bacteria | 3985 |
| 134 | Ga0466967_0208054 | 3300045976 | Bacteria | 1855 |
| 135 | Ga0495641_0035881 | 3300046461 | Bacteria | 2333 |
| 136 | Ga0495651_0154594 | 3300046462 | Bacteria | 1650 |
| 137 | Ga0495653_0020781 | 3300046463 | Bacteria | 5318 |
| 138 | Ga0495582_0194063 | 3300046473 | Bacteria | 1159 |
| 139 | Ga0495618_0001054 | 3300046514 | Bacteria | 18809 |
| 140 | Ga0495630_0000386 | 3300046517 | Bacteria | 34684 |
| 141 | Ga0495586_0347897 | 3300046535 | Bacteria | 851 |
| 142 | Ga0495645_0000121 | 3300046543 | Bacteria | 52863 |
| 143 | Ga0495657_0000008 | 3300046675 | Bacteria | 221090 |
| 144 | Ga0495581_0374593 | 3300047315 | Bacteria | 831 |
| 145 | Ga0495676_0028674 | 3300047321 | Bacteria | 4750 |
| 146 | Ga0495676_0312072 | 3300047321 | Bacteria | 1058 |
| 147 | Ga0495684_0246990 | 3300047471 | Bacteria | 1299 |
| 148 | Ga0496100_0031136 | 3300048903 | Bacteria | 3314 |
| 149 | Ga0496101_0528132 | 3300048904 | Bacteria | 933 |
| 150 | Ga0496103_0542039 | 3300048906 | Bacteria | 743 |
| 151 | Ga0496104_0000001 | 3300048907 | Bacteria | 711867 |
| 152 | Ga0496104_0383946 | 3300048907 | Bacteria | 1317 |
| 153 | Ga0496107_0087849 | 3300048910 | Bacteria | 2270 |
| 154 | Ga0496109_0358956 | 3300048912 | Bacteria | 1377 |
| 155 | Ga0496110_0007903 | 3300048913 | Bacteria | 8520 |
| 156 | Ga0496110_0106677 | 3300048913 | Bacteria | 2514 |
| 157 | Ga0496111_0000769 | 3300048914 | Bacteria | 17119 |
| 158 | Ga0496111_0130789 | 3300048914 | Bacteria | 1857 |
| 159 | Ga0496113_0564819 | 3300048916 | Bacteria | 912 |
| 160 | Ga0496115_0000034 | 3300048918 | Bacteria | 135380 |
| 161 | Ga0496115_0000240 | 3300048918 | Bacteria | 49737 |
| 162 | Ga0496115_0903573 | 3300048918 | Bacteria | 681 |
| 163 | Ga0501047_0445713 | 3300049581 | Bacteria | 1124 |
| 164 | Ga0501068_0769864 | 3300049584 | Bacteria | 631 |
| 165 | Ga0501076_0026533 | 3300049592 | Bacteria | 4489 |
| 166 | Ga0501081_0702669 | 3300049743 | Bacteria | 759 |
| 167 | Ga0501035_0017112 | 3300049822 | Bacteria | 6680 |
| 168 | nmdc:mga05p37_541776_c1 | 3300050507 | Bacteria | 1327 |
| 169 | nmdc:mga09592_344873_c1 | 3300050508 | Bacteria | 1289 |
| 170 | nmdc:mga08y16_769951_c1 | 3300050511 | Bacteria | 957 |
| 171 | nmdc:mga08y16_86268_c1 | 3300050511 | Bacteria | 3271 |
| 172 | nmdc:mga0n895_112423_c1 | 3300050512 | Bacteria | 2740 |
| 173 | Ga0495601_0627112 | 3300053077 | Bacteria | 689 |
| 174 | Ga0495612_0000107 | 3300053078 | Bacteria | 35645 |
| 175 | Ga0495612_0258593 | 3300053078 | Bacteria | 775 |
| 176 | Ga0495619_0122663 | 3300053085 | Bacteria | 1782 |
| 177 | Ga0495619_0243096 | 3300053085 | Bacteria | 1247 |
| 178 | Ga0501084_0320743 | 3300054114 | Bacteria | 1309 |
| 179 | Ga0466962_0052700 | 3300061719 | Bacteria | 1944 |
| 180 | Ga0466962_0190376 | 3300061719 | Bacteria | 1001 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032004 | Ga0307414_10145287 | Ga0307414_101452873 | 165 |
| 2 | 3300032126 | Ga0307415_100045640 | Ga0307415_1000456403 | 165 |
| 3 | 3300005981 | Ga0081538_10005012 | Ga0081538_100050128 | 166 |
| 4 | 3300009147 | Ga0114129_10063364 | Ga0114129_100633644 | 178 |
| 5 | 3300050507 | nmdc:mga05p37_541776_c1 | nmdc:mga05p37_541776_c1_134_682 | 178 |
| 6 | 3300049581 | Ga0501047_0445713 | Ga0501047_0445713_401_1015 | 185 |
| 7 | 3300049822 | Ga0501035_0017112 | Ga0501035_0017112_90_704 | 185 |
| 8 | 3300005444 | Ga0070694_100170733 | Ga0070694_1001707333 | 187 |
| 9 | 3300005545 | Ga0070695_100027660 | Ga0070695_1000276604 | 187 |
| 10 | 3300005549 | Ga0070704_100611019 | Ga0070704_1006110192 | 187 |
| 11 | 3300006852 | Ga0075433_10021913 | Ga0075433_100219134 | 187 |
| 12 | 3300009147 | Ga0114129_10506127 | Ga0114129_105061271 | 187 |
| 13 | 3300046462 | Ga0495651_0154594 | Ga0495651_0154594_821_1399 | 187 |
| 14 | 3300046463 | Ga0495653_0020781 | Ga0495653_0020781_1941_2519 | 187 |
| 15 | 3300046514 | Ga0495618_0001054 | Ga0495618_0001054_18193_18771 | 187 |
| 16 | 3300046543 | Ga0495645_0000121 | Ga0495645_0000121_45049_45627 | 187 |
| 17 | 3300053078 | Ga0495612_0000107 | Ga0495612_0000107_107_685 | 187 |
| 18 | 3300053085 | Ga0495619_0122663 | Ga0495619_0122663_137_715 | 187 |
| 19 | 3300009094 | Ga0111539_10068700 | Ga0111539_100687004 | 188 |
| 20 | 3300035170 | Ga0373943_0658397 | Ga0373943_0658397_19_606 | 188 |
| 21 | 3300039437 | Ga0436365_0395588 | Ga0436365_0395588_7878_8453 | 188 |
| 22 | 3300039437 | Ga0436365_1126585 | Ga0436365_1126585_1225_1800 | 188 |
| 23 | 3300039453 | Ga0436362_0667433 | Ga0436362_0667433_758_1333 | 188 |
| 24 | 3300054114 | Ga0501084_0320743 | Ga0501084_0320743_348_920 | 188 |
| 25 | 3300061719 | Ga0466962_0052700 | Ga0466962_0052700_1302_1892 | 188 |
| 26 | 3300025934 | Ga0207686_10384863 | Ga0207686_103848632 | 191 |
| 27 | 3300048903 | Ga0496100_0031136 | Ga0496100_0031136_2092_2691 | 191 |
| 28 | 3300048904 | Ga0496101_0528132 | Ga0496101_0528132_247_846 | 191 |
| 29 | 3300048918 | Ga0496115_0000240 | Ga0496115_0000240_29745_30395 | 191 |
| 30 | 3300028800 | Ga0265338_10099477 | Ga0265338_100994773 | 193 |
| 31 | 3300005445 | Ga0070708_100013766 | Ga0070708_1000137664 | 194 |
| 32 | 3300005468 | Ga0070707_100009321 | Ga0070707_1000093215 | 194 |
| 33 | 3300005468 | Ga0070707_100047701 | Ga0070707_1000477012 | 194 |
| 34 | 3300006844 | Ga0075428_100259890 | Ga0075428_1002598903 | 194 |
| 35 | 3300006880 | Ga0075429_100198243 | Ga0075429_1001982433 | 194 |
| 36 | 3300025914 | Ga0207671_10001620 | Ga0207671_1000162010 | 194 |
| 37 | 3300046535 | Ga0495586_0347897 | Ga0495586_0347897_121_723 | 194 |
| 38 | 3300049592 | Ga0501076_0026533 | Ga0501076_0026533_62_664 | 194 |
| 39 | 3300050508 | nmdc:mga09592_344873_c1 | nmdc:mga09592_344873_c1_231_833 | 194 |
| 40 | 3300005937 | Ga0081455_10004899 | Ga0081455_1000489914 | 195 |
| 41 | 3300005981 | Ga0081538_10047823 | Ga0081538_100478233 | 195 |
| 42 | 3300005983 | Ga0081540_1002959 | Ga0081540_10029593 | 195 |
| 43 | 3300006028 | Ga0070717_10013355 | Ga0070717_100133555 | 195 |
| 44 | 3300009098 | Ga0105245_10195035 | Ga0105245_101950352 | 195 |
| 45 | 3300009098 | Ga0105245_11666695 | Ga0105245_116666951 | 195 |
| 46 | 3300009545 | Ga0105237_10003537 | Ga0105237_1000353717 | 195 |
| 47 | 3300009553 | Ga0105249_11009905 | Ga0105249_110099052 | 195 |
| 48 | 3300013306 | Ga0163162_10801643 | Ga0163162_108016431 | 195 |
| 49 | 3300020082 | Ga0206353_10394340 | Ga0206353_103943401 | 195 |
| 50 | 3300025927 | Ga0207687_10164647 | Ga0207687_101646473 | 195 |
| 51 | 3300025972 | Ga0207668_10750699 | Ga0207668_107506991 | 195 |
| 52 | 3300037418 | Ga0395900_0260823 | Ga0395900_0260823_680_1270 | 195 |
| 53 | 3300037418 | Ga0395900_0650568 | Ga0395900_0650568_319_909 | 195 |
| 54 | 3300037418 | Ga0395900_0681889 | Ga0395900_0681889_103_693 | 195 |
| 55 | 3300037471 | Ga0395905_0325624 | Ga0395905_0325624_525_1115 | 195 |
| 56 | 3300038443 | Ga0395901_0150117 | Ga0395901_0150117_713_1303 | 195 |
| 57 | 3300039437 | Ga0436365_1916134 | Ga0436365_1916134_33_644 | 195 |
| 58 | 3300045976 | Ga0466967_0004730 | Ga0466967_0004730_8093_8689 | 195 |
| 59 | 3300048906 | Ga0496103_0542039 | Ga0496103_0542039_49_639 | 195 |
| 60 | 3300048907 | Ga0496104_0383946 | Ga0496104_0383946_503_1093 | 195 |
| 61 | 3300048910 | Ga0496107_0087849 | Ga0496107_0087849_1346_1936 | 195 |
| 62 | 3300048912 | Ga0496109_0358956 | Ga0496109_0358956_188_778 | 195 |
| 63 | 3300048913 | Ga0496110_0106677 | Ga0496110_0106677_733_1323 | 195 |
| 64 | 3300048914 | Ga0496111_0130789 | Ga0496111_0130789_266_856 | 195 |
| 65 | 3300048916 | Ga0496113_0564819 | Ga0496113_0564819_161_751 | 195 |
| 66 | 3300005328 | Ga0070676_10244545 | Ga0070676_102445451 | 196 |
| 67 | 3300005435 | Ga0070714_100100082 | Ga0070714_1001000822 | 196 |
| 68 | 3300005435 | Ga0070714_100101326 | Ga0070714_1001013263 | 196 |
| 69 | 3300005435 | Ga0070714_100105049 | Ga0070714_1001050493 | 196 |
| 70 | 3300005435 | Ga0070714_100138347 | Ga0070714_1001383472 | 196 |
| 71 | 3300005436 | Ga0070713_100062738 | Ga0070713_1000627383 | 196 |
| 72 | 3300005436 | Ga0070713_100108561 | Ga0070713_1001085612 | 196 |
| 73 | 3300005436 | Ga0070713_100149859 | Ga0070713_1001498593 | 196 |
| 74 | 3300005549 | Ga0070704_100340371 | Ga0070704_1003403712 | 196 |
| 75 | 3300005564 | Ga0070664_100084303 | Ga0070664_1000843032 | 196 |
| 76 | 3300005719 | Ga0068861_100103771 | Ga0068861_1001037712 | 196 |
| 77 | 3300005844 | Ga0068862_100144899 | Ga0068862_1001448992 | 196 |
| 78 | 3300005844 | Ga0068862_100460811 | Ga0068862_1004608113 | 196 |
| 79 | 3300005983 | Ga0081540_1062633 | Ga0081540_10626332 | 196 |
| 80 | 3300005985 | Ga0081539_10029196 | Ga0081539_100291962 | 196 |
| 81 | 3300006028 | Ga0070717_10078388 | Ga0070717_100783882 | 196 |
| 82 | 3300006173 | Ga0070716_100004048 | Ga0070716_1000040483 | 196 |
| 83 | 3300006175 | Ga0070712_100420241 | Ga0070712_1004202411 | 196 |
| 84 | 3300006871 | Ga0075434_100113673 | Ga0075434_1001136733 | 196 |
| 85 | 3300009093 | Ga0105240_11113165 | Ga0105240_111131651 | 196 |
| 86 | 3300009093 | Ga0105240_11194672 | Ga0105240_111946721 | 196 |
| 87 | 3300009094 | Ga0111539_10177233 | Ga0111539_101772332 | 196 |
| 88 | 3300009094 | Ga0111539_10553507 | Ga0111539_105535073 | 196 |
| 89 | 3300009176 | Ga0105242_10651605 | Ga0105242_106516052 | 196 |
| 90 | 3300009551 | Ga0105238_10511160 | Ga0105238_105111602 | 196 |
| 91 | 3300017792 | Ga0163161_10706643 | Ga0163161_107066432 | 196 |
| 92 | 3300020082 | Ga0206353_11117694 | Ga0206353_111176942 | 196 |
| 93 | 3300020082 | Ga0206353_11142209 | Ga0206353_111422092 | 196 |
| 94 | 3300021358 | Ga0213873_10068753 | Ga0213873_100687531 | 196 |
| 95 | 3300021358 | Ga0213873_10076350 | Ga0213873_100763501 | 196 |
| 96 | 3300021384 | Ga0213876_10003706 | Ga0213876_100037063 | 196 |
| 97 | 3300021384 | Ga0213876_10076483 | Ga0213876_100764832 | 196 |
| 98 | 3300021388 | Ga0213875_10084884 | Ga0213875_100848841 | 196 |
| 99 | 3300025906 | Ga0207699_10308840 | Ga0207699_103088402 | 196 |
| 100 | 3300025916 | Ga0207663_10041488 | Ga0207663_100414882 | 196 |
| 101 | 3300025916 | Ga0207663_10080907 | Ga0207663_100809072 | 196 |
| 102 | 3300025923 | Ga0207681_10266296 | Ga0207681_102662962 | 196 |
| 103 | 3300025923 | Ga0207681_10580341 | Ga0207681_105803412 | 196 |
| 104 | 3300025928 | Ga0207700_10261292 | Ga0207700_102612922 | 196 |
| 105 | 3300025928 | Ga0207700_10362746 | Ga0207700_103627462 | 196 |
| 106 | 3300025928 | Ga0207700_10678494 | Ga0207700_106784941 | 196 |
| 107 | 3300025929 | Ga0207664_10030758 | Ga0207664_100307583 | 196 |
| 108 | 3300025929 | Ga0207664_10282584 | Ga0207664_102825842 | 196 |
| 109 | 3300025929 | Ga0207664_10418308 | Ga0207664_104183082 | 196 |
| 110 | 3300025935 | Ga0207709_10176839 | Ga0207709_101768392 | 196 |
| 111 | 3300025945 | Ga0207679_10246740 | Ga0207679_102467403 | 196 |
| 112 | 3300025972 | Ga0207668_10119655 | Ga0207668_101196553 | 196 |
| 113 | 3300026023 | Ga0207677_10284697 | Ga0207677_102846971 | 196 |
| 114 | 3300028380 | Ga0268265_10810534 | Ga0268265_108105342 | 196 |
| 115 | 3300028558 | Ga0265326_10000837 | Ga0265326_1000083713 | 196 |
| 116 | 3300028563 | Ga0265319_1000322 | Ga0265319_100032214 | 196 |
| 117 | 3300028577 | Ga0265318_10000252 | Ga0265318_100002523 | 196 |
| 118 | 3300028654 | Ga0265322_10108836 | Ga0265322_101088362 | 196 |
| 119 | 3300028666 | Ga0265336_10000001 | Ga0265336_10000001563 | 196 |
| 120 | 3300028800 | Ga0265338_10000004 | Ga0265338_10000004320 | 196 |
| 121 | 3300029957 | Ga0265324_10004000 | Ga0265324_100040008 | 196 |
| 122 | 3300031240 | Ga0265320_10025964 | Ga0265320_100259642 | 196 |
| 123 | 3300031240 | Ga0265320_10097388 | Ga0265320_100973882 | 196 |
| 124 | 3300031247 | Ga0265340_10000002 | Ga0265340_10000002320 | 196 |
| 125 | 3300031249 | Ga0265339_10073760 | Ga0265339_100737603 | 196 |
| 126 | 3300031251 | Ga0265327_10025594 | Ga0265327_100255942 | 196 |
| 127 | 3300031344 | Ga0265316_10123381 | Ga0265316_101233812 | 196 |
| 128 | 3300031712 | Ga0265342_10045086 | Ga0265342_100450863 | 196 |
| 129 | 3300032002 | Ga0307416_100141573 | Ga0307416_1001415734 | 196 |
| 130 | 3300032126 | Ga0307415_100021638 | Ga0307415_1000216382 | 196 |
| 131 | 3300037068 | Ga0373925_0158577 | Ga0373925_0158577_675_1298 | 196 |
| 132 | 3300037853 | Ga0436364_0188384 | Ga0436364_0188384_19_630 | 196 |
| 133 | 3300037853 | Ga0436364_0818351 | Ga0436364_0818351_90_689 | 196 |
| 134 | 3300037853 | Ga0436364_0972810 | Ga0436364_0972810_160_759 | 196 |
| 135 | 3300038443 | Ga0395901_0671370 | Ga0395901_0671370_302_901 | 196 |
| 136 | 3300039437 | Ga0436365_0969934 | Ga0436365_0969934_139_738 | 196 |
| 137 | 3300039437 | Ga0436365_1501073 | Ga0436365_1501073_77_676 | 196 |
| 138 | 3300039437 | Ga0436365_1929325 | Ga0436365_1929325_28_627 | 196 |
| 139 | 3300039450 | Ga0436363_0338810 | Ga0436363_0338810_489_1088 | 196 |
| 140 | 3300039450 | Ga0436363_0800975 | Ga0436363_0800975_38_637 | 196 |
| 141 | 3300039453 | Ga0436362_0143016 | Ga0436362_0143016_726_1325 | 196 |
| 142 | 3300039453 | Ga0436362_0871071 | Ga0436362_0871071_249_848 | 196 |
| 143 | 3300044656 | Ga0466969_0024548 | Ga0466969_0024548_1115_1813 | 196 |
| 144 | 3300044684 | Ga0466966_0164339 | Ga0466966_0164339_344_949 | 196 |
| 145 | 3300044693 | Ga0466961_0001294 | Ga0466961_0001294_10583_11182 | 196 |
| 146 | 3300044694 | Ga0466963_0007290 | Ga0466963_0007290_1017_1616 | 196 |
| 147 | 3300044694 | Ga0466963_0043588 | Ga0466963_0043588_961_1566 | 196 |
| 148 | 3300044694 | Ga0466963_0308963 | Ga0466963_0308963_287_892 | 196 |
| 149 | 3300044694 | Ga0466963_0343935 | Ga0466963_0343935_12_617 | 196 |
| 150 | 3300045049 | Ga0466959_0028474 | Ga0466959_0028474_2300_2899 | 196 |
| 151 | 3300045836 | Ga0466958_0048409 | Ga0466958_0048409_1284_1889 | 196 |
| 152 | 3300045836 | Ga0466958_0049410 | Ga0466958_0049410_650_1249 | 196 |
| 153 | 3300045836 | Ga0466958_0079219 | Ga0466958_0079219_513_1124 | 196 |
| 154 | 3300045836 | Ga0466958_0510349 | Ga0466958_0510349_147_752 | 196 |
| 155 | 3300045836 | Ga0466958_0545029 | Ga0466958_0545029_48_647 | 196 |
| 156 | 3300045836 | Ga0466958_0609189 | Ga0466958_0609189_70_669 | 196 |
| 157 | 3300045976 | Ga0466967_0041085 | Ga0466967_0041085_2854_3453 | 196 |
| 158 | 3300045976 | Ga0466967_0208054 | Ga0466967_0208054_594_1193 | 196 |
| 159 | 3300046461 | Ga0495641_0035881 | Ga0495641_0035881_678_1268 | 196 |
| 160 | 3300046473 | Ga0495582_0194063 | Ga0495582_0194063_212_835 | 196 |
| 161 | 3300046517 | Ga0495630_0000386 | Ga0495630_0000386_29827_30438 | 196 |
| 162 | 3300046675 | Ga0495657_0000008 | Ga0495657_0000008_35371_35982 | 196 |
| 163 | 3300047315 | Ga0495581_0374593 | Ga0495581_0374593_102_725 | 196 |
| 164 | 3300047321 | Ga0495676_0028674 | Ga0495676_0028674_712_1335 | 196 |
| 165 | 3300047321 | Ga0495676_0312072 | Ga0495676_0312072_36_626 | 196 |
| 166 | 3300047471 | Ga0495684_0246990 | Ga0495684_0246990_581_1192 | 196 |
| 167 | 3300048907 | Ga0496104_0000001 | Ga0496104_0000001_102122_102751 | 196 |
| 168 | 3300048913 | Ga0496110_0007903 | Ga0496110_0007903_4144_4773 | 196 |
| 169 | 3300048914 | Ga0496111_0000769 | Ga0496111_0000769_13485_14114 | 196 |
| 170 | 3300048918 | Ga0496115_0000034 | Ga0496115_0000034_106761_107435 | 196 |
| 171 | 3300048918 | Ga0496115_0903573 | Ga0496115_0903573_19_618 | 196 |
| 172 | 3300049584 | Ga0501068_0769864 | Ga0501068_0769864_15_614 | 196 |
| 173 | 3300049743 | Ga0501081_0702669 | Ga0501081_0702669_57_656 | 196 |
| 174 | 3300050511 | nmdc:mga08y16_769951_c1 | nmdc:mga08y16_769951_c1_343_942 | 196 |
| 175 | 3300050511 | nmdc:mga08y16_86268_c1 | nmdc:mga08y16_86268_c1_407_1006 | 196 |
| 176 | 3300050512 | nmdc:mga0n895_112423_c1 | nmdc:mga0n895_112423_c1_2051_2656 | 196 |
| 177 | 3300053077 | Ga0495601_0627112 | Ga0495601_0627112_60_671 | 196 |
| 178 | 3300053078 | Ga0495612_0258593 | Ga0495612_0258593_31_636 | 196 |
| 179 | 3300053085 | Ga0495619_0243096 | Ga0495619_0243096_198_815 | 196 |
| 180 | 3300061719 | Ga0466962_0190376 | Ga0466962_0190376_147_746 | 196 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a93-assembly1.cif.gz_F | complex of recf-recr-dna from thermus thermophilus. | 0.9385 | 79 | 169 |
| 8a93-assembly1.cif.gz_F | complex of recf-recr-dna from thermus thermophilus. | 0.9287 | 79 | 169 |
| 3ve5-assembly1.cif.gz_A | structure of recombination mediator protein recr16-196 deletion mutant | 0.9048 | 17 | 196 |
| 3ve5-assembly1.cif.gz_A | structure of recombination mediator protein recr16-196 deletion mutant | 0.8969 | 17 | 196 |
| 4o6o-assembly1.cif.gz_B | structural and functional studies the characterization of cys4 zinc-finger motif in the recombination mediator protein recr | 0.822 | 1 | 194 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3vdpC01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 | 0.9762 | 1 | 51 | 1.10.8.420 |
| 3vdpB01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 | 0.9759 | 3 | 51 | 1.10.8.420 |
| 3ve5A03 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9758 | 76 | 196 | 3.40.1360.10 |
| 3vdpA01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 | 0.9743 | 1 | 51 | 1.10.8.420 |
| af_P9WHI3_76_174_3.40.1360.10 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.97 | 76 | 168 | 3.40.1360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A268RH89-F1-model_v4 | Recombination protein RecR | 0.9741 | 70 | 171 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
| AF-A0A3D0TKE5-F1-model_v4 | Recombination protein RecR | 0.9634 | 49 | 171 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
| AF-W1XYN8-F1-model_v4 | Recombination protein RecR | 0.9624 | 38 | 151 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
| AF-W4U8H3-F1-model_v4 | deleted | 0.955 | 48 | 143 |
|
| AF-A0A268RH89-F1-model_v4 | Recombination protein RecR | 0.9467 | 70 | 171 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar