F273266

General Info

Members Datasets Scaffolds Average Seq Length
179 112 358 293

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100300593|Ga0068868_1003005932
Length 347
Sequence VTTSKTASNVAAPTQFLQTGEQGYAYRRFGEGSAWPLLFLQHFTGTLDNWDPAITDPLASGREIILFDNAGVGRSTGPVPPTVAGMAKHALAFLDGLGVATCDVLGFSLGGMIAQQMAQDRPSIIRRMILVGTAPRGGEDIMLLEKPSLAKYLTDANLRGYALLQKIFFAPTESSQAAGAAFIERLAQRKEDRDPRSGPAVAGAQMAAFRDWEKFTGDRFANLRNIRQPTLVVNGIHDEMIHVSNSYWLSQNLPNAVLLTYPDSGHGSLFQFSRVLCPACDGISHIRLRLRTVLSSSRYRTSSASRLWGQTSALVSSDPTFFAEWIARAGTNKTSPALSVTGGLPST

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
81 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
88 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
89 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
90 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
91 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
94 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
95 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
99 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
105 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
110 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.41
Rhizosphere 84.92
Stem 0
Stem Tuber 0
Unclassified 13.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100300593 3300005338 Bacteria 1363
2 JGI25404J52841_10015845 3300003659 Unclassified 1635
3 Ga0065715_10105786 3300005293 Bacteria 2871
4 Ga0065707_10035283 3300005295 Bacteria 983
5 Ga0070670_100281082 3300005331 Unclassified 1453
6 Ga0068868_100241327 3300005338 Bacteria 1518
7 Ga0070667_100141486 3300005367 Bacteria 2107
8 Ga0070703_10094249 3300005406 Bacteria 1044
9 Ga0070709_10047564 3300005434 Bacteria 2673
10 Ga0070714_100072976 3300005435 Bacteria 2972
11 Ga0070713_100132096 3300005436 Bacteria 2203
12 Ga0070713_100202565 3300005436 Bacteria 1793
13 Ga0070711_100025913 3300005439 Bacteria 3839
14 Ga0070705_100105739 3300005440 Bacteria 1788
15 Ga0070694_100056472 3300005444 Bacteria 2667
16 Ga0070694_100069149 3300005444 Unclassified 2428
17 Ga0070694_100163544 3300005444 Unclassified 1635
18 Ga0070662_100410612 3300005457 Bacteria 1119
19 Ga0070706_100042885 3300005467 Bacteria 4180
20 Ga0070706_100248107 3300005467 Bacteria 1662
21 Ga0070707_100146847 3300005468 Bacteria 2295
22 Ga0070698_100006636 3300005471 Bacteria 12548
23 Ga0070698_100013246 3300005471 Bacteria 8726
24 Ga0070698_100061155 3300005471 Bacteria 3800
25 Ga0070698_100079035 3300005471 Bacteria 3286
26 Ga0070699_100004582 3300005518 Bacteria 12231
27 Ga0070699_100062509 3300005518 Bacteria 3227
28 Ga0070699_100359576 3300005518 Bacteria 1312
29 Ga0070697_100002406 3300005536 Bacteria 14409
30 Ga0070695_100040662 3300005545 Bacteria 2944
31 Ga0070696_100018481 3300005546 Bacteria 4711
32 Ga0070696_100464752 3300005546 Bacteria 1001
33 Ga0070704_100020505 3300005549 Unclassified 4263
34 Ga0070704_100041483 3300005549 Bacteria 3176
35 Ga0068859_100701799 3300005617 Bacteria 1102
36 Ga0068864_100094582 3300005618 Bacteria 2641
37 Ga0068861_100258287 3300005719 Unclassified 1490
38 Ga0068863_100161180 3300005841 Bacteria 2149
39 Ga0068863_100282982 3300005841 Bacteria 1607
40 Ga0068860_100080222 3300005843 Bacteria 3103
41 Ga0081455_10020359 3300005937 Archaea 6249
42 Ga0081455_10023675 3300005937 Bacteria 5708
43 Ga0081540_1000346 3300005983 Bacteria 46837
44 Ga0068871_100029552 3300006358 Bacteria 4305
45 Ga0068871_100280650 3300006358 Bacteria 1457
46 Ga0075428_100593966 3300006844 Bacteria 1183
47 Ga0075430_100089875 3300006846 Bacteria 2569
48 Ga0075433_10025817 3300006852 Bacteria 4968
49 Ga0075434_100002290 3300006871 Bacteria 16748
50 Ga0075434_100169172 3300006871 Bacteria 2205
51 Ga0075434_100336885 3300006871 Bacteria 1529
52 Ga0075434_100497113 3300006871 Bacteria 1240
53 Ga0075434_100604047 3300006871 Bacteria 1116
54 Ga0075434_100675097 3300006871 Bacteria 1051
55 Ga0068865_100571058 3300006881 Unclassified 952
56 Ga0075436_100153167 3300006914 Bacteria 1623
57 Ga0097620_100701777 3300006931 Bacteria 1102
58 Ga0075435_100033245 3300007076 Bacteria 4076
59 Ga0075435_100114882 3300007076 Bacteria 2241
60 Ga0075435_100222607 3300007076 Bacteria 1602
61 Ga0111539_10216506 3300009094 Bacteria 2231
62 Ga0111539_10396235 3300009094 Bacteria 1608
63 Ga0111539_10486344 3300009094 Bacteria 1438
64 Ga0111539_10544412 3300009094 Bacteria 1352
65 Ga0105245_10290537 3300009098 Unclassified 1601
66 Ga0114129_10017595 3300009147 Bacteria 10175
67 Ga0114129_10113484 3300009147 Bacteria 3736
68 Ga0114129_10171217 3300009147 Unclassified 2960
69 Ga0114129_10328684 3300009147 Bacteria 2031
70 Ga0105241_10347903 3300009174 Unclassified 1286
71 Ga0105242_10029380 3300009176 Bacteria 4384
72 Ga0105248_10030021 3300009177 Bacteria 6067
73 Ga0105248_10140046 3300009177 Bacteria 2729
74 Ga0105248_10154780 3300009177 Bacteria 2587
75 Ga0105239_10151968 3300010375 Unclassified 2584
76 Ga0105239_10633268 3300010375 Bacteria 1221
77 Ga0157374_10415359 3300013296 Unclassified 1344
78 Ga0157378_10001207 3300013297 Bacteria 23457
79 Ga0163162_10038671 3300013306 Bacteria 4761
80 Ga0163162_10169325 3300013306 Unclassified 2309
81 Ga0163162_10591695 3300013306 Bacteria 1236
82 Ga0157375_10045296 3300013308 Bacteria 4280
83 Ga0163163_10000048 3300014325 Bacteria 130746
84 Ga0163163_10382819 3300014325 Bacteria 1464
85 Ga0157379_10192241 3300014968 Bacteria 1844
86 Ga0157379_10237682 3300014968 Bacteria 1652
87 Ga0157376_10365617 3300014969 Bacteria 1385
88 Ga0228598_1000672 3300024227 Bacteria 7211
89 Ga0207684_10035088 3300025910 Bacteria 4259
90 Ga0207654_10129038 3300025911 Bacteria 1598
91 Ga0207646_10009333 3300025922 Bacteria 9700
92 Ga0207646_10056538 3300025922 Bacteria 3506
93 Ga0207646_10072162 3300025922 Bacteria 3084
94 Ga0207650_10295959 3300025925 Bacteria 1321
95 Ga0207687_10572411 3300025927 Unclassified 949
96 Ga0207700_10162012 3300025928 Bacteria 1858
97 Ga0207664_10018887 3300025929 Bacteria 5084
98 Ga0207644_10041197 3300025931 Bacteria 3266
99 Ga0207644_10073771 3300025931 Bacteria 2503
100 Ga0207644_10354579 3300025931 Bacteria 1192
101 Ga0207706_10116659 3300025933 Unclassified 2348
102 Ga0207686_10058483 3300025934 Bacteria 2430
103 Ga0207670_10093713 3300025936 Bacteria 2129
104 Ga0207704_10354887 3300025938 Bacteria 1143
105 Ga0207711_10032236 3300025941 Bacteria 4430
106 Ga0207711_10032290 3300025941 Bacteria 4426
107 Ga0207668_10438296 3300025972 Unclassified 1112
108 Ga0207658_10103799 3300025986 Bacteria 2232
109 Ga0207677_10201083 3300026023 Bacteria 1584
110 Ga0207703_10176690 3300026035 Bacteria 1882
111 Ga0207641_10088106 3300026088 Bacteria 2710
112 Ga0207641_10121623 3300026088 Bacteria 2330
113 Ga0207676_10289184 3300026095 Bacteria 1491
114 Ga0207428_10024354 3300027907 Bacteria 5082
115 Ga0268266_10008573 3300028379 Bacteria 9085
116 Ga0268265_10486323 3300028380 Unclassified 1160
117 Ga0268264_10666443 3300028381 Bacteria 1031
118 Ga0307513_10298996 3300031456 Bacteria 1377
119 Ga0265313_10000824 3300031595 Bacteria 31312
120 Ga0307409_100436849 3300031995 Bacteria 1260
121 Ga0373932_0009902 3300035112 Bacteria 2298
122 Ga0373931_0209022 3300035691 Bacteria 1169
123 Ga0395900_0079833 3300037418 Bacteria 3362
124 Ga0395900_0176720 3300037418 Unclassified 2171
125 Ga0395898_0086589 3300037466 Bacteria 3019
126 Ga0395905_0003570 3300037471 Bacteria 16560
127 Ga0436364_0797116 3300037853 Bacteria 7644
128 Ga0395901_0090627 3300038443 Bacteria 3200
129 Ga0453683_0091566 3300044673 Bacteria 1906
130 Ga0495613_0106012 3300046689 Bacteria 2028
131 Ga0495674_0023076 3300047319 Bacteria 5734
132 Ga0495684_0182097 3300047471 Bacteria 1557
133 Ga0496100_0077425 3300048903 Bacteria 2236
134 Ga0496100_0223301 3300048903 Unclassified 1383
135 Ga0496104_0226823 3300048907 Bacteria 1780
136 Ga0496104_0261410 3300048907 Bacteria 1643
137 Ga0496104_0329049 3300048907 Unclassified 1441
138 Ga0496105_0009222 3300048908 Bacteria 7706
139 Ga0496105_0078573 3300048908 Bacteria 2724
140 Ga0496106_0055925 3300048909 Bacteria 2983
141 Ga0496107_0221060 3300048910 Bacteria 1409
142 Ga0496108_0010678 3300048911 Bacteria 7451
143 Ga0496108_0095456 3300048911 Bacteria 2532
144 Ga0496108_0294706 3300048911 Unclassified 1413
145 Ga0496109_0068584 3300048912 Bacteria 3250
146 Ga0496109_0086686 3300048912 Bacteria 2892
147 Ga0496110_0063141 3300048913 Bacteria 3272
148 Ga0496111_0007398 3300048914 Bacteria 7193
149 Ga0496111_0247146 3300048914 Bacteria 1324
150 Ga0496111_0343055 3300048914 Bacteria 1106
151 Ga0496112_0212704 3300048915 Unclassified 1890
152 Ga0496112_0535919 3300048915 Unclassified 1105
153 Ga0496113_0003180 3300048916 Bacteria 9782
154 Ga0496114_0051352 3300048917 Bacteria 3433
155 Ga0496115_0056426 3300048918 Unclassified 3157
156 Ga0496115_0066572 3300048918 Bacteria 2911
157 Ga0496119_0000576 3300048922 Bacteria 49432
158 Ga0501076_0222915 3300049592 Bacteria 1541
159 nmdc:mga05p37_271084_c1 3300050507 Bacteria 2028
160 nmdc:mga05p37_35121_c1 3300050507 Bacteria 2810
161 nmdc:mga05p37_452151_c1 3300050507 Bacteria 1486
162 nmdc:mga05p37_6221_c1 3300050507 Bacteria 14052
163 nmdc:mga05p37_788288_c1 3300050507 Bacteria 1042
164 nmdc:mga09592_284608_c1 3300050508 Bacteria 1433
165 nmdc:mga08y16_541227_c1 3300050511 Bacteria 1179
166 nmdc:mga08y16_59690_c1 3300050511 Bacteria 3984
167 nmdc:mga0n895_159683_c1 3300050512 Bacteria 2285
168 nmdc:mga0n895_23665_c1 3300050512 Bacteria 5777
169 nmdc:mga0n895_246614_c1 3300050512 Bacteria 1813
170 nmdc:mga0n895_268245_c1 3300050512 Bacteria 1731
171 nmdc:mga0n895_329421_c1 3300050512 Bacteria 1547
172 nmdc:mga0n895_579456_c1 3300050512 Bacteria 1126
173 nmdc:mga0n895_61932_c1 3300050512 Bacteria 3696
174 nmdc:mga0rr50_14240_c1 3300050513 Bacteria 5210
175 nmdc:mga0rr50_264811_c1 3300050513 Bacteria 1431
176 nmdc:mga0rr50_280613_c1 3300050513 Unclassified 1390
177 nmdc:mga08x19_66439_c1 3300050514 Bacteria 2344
178 nmdc:mga0a205_29284_c1 3300050515 Bacteria 5269
179 nmdc:mga0a205_79404_c1 3300050515 Bacteria 3171
180 Ga0068868_100300593
181 JGI25404J52841_10015845
182 Ga0065715_10105786
183 Ga0065707_10035283
184 Ga0070670_100281082
185 Ga0068868_100241327
186 Ga0070667_100141486
187 Ga0070703_10094249
188 Ga0070709_10047564
189 Ga0070714_100072976
190 Ga0070713_100132096
191 Ga0070713_100202565
192 Ga0070711_100025913
193 Ga0070705_100105739
194 Ga0070694_100056472
195 Ga0070694_100069149
196 Ga0070694_100163544
197 Ga0070662_100410612
198 Ga0070706_100042885
199 Ga0070706_100248107
200 Ga0070707_100146847
201 Ga0070698_100006636
202 Ga0070698_100013246
203 Ga0070698_100061155
204 Ga0070698_100079035
205 Ga0070699_100004582
206 Ga0070699_100062509
207 Ga0070699_100359576
208 Ga0070697_100002406
209 Ga0070695_100040662
210 Ga0070696_100018481
211 Ga0070696_100464752
212 Ga0070704_100020505
213 Ga0070704_100041483
214 Ga0068859_100701799
215 Ga0068864_100094582
216 Ga0068861_100258287
217 Ga0068863_100161180
218 Ga0068863_100282982
219 Ga0068860_100080222
220 Ga0081455_10020359
221 Ga0081455_10023675
222 Ga0081540_1000346
223 Ga0068871_100029552
224 Ga0068871_100280650
225 Ga0075428_100593966
226 Ga0075430_100089875
227 Ga0075433_10025817
228 Ga0075434_100002290
229 Ga0075434_100169172
230 Ga0075434_100336885
231 Ga0075434_100497113
232 Ga0075434_100604047
233 Ga0075434_100675097
234 Ga0068865_100571058
235 Ga0075436_100153167
236 Ga0097620_100701777
237 Ga0075435_100033245
238 Ga0075435_100114882
239 Ga0075435_100222607
240 Ga0111539_10216506
241 Ga0111539_10396235
242 Ga0111539_10486344
243 Ga0111539_10544412
244 Ga0105245_10290537
245 Ga0114129_10017595
246 Ga0114129_10113484
247 Ga0114129_10171217
248 Ga0114129_10328684
249 Ga0105241_10347903
250 Ga0105242_10029380
251 Ga0105248_10030021
252 Ga0105248_10140046
253 Ga0105248_10154780
254 Ga0105239_10151968
255 Ga0105239_10633268
256 Ga0157374_10415359
257 Ga0157378_10001207
258 Ga0163162_10038671
259 Ga0163162_10169325
260 Ga0163162_10591695
261 Ga0157375_10045296
262 Ga0163163_10000048
263 Ga0163163_10382819
264 Ga0157379_10192241
265 Ga0157379_10237682
266 Ga0157376_10365617
267 Ga0228598_1000672
268 Ga0207684_10035088
269 Ga0207654_10129038
270 Ga0207646_10009333
271 Ga0207646_10056538
272 Ga0207646_10072162
273 Ga0207650_10295959
274 Ga0207687_10572411
275 Ga0207700_10162012
276 Ga0207664_10018887
277 Ga0207644_10041197
278 Ga0207644_10073771
279 Ga0207644_10354579
280 Ga0207706_10116659
281 Ga0207686_10058483
282 Ga0207670_10093713
283 Ga0207704_10354887
284 Ga0207711_10032236
285 Ga0207711_10032290
286 Ga0207668_10438296
287 Ga0207658_10103799
288 Ga0207677_10201083
289 Ga0207703_10176690
290 Ga0207641_10088106
291 Ga0207641_10121623
292 Ga0207676_10289184
293 Ga0207428_10024354
294 Ga0268266_10008573
295 Ga0268265_10486323
296 Ga0268264_10666443
297 Ga0307513_10298996
298 Ga0265313_10000824
299 Ga0307409_100436849
300 Ga0373932_0009902
301 Ga0373931_0209022
302 Ga0395900_0079833
303 Ga0395900_0176720
304 Ga0395898_0086589
305 Ga0395905_0003570
306 Ga0436364_0797116
307 Ga0395901_0090627
308 Ga0453683_0091566
309 Ga0495613_0106012
310 Ga0495674_0023076
311 Ga0495684_0182097
312 Ga0496100_0077425
313 Ga0496100_0223301
314 Ga0496104_0226823
315 Ga0496104_0261410
316 Ga0496104_0329049
317 Ga0496105_0009222
318 Ga0496105_0078573
319 Ga0496106_0055925
320 Ga0496107_0221060
321 Ga0496108_0010678
322 Ga0496108_0095456
323 Ga0496108_0294706
324 Ga0496109_0068584
325 Ga0496109_0086686
326 Ga0496110_0063141
327 Ga0496111_0007398
328 Ga0496111_0247146
329 Ga0496111_0343055
330 Ga0496112_0212704
331 Ga0496112_0535919
332 Ga0496113_0003180
333 Ga0496114_0051352
334 Ga0496115_0056426
335 Ga0496115_0066572
336 Ga0496119_0000576
337 Ga0501076_0222915
338 nmdc:mga05p37_271084_c1
339 nmdc:mga05p37_35121_c1
340 nmdc:mga05p37_452151_c1
341 nmdc:mga05p37_6221_c1
342 nmdc:mga05p37_788288_c1
343 nmdc:mga09592_284608_c1
344 nmdc:mga08y16_541227_c1
345 nmdc:mga08y16_59690_c1
346 nmdc:mga0n895_159683_c1
347 nmdc:mga0n895_23665_c1
348 nmdc:mga0n895_246614_c1
349 nmdc:mga0n895_268245_c1
350 nmdc:mga0n895_329421_c1
351 nmdc:mga0n895_579456_c1
352 nmdc:mga0n895_61932_c1
353 nmdc:mga0rr50_14240_c1
354 nmdc:mga0rr50_264811_c1
355 nmdc:mga0rr50_280613_c1
356 nmdc:mga08x19_66439_c1
357 nmdc:mga0a205_29284_c1
358 nmdc:mga0a205_79404_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

36

273

0.89

PF12146

Hydrolase_4

Serine aminopeptidase, S33

51

271

0.78

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

28

278

0.59

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pw0-assembly1.cif.gz_A-2 alpha/beta hydrolase fold protein from chitinophaga pinensis 0.9451 8 287
4pw0-assembly1.cif.gz_A-2 alpha/beta hydrolase fold protein from chitinophaga pinensis 0.9352 8 287
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8771 10 134
6eb3-assembly1.cif.gz_A structural and enzymatic characterization of an esterase from a metagenomic library 0.8682 15 289
6eb3-assembly3.cif.gz_C structural and enzymatic characterization of an esterase from a metagenomic library 0.863 15 289
ID Description Score Start End Superfamily
af_O53327_8_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9557 7 285 3.40.50.1820
af_O53327_8_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9389 7 285 3.40.50.1820
4pw0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9366 8 287 3.40.50.1820
4pw0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9265 8 287 3.40.50.1820
af_A0A1D6G795_43_176_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8592 224 284 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2P8G2C1-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.975 8 287
AF-A0A6P2ZTK3-F1-model_v4 Alpha/beta hydrolase 0.9587 13 140 GO:0016787
AF-A0A2V8N4B6-F1-model_v4 Alpha/beta hydrolase 0.9554 8 287 GO:0016787
AF-A0A1H9KD53-F1-model_v4 NADPH:quinone reductase 0.9527 8 289 GO:0016491
AF-A0A2N2QIT6-F1-model_v4 deleted 0.9497 1 287

Map