F271001

General Info

Members Datasets Scaffolds Average Seq Length
177 67 354 308

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_75897_c1|nmdc:mga09592_75897_c1_565_1575
Length 336
Sequence MGIDRAGSLLSLVEQIGREAFRRNNSANMTSASAPGKIILFGEHAVVYGRPALAVPVTQVHVDVEISDNDSAGIWLSAPDVDLHAELNMLPSDHPIASVIHNLFFLSRVSPFPNLNVKISSTIPVASGLGSGAAVTVALTRALSEHINYAMTDEQVSAFAYEIEKLHHGTPSGIDNTVVTYAKPVYFVKGQPIETFKVRQPFTIVVADTGISAPTKESVGDVRKLWETDKAKWENMFDEVADISFSARHVIREGWIKMLGALMDENHAYLQEMTVSSPELDNLVSVARKAGALGAKMSGGGRGGNMIALVEEETAPVIAEALMSAGAKRIITTQVS

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
30 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
31 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
32 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
33 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
34 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
35 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
36 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
37 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
38 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
39 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
40 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
41 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
42 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
43 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
44 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
47 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
48 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
49 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
50 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
51 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
52 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
53 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
54 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
55 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
56 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
57 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
59 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
60 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
61 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
62 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
63 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
64 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
65 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
66 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
67 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 1.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.74
Stem 0
Stem Tuber 0
Unclassified 21.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_75897_c1 3300050508 Bacteria 2203
2 JGI25406J46586_10002578 3300003203 Bacteria 8558
3 Ga0065707_10000664 3300005295 Bacteria 18061
4 Ga0065707_10085366 3300005295 Bacteria 6212
5 Ga0065707_10108829 3300005295 Bacteria 2493
6 Ga0070689_100027346 3300005340 Bacteria 4300
7 Ga0070700_100098873 3300005441 Bacteria 1919
8 Ga0070694_100156670 3300005444 Bacteria 1668
9 Ga0070706_100134264 3300005467 Bacteria 2310
10 Ga0070698_100167217 3300005471 Bacteria 2141
11 Ga0070699_100002605 3300005518 Bacteria 16114
12 Ga0070699_100024444 3300005518 Bacteria 5206
13 Ga0070704_100021481 3300005549 Bacteria 4186
14 Ga0068859_100313054 3300005617 Bacteria 1663
15 Ga0068864_100035313 3300005618 Bacteria 4256
16 Ga0068870_10026717 3300005840 Bacteria 2880
17 Ga0068862_100193013 3300005844 Bacteria 1833
18 Ga0068862_100407812 3300005844 Unclassified 1273
19 Ga0068862_100429263 3300005844 Bacteria 1242
20 Ga0081539_10002200 3300005985 Bacteria 28511
21 Ga0081539_10005821 3300005985 Bacteria 12245
22 Ga0075428_100131021 3300006844 Bacteria 2727
23 Ga0075428_100222881 3300006844 Bacteria 2036
24 Ga0075431_100066632 3300006847 Unclassified 3718
25 Ga0075431_100086064 3300006847 Bacteria 3244
26 Ga0075433_10242527 3300006852 Bacteria 1600
27 Ga0075429_100000999 3300006880 Bacteria 22483
28 Ga0075429_100057807 3300006880 Bacteria 3377
29 Ga0075429_100146639 3300006880 Bacteria 2065
30 Ga0097620_100313042 3300006931 Bacteria 1663
31 Ga0114129_10002239 3300009147 Bacteria 26695
32 Ga0114129_10079864 3300009147 Bacteria 4548
33 Ga0114129_10213660 3300009147 Bacteria 2606
34 Ga0114129_10265121 3300009147 Bacteria 2300
35 Ga0114129_10314208 3300009147 Unclassified 2085
36 Ga0105237_10015556 3300009545 Bacteria 7913
37 Ga0105249_10164018 3300009553 Bacteria 2150
38 Ga0105246_10031391 3300011119 Bacteria 3515
39 Ga0207643_10056764 3300025908 Bacteria 2227
40 Ga0207684_10081565 3300025910 Bacteria 2752
41 Ga0207676_10090100 3300026095 Bacteria 2516
42 Ga0268265_10026947 3300028380 Unclassified 4095
43 Ga0268265_10080134 3300028380 Bacteria 2574
44 Ga0265323_10064907 3300028653 Unclassified 1260
45 Ga0265320_10019523 3300031240 Bacteria 3703
46 Ga0265340_10004437 3300031247 Bacteria 7838
47 Ga0265340_10050362 3300031247 Bacteria 2021
48 Ga0265331_10007457 3300031250 Bacteria 6324
49 Ga0265327_10011435 3300031251 Bacteria 6109
50 Ga0316575_10066955 3300031665 Bacteria 1439
51 Ga0316579_10000611 3300031691 Bacteria 12063
52 Ga0316579_10022337 3300031691 Bacteria 2828
53 Ga0316579_10024253 3300031691 Bacteria 2729
54 Ga0316579_10040926 3300031691 Unclassified 2150
55 Ga0316576_10003618 3300031727 Bacteria 9115
56 Ga0316576_10007120 3300031727 Bacteria 7013
57 Ga0316576_10009056 3300031727 Bacteria 6404
58 Ga0316576_10084963 3300031727 Bacteria 2352
59 Ga0316576_10087448 3300031727 Bacteria 2319
60 Ga0316576_10123238 3300031727 Bacteria 1947
61 Ga0316578_10001984 3300031728 Bacteria 8688
62 Ga0316578_10002730 3300031728 Bacteria 7852
63 Ga0316578_10010261 3300031728 Unclassified 4855
64 Ga0316578_10046111 3300031728 Bacteria 2540
65 Ga0316578_10140956 3300031728 Unclassified 1452
66 Ga0316577_10003997 3300031733 Bacteria 7546
67 Ga0316577_10004777 3300031733 Bacteria 7039
68 Ga0316577_10023060 3300031733 Unclassified 3457
69 Ga0316577_10085472 3300031733 Bacteria 1765
70 Ga0316577_10198215 3300031733 Unclassified 1135
71 Ga0307407_10074269 3300031903 Unclassified 2034
72 Ga0307409_100313127 3300031995 Unclassified 1466
73 Ga0316583_10000034 3300032133 Bacteria 25820
74 Ga0316585_10001939 3300032137 Bacteria 5531
75 Ga0316585_10007489 3300032137 Bacteria 3148
76 Ga0316585_10012916 3300032137 Unclassified 2483
77 Ga0316585_10033818 3300032137 Bacteria 1614
78 Ga0316580_10000202 3300032139 Bacteria 12174
79 Ga0316580_10067860 3300032139 Unclassified 1093
80 Ga0316593_10002415 3300032168 Bacteria 4420
81 Ga0316596_1000144 3300033541 Bacteria 9822
82 Ga0316596_1030216 3300033541 Bacteria 1405
83 Ga0316574_0003566 3300035398 Bacteria 8043
84 Ga0316574_0003898 3300035398 Bacteria 7753
85 Ga0316574_0009866 3300035398 Bacteria 5368
86 Ga0316574_0018407 3300035398 Unclassified 4104
87 Ga0316574_0027416 3300035398 Bacteria 3432
88 Ga0316574_0054762 3300035398 Bacteria 2492
89 Ga0316574_0069202 3300035398 Bacteria 2227
90 Ga0316574_0167033 3300035398 Bacteria 1417
91 Ga0316574_0310333 3300035398 Unclassified 1002
92 Ga0316582_0000588 3300036647 Bacteria 14064
93 Ga0316582_0001345 3300036647 Bacteria 10690
94 Ga0316582_0003210 3300036647 Bacteria 7951
95 Ga0316582_0007281 3300036647 Bacteria 5885
96 Ga0316582_0031457 3300036647 Bacteria 3244
97 Ga0316582_0036103 3300036647 Bacteria 3056
98 Ga0316582_0185534 3300036647 Bacteria 1416
99 Ga0316584_0000160 3300036712 Bacteria 31266
100 Ga0316584_0001825 3300036712 Bacteria 13165
101 Ga0316584_0011870 3300036712 Bacteria 6137
102 Ga0316584_0037958 3300036712 Unclassified 3582
103 Ga0316584_0049173 3300036712 Bacteria 3152
104 Ga0316584_0067039 3300036712 Bacteria 2690
105 Ga0316584_0118070 3300036712 Bacteria 1983
106 Ga0316584_0148936 3300036712 Bacteria 1743
107 Ga0316584_0213376 3300036712 Bacteria 1420
108 Ga0316584_0240614 3300036712 Unclassified 1324
109 Ga0316584_0336325 3300036712 Unclassified 1086
110 Ga0316581_0008956 3300037588 Bacteria 2739
111 Ga0400484_14591 3300038725 Unclassified 1292
112 Ga0400488_06926 3300038741 Bacteria 1736
113 Ga0400489_11138 3300039093 Unclassified 1301
114 Ga0400489_53848 3300039093 Bacteria 23484
115 Ga0451577_0001598 3300042876 Bacteria 29510
116 Ga0451577_0008318 3300042876 Bacteria 10096
117 Ga0451577_0016696 3300042876 Bacteria 6789
118 Ga0451577_0102979 3300042876 Unclassified 2551
119 Ga0451577_0223518 3300042876 Bacteria 1702
120 Ga0453683_0000709 3300044673 Bacteria 34522
121 Ga0453683_0009061 3300044673 Bacteria 6646
122 Ga0453683_0076709 3300044673 Bacteria 2093
123 Ga0453683_0221136 3300044673 Bacteria 1204
124 Ga0453684_0000023 3300044712 Bacteria 857153
125 Ga0453684_0000670 3300044712 Bacteria 122645
126 Ga0453684_0000865 3300044712 Bacteria 101801
127 Ga0453684_0000894 3300044712 Bacteria 99515
128 Ga0453684_0001624 3300044712 Bacteria 61357
129 Ga0453684_0002291 3300044712 Bacteria 47029
130 Ga0453684_0002568 3300044712 Bacteria 43618
131 Ga0453684_0003732 3300044712 Bacteria 33729
132 Ga0453684_0004030 3300044712 Bacteria 31962
133 Ga0453684_0008432 3300044712 Bacteria 18459
134 Ga0453684_0017984 3300044712 Bacteria 10888
135 Ga0453684_0021024 3300044712 Bacteria 9786
136 Ga0453684_0024871 3300044712 Bacteria 8721
137 Ga0453684_0048097 3300044712 Bacteria 5646
138 Ga0453684_0048360 3300044712 Bacteria 5627
139 Ga0453684_0058346 3300044712 Bacteria 4986
140 Ga0453684_0093835 3300044712 Unclassified 3695
141 Ga0453684_0130653 3300044712 Unclassified 3014
142 Ga0453684_0172437 3300044712 Unclassified 2548
143 Ga0453684_0174055 3300044712 Unclassified 2534
144 Ga0453684_0280239 3300044712 Unclassified 1901
145 Ga0453684_0297753 3300044712 Bacteria 1834
146 Ga0453684_0771690 3300044712 Bacteria 1039
147 Ga0451576_0000311 3300045051 Bacteria 117825
148 Ga0451576_0002918 3300045051 Bacteria 24343
149 Ga0451576_0010532 3300045051 Bacteria 10597
150 Ga0451576_0066388 3300045051 Unclassified 3756
151 Ga0451576_0189126 3300045051 Unclassified 2150
152 Ga0451576_0228417 3300045051 Bacteria 1943
153 Ga0451576_0392263 3300045051 Bacteria 1455
154 Ga0451576_0554424 3300045051 Bacteria 1207
155 Ga0501034_0053148 3300049571 Bacteria 4081
156 Ga0501073_0053016 3300049589 Bacteria 2840
157 Ga0501073_0129017 3300049589 Unclassified 1753
158 Ga0501075_0044511 3300049591 Bacteria 3330
159 Ga0501076_0115617 3300049592 Unclassified 2171
160 Ga0501080_0064704 3300049742 Bacteria 3401
161 nmdc:mga05p37_226128_c1 3300050507 Bacteria 2256
162 nmdc:mga05p37_309984_c1 3300050507 Unclassified 1871
163 nmdc:mga05p37_617017_c1 3300050507 Bacteria 1221
164 nmdc:mga05p37_6708_c1 3300050507 Bacteria 13566
165 nmdc:mga05p37_98968_c1 3300050507 Bacteria 3593
166 nmdc:mga09592_124746_c1 3300050508 Unclassified 2213
167 nmdc:mga09592_258870_c1 3300050508 Bacteria 1509
168 nmdc:mga09592_28711_c1 3300050508 Unclassified 4623
169 nmdc:mga09592_31043_c1 3300050508 Bacteria 4451
170 nmdc:mga09592_8421_c1 3300050508 Bacteria 8384
171 nmdc:mga0qj67_196251_c1 3300050509 Unclassified 1640
172 nmdc:mga06r32_161918_c1 3300050510 Unclassified 2220
173 nmdc:mga06r32_279572_c1 3300050510 Bacteria 1656
174 nmdc:mga0n895_131333_c1 3300050512 Unclassified 2529
175 nmdc:mga0a205_83016_c1 3300050515 Unclassified 3095
176 Ga0501084_0007089 3300054114 Bacteria 9236
177 Ga0501084_0018354 3300054114 Bacteria 5826
178 nmdc:mga09592_75897_c1
179 JGI25406J46586_10002578
180 Ga0065707_10000664
181 Ga0065707_10085366
182 Ga0065707_10108829
183 Ga0070689_100027346
184 Ga0070700_100098873
185 Ga0070694_100156670
186 Ga0070706_100134264
187 Ga0070698_100167217
188 Ga0070699_100002605
189 Ga0070699_100024444
190 Ga0070704_100021481
191 Ga0068859_100313054
192 Ga0068864_100035313
193 Ga0068870_10026717
194 Ga0068862_100193013
195 Ga0068862_100407812
196 Ga0068862_100429263
197 Ga0081539_10002200
198 Ga0081539_10005821
199 Ga0075428_100131021
200 Ga0075428_100222881
201 Ga0075431_100066632
202 Ga0075431_100086064
203 Ga0075433_10242527
204 Ga0075429_100000999
205 Ga0075429_100057807
206 Ga0075429_100146639
207 Ga0097620_100313042
208 Ga0114129_10002239
209 Ga0114129_10079864
210 Ga0114129_10213660
211 Ga0114129_10265121
212 Ga0114129_10314208
213 Ga0105237_10015556
214 Ga0105249_10164018
215 Ga0105246_10031391
216 Ga0207643_10056764
217 Ga0207684_10081565
218 Ga0207676_10090100
219 Ga0268265_10026947
220 Ga0268265_10080134
221 Ga0265323_10064907
222 Ga0265320_10019523
223 Ga0265340_10004437
224 Ga0265340_10050362
225 Ga0265331_10007457
226 Ga0265327_10011435
227 Ga0316575_10066955
228 Ga0316579_10000611
229 Ga0316579_10022337
230 Ga0316579_10024253
231 Ga0316579_10040926
232 Ga0316576_10003618
233 Ga0316576_10007120
234 Ga0316576_10009056
235 Ga0316576_10084963
236 Ga0316576_10087448
237 Ga0316576_10123238
238 Ga0316578_10001984
239 Ga0316578_10002730
240 Ga0316578_10010261
241 Ga0316578_10046111
242 Ga0316578_10140956
243 Ga0316577_10003997
244 Ga0316577_10004777
245 Ga0316577_10023060
246 Ga0316577_10085472
247 Ga0316577_10198215
248 Ga0307407_10074269
249 Ga0307409_100313127
250 Ga0316583_10000034
251 Ga0316585_10001939
252 Ga0316585_10007489
253 Ga0316585_10012916
254 Ga0316585_10033818
255 Ga0316580_10000202
256 Ga0316580_10067860
257 Ga0316593_10002415
258 Ga0316596_1000144
259 Ga0316596_1030216
260 Ga0316574_0003566
261 Ga0316574_0003898
262 Ga0316574_0009866
263 Ga0316574_0018407
264 Ga0316574_0027416
265 Ga0316574_0054762
266 Ga0316574_0069202
267 Ga0316574_0167033
268 Ga0316574_0310333
269 Ga0316582_0000588
270 Ga0316582_0001345
271 Ga0316582_0003210
272 Ga0316582_0007281
273 Ga0316582_0031457
274 Ga0316582_0036103
275 Ga0316582_0185534
276 Ga0316584_0000160
277 Ga0316584_0001825
278 Ga0316584_0011870
279 Ga0316584_0037958
280 Ga0316584_0049173
281 Ga0316584_0067039
282 Ga0316584_0118070
283 Ga0316584_0148936
284 Ga0316584_0213376
285 Ga0316584_0240614
286 Ga0316584_0336325
287 Ga0316581_0008956
288 Ga0400484_14591
289 Ga0400488_06926
290 Ga0400489_11138
291 Ga0400489_53848
292 Ga0451577_0001598
293 Ga0451577_0008318
294 Ga0451577_0016696
295 Ga0451577_0102979
296 Ga0451577_0223518
297 Ga0453683_0000709
298 Ga0453683_0009061
299 Ga0453683_0076709
300 Ga0453683_0221136
301 Ga0453684_0000023
302 Ga0453684_0000670
303 Ga0453684_0000865
304 Ga0453684_0000894
305 Ga0453684_0001624
306 Ga0453684_0002291
307 Ga0453684_0002568
308 Ga0453684_0003732
309 Ga0453684_0004030
310 Ga0453684_0008432
311 Ga0453684_0017984
312 Ga0453684_0021024
313 Ga0453684_0024871
314 Ga0453684_0048097
315 Ga0453684_0048360
316 Ga0453684_0058346
317 Ga0453684_0093835
318 Ga0453684_0130653
319 Ga0453684_0172437
320 Ga0453684_0174055
321 Ga0453684_0280239
322 Ga0453684_0297753
323 Ga0453684_0771690
324 Ga0451576_0000311
325 Ga0451576_0002918
326 Ga0451576_0010532
327 Ga0451576_0066388
328 Ga0451576_0189126
329 Ga0451576_0228417
330 Ga0451576_0392263
331 Ga0451576_0554424
332 Ga0501034_0053148
333 Ga0501073_0053016
334 Ga0501073_0129017
335 Ga0501075_0044511
336 Ga0501076_0115617
337 Ga0501080_0064704
338 nmdc:mga05p37_226128_c1
339 nmdc:mga05p37_309984_c1
340 nmdc:mga05p37_617017_c1
341 nmdc:mga05p37_6708_c1
342 nmdc:mga05p37_98968_c1
343 nmdc:mga09592_124746_c1
344 nmdc:mga09592_258870_c1
345 nmdc:mga09592_28711_c1
346 nmdc:mga09592_31043_c1
347 nmdc:mga09592_8421_c1
348 nmdc:mga0qj67_196251_c1
349 nmdc:mga06r32_161918_c1
350 nmdc:mga06r32_279572_c1
351 nmdc:mga0n895_131333_c1
352 nmdc:mga0a205_83016_c1
353 Ga0501084_0007089
354 Ga0501084_0018354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08544

GHMP_kinases_C

GHMP kinases C terminal

247

328

0.91

PF00288

GHMP_kinases_N

GHMP kinases N terminal domain

96

183

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hac-assembly1.cif.gz_B crystal structure of the mevalonate kinase from an archaeon methanosarcina mazei 0.829 20 328
2oi2-assembly1.cif.gz_A-2 streptococcus pneumoniae mevalonate kinase in complex with diphosphomevalonate 0.8184 21 327
2oi2-assembly1.cif.gz_A-2 streptococcus pneumoniae mevalonate kinase in complex with diphosphomevalonate 0.8157 21 327
1s4e-assembly5.cif.gz_E pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium 0.7996 23 328
4hac-assembly1.cif.gz_B crystal structure of the mevalonate kinase from an archaeon methanosarcina mazei 0.7961 20 328
ID Description Score Start End Superfamily
af_Q9HDU2_429_505_3.30.70.3170 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9661 267 315 3.30.70.3170
4hacB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.966 196 323 3.30.70.890
af_Q4CLD0_218_362_3.30.70.890 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.9631 192 327 3.30.70.890
2oi2A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.9505 195 327 3.30.70.890
4hacB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.9438 196 323 3.30.70.890
ID Description Score Start End GO Terms
AF-A0A2W4M636-F1-model_v4 GHMP kinase C-terminal domain-containing protein 0.9879 184 328 GO:0004496
GO:0005524
GO:0005829
GO:0019287
AF-A0A2M8PPQ0-F1-model_v4 Mevalonate kinase 0.9871 175 328 GO:0004496
GO:0005524
GO:0005829
GO:0019287
AF-A0A7V4W831-F1-model_v4 GHMP kinase C-terminal domain-containing protein 0.985 197 323 GO:0004496
GO:0005524
GO:0005829
GO:0019287
AF-A0A2W4M636-F1-model_v4 GHMP kinase C-terminal domain-containing protein 0.9812 184 328 GO:0004496
GO:0005524
GO:0005829
GO:0019287
AF-A0A7C6Y063-F1-model_v4 Mevalonate kinase 0.9808 216 323 GO:0004496
GO:0005524
GO:0005829
GO:0019287

Map