F270659

General Info

Members Datasets Scaffolds Average Seq Length
177 120 354 260

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0005477|Ga0466969_0005477_570_1475
Length 301
Sequence MISELYHGEVPTRRGPEVHDGVVRTGREGNELDTGGLPQYGQQYGAQPSDQAPALQMSGLRKAFGTTVAVDDVQLAVPRGSFFGLVGPNGAGKTTSLSMAVGLLRPDAGAVRIFGVDVWESPERAKALVGVLPDGMALPERLTGRELLTYTGLLRGLDAATVAARADELLGVLELTDAERTLVIDYSAGMRKKIGLATALLHAPKLLVLDEPFEAVDPVSASTIRTILQRFVASGGAVVLSSHVMDLVEKLCDHVAVITRGRVVASGPVAEVRGDQTLEQAFVHLVGGRTGGGEGLSWLAS

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
37 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
38 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
39 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
40 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
41 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
42 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
43 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
46 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
47 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
48 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
49 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
50 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
51 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
55 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
56 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
57 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
58 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
62 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
63 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
64 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
65 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
66 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
67 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
68 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
69 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
70 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
71 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
72 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
73 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
74 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
75 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
76 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
77 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
78 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
79 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
80 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
81 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
82 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
83 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
84 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
85 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
86 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
92 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
93 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
94 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
95 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
96 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
97 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
98 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
99 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
100 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
101 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
102 2558860280 Kutzneria sp. 744 Isolate Unclassified
103 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
104 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
105 2643221711 Terrabacter sp. Root85 Isolate Unclassified
106 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
107 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
108 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
109 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
110 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
111 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
112 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
113 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
114 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
115 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
116 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
117 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
118 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
119 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
120 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.7
Metatranscriptomes 0
Isolates 11.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.39
Nodule 0
Rhizoplane 19.77
Rhizosphere 63.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0005477 3300044656 Bacteria 6753
2 JGI25151J46595_10004533 3300003187 Bacteria 7331
3 rootH1_10043724 3300003323 Bacteria 1419
4 JGI25407J50210_10003607 3300003373 Bacteria 3720
5 JGI25404J52841_10030669 3300003659 Bacteria 1150
6 Ga0055538_1000252 3300003751 Bacteria 28500
7 Ga0068868_100247282 3300005338 Bacteria 1500
8 Ga0070668_100351864 3300005347 Bacteria 1247
9 Ga0068853_100038864 3300005539 Bacteria 4055
10 Ga0068857_100631789 3300005577 Bacteria 1014
11 Ga0068852_100050304 3300005616 Bacteria 3570
12 Ga0068859_100000525 3300005617 Bacteria 38102
13 Ga0068863_100184398 3300005841 Bacteria 2004
14 Ga0081455_10277136 3300005937 Bacteria 1213
15 Ga0081538_10001132 3300005981 Bacteria 28177
16 Ga0081538_10002628 3300005981 Bacteria 17363
17 Ga0081538_10002699 3300005981 Bacteria 17069
18 Ga0081538_10004519 3300005981 Bacteria 12811
19 Ga0081538_10007575 3300005981 Bacteria 9365
20 Ga0081538_10008970 3300005981 Bacteria 8403
21 Ga0081538_10013826 3300005981 Bacteria 6367
22 Ga0081538_10019095 3300005981 Bacteria 5114
23 Ga0081538_10050117 3300005981 Bacteria 2525
24 Ga0081538_10053330 3300005981 Bacteria 2404
25 Ga0081540_1002497 3300005983 Bacteria 14976
26 Ga0081540_1017507 3300005983 Bacteria 4433
27 Ga0081539_10000692 3300005985 Bacteria 67584
28 Ga0081539_10108811 3300005985 Bacteria 1399
29 Ga0075432_10010149 3300006058 Bacteria 3195
30 Ga0075433_10015265 3300006852 Bacteria 6296
31 Ga0075434_100003877 3300006871 Bacteria 13386
32 Ga0075434_100005125 3300006871 Bacteria 11898
33 Ga0075429_100574410 3300006880 Bacteria 988
34 Ga0097620_100000525 3300006931 Bacteria 38102
35 Ga0111539_10058271 3300009094 Bacteria 4583
36 Ga0111539_10372674 3300009094 Bacteria 1662
37 Ga0114129_10013670 3300009147 Bacteria 11566
38 Ga0114129_10328488 3300009147 Bacteria 2031
39 Ga0105243_10509488 3300009148 Bacteria 1142
40 Ga0157372_10056629 3300013307 Bacteria 4380
41 Ga0209784_100121 3300025224 Bacteria 82273
42 Ga0209676_1006714 3300025292 Bacteria 5603
43 Ga0209025_1001873 3300025294 Bacteria 24642
44 Ga0209025_1002713 3300025294 Bacteria 17990
45 Ga0207647_10011773 3300025904 Bacteria 6118
46 Ga0207668_10032769 3300025972 Bacteria 3438
47 Ga0207668_10186653 3300025972 Bacteria 1640
48 Ga0207703_10571149 3300026035 Bacteria 1068
49 Ga0207639_10069516 3300026041 Bacteria 2747
50 Ga0207641_10237456 3300026088 Bacteria 1697
51 Ga0207674_10096471 3300026116 Bacteria 2942
52 Ga0207428_10001915 3300027907 Bacteria 21073
53 Ga0207428_10061553 3300027907 Bacteria 2971
54 Ga0307515_10088788 3300028794 Bacteria 3902
55 Ga0237817_10204 3300030083 Bacteria 15804
56 Ga0307511_10000635 3300030521 Bacteria 37608
57 Ga0307511_10083129 3300030521 Bacteria 2233
58 Ga0307512_10003946 3300030522 Bacteria 16596
59 Ga0307513_10008723 3300031456 Bacteria 12912
60 Ga0307513_10056720 3300031456 Bacteria 4179
61 Ga0307513_10107945 3300031456 Bacteria 2786
62 Ga0307513_10197869 3300031456 Bacteria 1854
63 Ga0316576_10083806 3300031727 Bacteria 2369
64 Ga0307405_10043220 3300031731 Bacteria 2748
65 Ga0307410_10020285 3300031852 Bacteria 4062
66 Ga0307415_100033315 3300032126 Bacteria 3344
67 Ga0316574_0127909 3300035398 Bacteria 1634
68 Ga0316574_0250254 3300035398 Bacteria 1132
69 Ga0373947_0039021 3300035725 Bacteria 2824
70 Ga0373925_0116264 3300037068 Bacteria 2071
71 Ga0373925_0273445 3300037068 Bacteria 1359
72 Ga0395899_0208369 3300037312 Bacteria 1360
73 Ga0395900_0032014 3300037418 Bacteria 5406
74 Ga0395898_0032068 3300037466 Bacteria 5244
75 Ga0395898_0037315 3300037466 Bacteria 4822
76 Ga0395898_0331917 3300037466 Bacteria 1450
77 Ga0395905_0026991 3300037471 Bacteria 5415
78 Ga0395905_0185454 3300037471 Bacteria 1953
79 Ga0395901_0003061 3300038443 Bacteria 16849
80 Ga0395901_0013259 3300038443 Bacteria 8370
81 Ga0395901_0377705 3300038443 Bacteria 1459
82 Ga0237819_00042 3300038705 Bacteria 43990
83 Ga0439458_0022265 3300042157 Bacteria 1471
84 Ga0439435_0091429 3300042436 Bacteria 925
85 Ga0466969_0011169 3300044656 Bacteria 4755
86 Ga0466966_0101307 3300044684 Bacteria 1781
87 Ga0466961_0015794 3300044693 Bacteria 4844
88 Ga0466961_0048692 3300044693 Bacteria 2709
89 Ga0466970_0003353 3300044765 Bacteria 7790
90 Ga0466970_0225896 3300044765 Bacteria 1045
91 Ga0466967_0008191 3300045976 Bacteria 7633
92 Ga0495629_0243615 3300046459 Bacteria 1238
93 Ga0495641_0020230 3300046461 Bacteria 3381
94 Ga0495582_0102876 3300046473 Bacteria 1600
95 Ga0495594_0053250 3300046499 Bacteria 2229
96 Ga0495606_0000332 3300046507 Bacteria 81774
97 Ga0495668_0000721 3300046616 Bacteria 39752
98 Ga0495625_0001207 3300046660 Bacteria 32820
99 Ga0495672_0171887 3300047320 Bacteria 1105
100 Ga0495676_0220517 3300047321 Bacteria 1307
101 Ga0495683_0052908 3300047323 Bacteria 2026
102 Ga0495626_0000385 3300048091 Bacteria 45738
103 Ga0496100_0002692 3300048903 Bacteria 9068
104 Ga0496100_0084290 3300048903 Bacteria 2154
105 Ga0496101_0001555 3300048904 Bacteria 13768
106 Ga0496101_0037151 3300048904 Bacteria 3453
107 Ga0496102_0000908 3300048905 Bacteria 28014
108 Ga0496102_0004214 3300048905 Bacteria 12159
109 Ga0496102_0351256 3300048905 Bacteria 1388
110 Ga0496102_0502130 3300048905 Bacteria 1135
111 Ga0496103_0007658 3300048906 Bacteria 6424
112 Ga0496103_0085295 3300048906 Bacteria 1990
113 Ga0496103_0096860 3300048906 Bacteria 1865
114 Ga0496104_0000587 3300048907 Bacteria 31065
115 Ga0496104_0019307 3300048907 Bacteria 6234
116 Ga0496104_0262348 3300048907 Bacteria 1640
117 Ga0496105_0005166 3300048908 Bacteria 9895
118 Ga0496105_0005672 3300048908 Bacteria 9500
119 Ga0496105_0031819 3300048908 Bacteria 4327
120 Ga0496105_0223053 3300048908 Bacteria 1534
121 Ga0496106_0066314 3300048909 Bacteria 2749
122 Ga0496106_0393010 3300048909 Bacteria 1114
123 Ga0496106_0711519 3300048909 Bacteria 800
124 Ga0496107_0044094 3300048910 Bacteria 3206
125 Ga0496107_0157194 3300048910 Bacteria 1684
126 Ga0496107_0397291 3300048910 Bacteria 1025
127 Ga0496108_0067822 3300048911 Bacteria 3009
128 Ga0496108_0591444 3300048911 Bacteria 967
129 Ga0496109_0156915 3300048912 Bacteria 2131
130 Ga0496109_0208786 3300048912 Bacteria 1836
131 Ga0496110_0036674 3300048913 Bacteria 4259
132 Ga0496112_0140561 3300048915 Bacteria 2384
133 Ga0496112_0675802 3300048915 Bacteria 961
134 Ga0496113_0190634 3300048916 Bacteria 1627
135 Ga0496114_0003531 3300048917 Bacteria 11995
136 Ga0496114_0010437 3300048917 Bacteria 7390
137 Ga0496114_0042619 3300048917 Bacteria 3762
138 Ga0496119_0108043 3300048922 Bacteria 1550
139 Ga0501031_0034169 3300049568 Bacteria 3319
140 Ga0501034_0054383 3300049571 Bacteria 4030
141 Ga0501036_0919931 3300049572 Bacteria 717
142 Ga0501040_0128785 3300049576 Bacteria 1779
143 Ga0501071_0074291 3300049587 Bacteria 2481
144 Ga0501045_0209196 3300049824 Bacteria 1453
145 nmdc:mga05p37_175622_c1 3300050507 Bacteria 2610
146 nmdc:mga05p37_234823_c1 3300050507 Bacteria 2208
147 nmdc:mga05p37_415048_c1 3300050507 Bacteria 1568
148 nmdc:mga05p37_77643_c1 3300050507 Bacteria 4088
149 nmdc:mga09592_10955_c1 3300050508 Bacteria 7376
150 nmdc:mga06r32_86943_c1 3300050510 Bacteria 3050
151 nmdc:mga08y16_201578_c1 3300050511 Bacteria 2062
152 nmdc:mga08y16_7125_c1 3300050511 Bacteria 11735
153 nmdc:mga0n895_27023_c1 3300050512 Bacteria 5445
154 nmdc:mga0a205_11529_c1 3300050515 Bacteria 8143
155 nmdc:mga0a205_1177_c2 3300050515 Bacteria 13064
156 Ga0501084_0068762 3300054114 Bacteria 2965
157 Ga0501082_0239807 3300060353 Bacteria 1578
158 2552106282 2551306166 Bacteria 9731570
159 2559425942 2558860280 Bacteria 11429938
160 2643853181 2643221567 Bacteria 4163945
161 2644137164 2643221624 Bacteria 4384879
162 2644609370 2643221711 Bacteria 4865335
163 2698322777 2695420987 Bacteria 6152737
164 2791912936 2791354901 Bacteria 8322202
165 2809591098 2808606522 Bacteria 9488490
166 2812374590 2811994882 Bacteria 4688362
167 2816422347 2816332119 Bacteria 8120218
168 2819666204 2818991458 Bacteria 4794049
169 2819693046 2818991462 Bacteria 4320267
170 2819730320 2818991469 Bacteria 4644110
171 2863407913 2863404153 Bacteria 9672205
172 2891331244 2891326441 Bacteria 6439512
173 2891400769 2891395885 Bacteria 9251614
174 2915772753 2915768154 Bacteria 8424322
175 2917738758 2917736166 Bacteria 9690793
176 2947429235 2947426588 Bacteria 5357194
177 8001782961 8001781756 Bacteria 9586736
178 Ga0466969_0005477
179 JGI25151J46595_10004533
180 rootH1_10043724
181 JGI25407J50210_10003607
182 JGI25404J52841_10030669
183 Ga0055538_1000252
184 Ga0068868_100247282
185 Ga0070668_100351864
186 Ga0068853_100038864
187 Ga0068857_100631789
188 Ga0068852_100050304
189 Ga0068859_100000525
190 Ga0068863_100184398
191 Ga0081455_10277136
192 Ga0081538_10001132
193 Ga0081538_10002628
194 Ga0081538_10002699
195 Ga0081538_10004519
196 Ga0081538_10007575
197 Ga0081538_10008970
198 Ga0081538_10013826
199 Ga0081538_10019095
200 Ga0081538_10050117
201 Ga0081538_10053330
202 Ga0081540_1002497
203 Ga0081540_1017507
204 Ga0081539_10000692
205 Ga0081539_10108811
206 Ga0075432_10010149
207 Ga0075433_10015265
208 Ga0075434_100003877
209 Ga0075434_100005125
210 Ga0075429_100574410
211 Ga0097620_100000525
212 Ga0111539_10058271
213 Ga0111539_10372674
214 Ga0114129_10013670
215 Ga0114129_10328488
216 Ga0105243_10509488
217 Ga0157372_10056629
218 Ga0209784_100121
219 Ga0209676_1006714
220 Ga0209025_1001873
221 Ga0209025_1002713
222 Ga0207647_10011773
223 Ga0207668_10032769
224 Ga0207668_10186653
225 Ga0207703_10571149
226 Ga0207639_10069516
227 Ga0207641_10237456
228 Ga0207674_10096471
229 Ga0207428_10001915
230 Ga0207428_10061553
231 Ga0307515_10088788
232 Ga0237817_10204
233 Ga0307511_10000635
234 Ga0307511_10083129
235 Ga0307512_10003946
236 Ga0307513_10008723
237 Ga0307513_10056720
238 Ga0307513_10107945
239 Ga0307513_10197869
240 Ga0316576_10083806
241 Ga0307405_10043220
242 Ga0307410_10020285
243 Ga0307415_100033315
244 Ga0316574_0127909
245 Ga0316574_0250254
246 Ga0373947_0039021
247 Ga0373925_0116264
248 Ga0373925_0273445
249 Ga0395899_0208369
250 Ga0395900_0032014
251 Ga0395898_0032068
252 Ga0395898_0037315
253 Ga0395898_0331917
254 Ga0395905_0026991
255 Ga0395905_0185454
256 Ga0395901_0003061
257 Ga0395901_0013259
258 Ga0395901_0377705
259 Ga0237819_00042
260 Ga0439458_0022265
261 Ga0439435_0091429
262 Ga0466969_0011169
263 Ga0466966_0101307
264 Ga0466961_0015794
265 Ga0466961_0048692
266 Ga0466970_0003353
267 Ga0466970_0225896
268 Ga0466967_0008191
269 Ga0495629_0243615
270 Ga0495641_0020230
271 Ga0495582_0102876
272 Ga0495594_0053250
273 Ga0495606_0000332
274 Ga0495668_0000721
275 Ga0495625_0001207
276 Ga0495672_0171887
277 Ga0495676_0220517
278 Ga0495683_0052908
279 Ga0495626_0000385
280 Ga0496100_0002692
281 Ga0496100_0084290
282 Ga0496101_0001555
283 Ga0496101_0037151
284 Ga0496102_0000908
285 Ga0496102_0004214
286 Ga0496102_0351256
287 Ga0496102_0502130
288 Ga0496103_0007658
289 Ga0496103_0085295
290 Ga0496103_0096860
291 Ga0496104_0000587
292 Ga0496104_0019307
293 Ga0496104_0262348
294 Ga0496105_0005166
295 Ga0496105_0005672
296 Ga0496105_0031819
297 Ga0496105_0223053
298 Ga0496106_0066314
299 Ga0496106_0393010
300 Ga0496106_0711519
301 Ga0496107_0044094
302 Ga0496107_0157194
303 Ga0496107_0397291
304 Ga0496108_0067822
305 Ga0496108_0591444
306 Ga0496109_0156915
307 Ga0496109_0208786
308 Ga0496110_0036674
309 Ga0496112_0140561
310 Ga0496112_0675802
311 Ga0496113_0190634
312 Ga0496114_0003531
313 Ga0496114_0010437
314 Ga0496114_0042619
315 Ga0496119_0108043
316 Ga0501031_0034169
317 Ga0501034_0054383
318 Ga0501036_0919931
319 Ga0501040_0128785
320 Ga0501071_0074291
321 Ga0501045_0209196
322 nmdc:mga05p37_175622_c1
323 nmdc:mga05p37_234823_c1
324 nmdc:mga05p37_415048_c1
325 nmdc:mga05p37_77643_c1
326 nmdc:mga09592_10955_c1
327 nmdc:mga06r32_86943_c1
328 nmdc:mga08y16_201578_c1
329 nmdc:mga08y16_7125_c1
330 nmdc:mga0n895_27023_c1
331 nmdc:mga0a205_11529_c1
332 nmdc:mga0a205_1177_c2
333 Ga0501084_0068762
334 Ga0501082_0239807
335 2552106282
336 2559425942
337 2643853181
338 2644137164
339 2644609370
340 2698322777
341 2791912936
342 2809591098
343 2812374590
344 2816422347
345 2819666204
346 2819693046
347 2819730320
348 2863407913
349 2891331244
350 2891400769
351 2915772753
352 2917738758
353 2947429235
354 8001782961

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

70

214

0.97

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

152

249

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tbw-assembly1.cif.gz_A the structure of atp-bound abca1 0.9435 16 240
8ee6-assembly1.cif.gz_A cryo-em structure of human abca7 in pe/ch nanodiscs 0.9353 18 240
5lil-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) 0.9349 17 234
8f5b-assembly1.cif.gz_A human abca4 structure in complex with amp-pnp 0.9325 17 236
7o17-assembly1.cif.gz_B abc transporter nosdfy e154q, atp-bound in lipid nanodisc 0.9312 19 240
ID Description Score Start End Superfamily
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9656 13 228 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9586 18 238 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.957 17 238 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9502 17 240 3.40.50.300
af_Q2FXB7_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9403 17 251 3.40.50.300
ID Description Score Start End GO Terms
AF-K1YG27-F1-model_v4 ABC transporter domain-containing protein 0.9686 18 238 GO:0005524
GO:0016887
AF-A0A7W7BQI4-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9677 17 264 GO:0005524
GO:0016887
GO:0046677
AF-A0A1G0AQV2-F1-model_v4 ABC transporter ATP-binding protein 0.9626 17 252 GO:0005524
GO:0016887
AF-A0A7V1AN41-F1-model_v4 ABC transporter ATP-binding protein 0.9619 20 251 GO:0005524
GO:0016887
AF-A0A265N7C0-F1-model_v4 ABC transporter 0.9611 20 251 GO:0005524
GO:0016887

Map