F270442

General Info

Members Datasets Scaffolds Average Seq Length
177 138 354 414

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10011796|Ga0307513_100117967
Length 466
Sequence MPCGEAGAKCRRVRLLPGGFHLSLRRAACGRRTLAFGGRTMGFLRHLRVLYVQVLIGVAWPAFGASLKPLGDAFIKLIKLAIAPVIFCTVAGGIARMGDLKAFGRLGARTLIYFEVVSTLALVVGLIVGKVVHPGAGFNIDVATLDPKVGAEYLAKAEHSESVVAYLLNLIPDTFVGAFAGGQLLQVLVVAVLAGFACTRMGSFGDQVAGVLDDIAKLFFGIIGVVVRLAPIGAFGAMAFTIGKYGVDSLVQLGALIGTFYLTSVLFILIVLGAIARLAGFSILKFIAYIREELLIVLGTSSSESVLPQMMAKMQRLGAGKGTVGLVIPTGYSFNLDGTNIYMTLATLFLAQATNTPLSLTQELTLLGVAMLTSKGASGVTGAGFITLAATLAVIPDLPIAALALLVGIDRFMSECRALTNLVGNGVATVVMARWEGDLDRETLKRELDRGPLAVGDPLLAGAEAD

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
60 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
67 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
68 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
81 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
82 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
85 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
86 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
87 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
90 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
91 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
92 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
97 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
98 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
99 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
100 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
101 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
102 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
103 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
112 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
118 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
119 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
120 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
121 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
122 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
123 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
124 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
125 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
126 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
127 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
128 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
129 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
130 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
131 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
132 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
133 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
134 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
135 2904699407
136 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
137 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
138 2922368715

Type Distribution

Type Percentage (%)
Metagenomes 93.14
Metatranscriptomes 0
Isolates 6.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.08
Nodule 6.21
Rhizoplane 2.82
Rhizosphere 73.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10011796 3300031456 Bacteria 10833
2 JGI25406J46586_10000556 3300003203 Bacteria 17608
3 Ga0070658_10067662 3300005327 Bacteria 2918
4 Ga0070658_10200342 3300005327 Bacteria 1684
5 Ga0070680_100006282 3300005336 Bacteria 9018
6 Ga0070668_100000480 3300005347 Bacteria 26516
7 Ga0070673_100098353 3300005364 Bacteria 2405
8 Ga0070659_100000143 3300005366 Bacteria 55183
9 Ga0070667_100001176 3300005367 Bacteria 23798
10 Ga0070710_10017449 3300005437 Bacteria 3674
11 Ga0070711_100026730 3300005439 Bacteria 3784
12 Ga0070694_100011072 3300005444 Bacteria 5583
13 Ga0070678_100093680 3300005456 Bacteria 2310
14 Ga0070681_10016591 3300005458 Bacteria 7354
15 Ga0070706_100002303 3300005467 Bacteria 19295
16 Ga0068853_100025597 3300005539 Bacteria 4953
17 Ga0068853_100041618 3300005539 Bacteria 3926
18 Ga0070686_100001944 3300005544 Bacteria 11473
19 Ga0070665_100000144 3300005548 Bacteria 132302
20 Ga0070665_100000304 3300005548 Bacteria 76931
21 Ga0070704_100030137 3300005549 Bacteria 3632
22 Ga0068864_100000096 3300005618 Bacteria 88306
23 Ga0068863_100000041 3300005841 Bacteria 157478
24 Ga0068858_100000494 3300005842 Bacteria 41195
25 Ga0068860_100000115 3300005843 Bacteria 128506
26 Ga0068860_100000351 3300005843 Bacteria 61888
27 Ga0068862_100008437 3300005844 Bacteria 8523
28 Ga0068862_100056266 3300005844 Bacteria 3370
29 Ga0075428_100000129 3300006844 Bacteria 65954
30 Ga0075431_100000235 3300006847 Bacteria 41569
31 Ga0075429_100000514 3300006880 Bacteria 29300
32 Ga0068865_100007398 3300006881 Bacteria 6758
33 Ga0105250_10038396 3300009092 Bacteria 1920
34 Ga0105240_10037238 3300009093 Bacteria 6252
35 Ga0111539_10049200 3300009094 Bacteria 5029
36 Ga0114129_10092668 3300009147 Bacteria 4186
37 Ga0105248_10001990 3300009177 Bacteria 22723
38 Ga0105248_10070579 3300009177 Bacteria 3923
39 Ga0105237_10054861 3300009545 Bacteria 3992
40 Ga0105238_10019578 3300009551 Bacteria 6892
41 Ga0105238_10155890 3300009551 Bacteria 2259
42 Ga0105238_10312057 3300009551 Bacteria 1558
43 Ga0105239_10119126 3300010375 Bacteria 2930
44 Ga0157369_10002561 3300013105 Bacteria 21760
45 Ga0163162_10408312 3300013306 Bacteria 1491
46 Ga0157372_10326121 3300013307 Bacteria 1788
47 Ga0207705_10042571 3300025909 Bacteria 3260
48 Ga0207707_10096583 3300025912 Bacteria 2582
49 Ga0207707_10164465 3300025912 Bacteria 1939
50 Ga0207695_10266093 3300025913 Bacteria 1611
51 Ga0207660_10019584 3300025917 Bacteria 4525
52 Ga0207657_10003177 3300025919 Bacteria 17574
53 Ga0207657_10064365 3300025919 Bacteria 3130
54 Ga0207694_10071333 3300025924 Bacteria 2714
55 Ga0207694_10073208 3300025924 Bacteria 2680
56 Ga0207690_10000283 3300025932 Bacteria 36051
57 Ga0207704_10000916 3300025938 Bacteria 13028
58 Ga0207711_10005497 3300025941 Bacteria 10712
59 Ga0207711_10059642 3300025941 Bacteria 3286
60 Ga0207668_10000005 3300025972 Bacteria 193572
61 Ga0207677_10110252 3300026023 Bacteria 2048
62 Ga0207703_10000035 3300026035 Bacteria 183082
63 Ga0207639_10079828 3300026041 Bacteria 2587
64 Ga0207639_10265836 3300026041 Bacteria 1502
65 Ga0207641_10000027 3300026088 Bacteria 244787
66 Ga0207641_10050562 3300026088 Bacteria 3517
67 Ga0207676_10000093 3300026095 Bacteria 80702
68 Ga0207698_10086786 3300026142 Bacteria 2546
69 Ga0207428_10032246 3300027907 Bacteria 4311
70 Ga0268266_10000003 3300028379 Bacteria 1701703
71 Ga0268266_10002143 3300028379 Bacteria 21700
72 Ga0268265_10017505 3300028380 Bacteria 4947
73 Ga0268264_10000002 3300028381 Bacteria 1153045
74 Ga0268264_10001134 3300028381 Bacteria 26118
75 Ga0307517_10000705 3300028786 Bacteria 57524
76 Ga0307517_10037098 3300028786 Bacteria 5456
77 Ga0307517_10053035 3300028786 Bacteria 4048
78 Ga0307515_10000005 3300028794 Bacteria 758563
79 Ga0265325_10051438 3300031241 Bacteria 2118
80 Ga0265340_10009907 3300031247 Bacteria 5107
81 Ga0265327_10004393 3300031251 Bacteria 12511
82 Ga0307513_10000208 3300031456 Bacteria 84906
83 Ga0307513_10000764 3300031456 Bacteria 46492
84 Ga0307513_10011006 3300031456 Bacteria 11285
85 Ga0265313_10004108 3300031595 Bacteria 11334
86 Ga0265314_10009276 3300031711 Bacteria 8333
87 Ga0307516_10000115 3300031730 Bacteria 92959
88 Ga0307510_10008320 3300033180 Bacteria 12363
89 Ga0315911_1000018 3300033442 Bacteria 152089
90 Ga0373935_0030904 3300035692 Bacteria 3320
91 Ga0373927_0003701 3300035695 Bacteria 10877
92 Ga0373937_0206416 3300036401 Bacteria 1848
93 Ga0373925_0000111 3300037068 Bacteria 87426
94 Ga0395899_0000666 3300037312 Bacteria 34912
95 Ga0395899_0077001 3300037312 Bacteria 2434
96 Ga0395900_0000016 3300037418 Bacteria 382407
97 Ga0395900_0008966 3300037418 Bacteria 10258
98 Ga0395900_0035082 3300037418 Bacteria 5167
99 Ga0395898_0006594 3300037466 Bacteria 12379
100 Ga0395898_0012978 3300037466 Bacteria 8591
101 Ga0395898_0014241 3300037466 Bacteria 8174
102 Ga0395905_0003448 3300037471 Bacteria 16921
103 Ga0395905_0283349 3300037471 Bacteria 1543
104 Ga0436364_0805816 3300037853 Bacteria 2248
105 Ga0436364_0826431 3300037853 Bacteria 1731
106 Ga0395901_0000022 3300038443 Bacteria 296356
107 Ga0436365_1611931 3300039437 Bacteria 8474
108 Ga0436360_0563505 3300039438 Bacteria 5680
109 Ga0436361_0251140 3300039447 Bacteria 1528
110 Ga0436361_0626520 3300039447 Bacteria 2124
111 Ga0439455_0011265 3300042012 Bacteria 1982
112 Ga0495638_0058283 3300046460 Bacteria 2394
113 Ga0495584_0026468 3300046491 Bacteria 2938
114 Ga0495607_0008631 3300046501 Bacteria 6949
115 Ga0495583_0006736 3300046506 Bacteria 7433
116 Ga0495616_0008459 3300046513 Bacteria 6096
117 Ga0495643_0024193 3300046522 Bacteria 3447
118 Ga0495642_0015992 3300046528 Bacteria 2921
119 Ga0495609_0000681 3300046538 Bacteria 26243
120 Ga0495597_0000444 3300046542 Bacteria 35383
121 Ga0495622_0022123 3300046557 Bacteria 2962
122 Ga0495668_0020107 3300046616 Bacteria 3841
123 Ga0495668_0036427 3300046616 Bacteria 2756
124 Ga0495668_0085688 3300046616 Bacteria 1728
125 Ga0495611_0035663 3300046648 Bacteria 2204
126 Ga0495625_0004518 3300046660 Bacteria 13122
127 Ga0495625_0150606 3300046660 Bacteria 1564
128 Ga0495659_0005499 3300046664 Bacteria 3986
129 Ga0495669_0000005 3300046684 Bacteria 193971
130 Ga0495669_0001354 3300046684 Bacteria 10140
131 Ga0495649_0024386 3300046694 Bacteria 3373
132 Ga0495636_0022654 3300047318 Bacteria 2540
133 Ga0495672_0007777 3300047320 Bacteria 8015
134 Ga0495672_0031507 3300047320 Bacteria 3310
135 Ga0495672_0054945 3300047320 Bacteria 2325
136 Ga0495687_049752 3300047443 Bacteria 1789
137 Ga0495677_0008533 3300047445 Bacteria 3804
138 Ga0495681_0006226 3300047470 Bacteria 7867
139 Ga0496102_0157088 3300048905 Bacteria 2138
140 Ga0496109_0040643 3300048912 Bacteria 4212
141 Ga0496112_0024712 3300048915 Bacteria 5760
142 Ga0496115_0010691 3300048918 Bacteria 6865
143 Ga0496115_0029921 3300048918 Bacteria 4281
144 Ga0496117_0031684 3300048920 Bacteria 4032
145 Ga0496118_0006605 3300048921 Bacteria 12667
146 Ga0496121_0000053 3300048924 Bacteria 312611
147 Ga0496121_0145500 3300048924 Bacteria 1752
148 Ga0496126_0012483 3300048929 Bacteria 8699
149 Ga0496126_0052454 3300048929 Bacteria 3706
150 Ga0501257_001134 3300049686 Bacteria 5431
151 nmdc:mga05p37_73014_c1 3300050507 Bacteria 4222
152 nmdc:mga09592_4679_c1 3300050508 Bacteria 11075
153 nmdc:mga06r32_16982_c1 3300050510 Bacteria 6641
154 nmdc:mga08y16_407_c1 3300050511 Bacteria 39530
155 Ga0500643_005606 3300053087 Bacteria 5380
156 Ga0500566_0034388 3300053094 Bacteria 2949
157 Ga0500641_0005817 3300053096 Bacteria 4365
158 Ga0500556_0042568 3300053104 Bacteria 1607
159 Ga0500562_004399 3300053108 Bacteria 3564
160 Ga0500595_009319 3300053119 Bacteria 3966
161 Ga0500608_001089 3300053122 Bacteria 9690
162 Ga0500559_0006406 3300053136 Bacteria 5318
163 Ga0500603_006211 3300053150 Bacteria 2591
164 2509147038 2508501128 Bacteria 8613869
165 2513860259 2513237137 Bacteria 9558895
166 2513887578 2513237141 Bacteria 8496279
167 2524536520 2524023228 Bacteria 10118060
168 2793073276 2791355197 Bacteria 8420563
169 2885376024 2885374607 Bacteria 8927485
170 2894772631 2894772417 Bacteria 5305674
171 2903751593 2903748898 Bacteria 9972761
172 2904692482 2904690495 Bacteria 9412302
173 2904709058
174 2908747805 2908739725 Bacteria 8628932
175 2908757218 2908756301 Bacteria 8864324
176 2908762636 2908756301 Bacteria 8864324
177 2922370955
178 Ga0307513_10011796
179 JGI25406J46586_10000556
180 Ga0070658_10067662
181 Ga0070658_10200342
182 Ga0070680_100006282
183 Ga0070668_100000480
184 Ga0070673_100098353
185 Ga0070659_100000143
186 Ga0070667_100001176
187 Ga0070710_10017449
188 Ga0070711_100026730
189 Ga0070694_100011072
190 Ga0070678_100093680
191 Ga0070681_10016591
192 Ga0070706_100002303
193 Ga0068853_100025597
194 Ga0068853_100041618
195 Ga0070686_100001944
196 Ga0070665_100000144
197 Ga0070665_100000304
198 Ga0070704_100030137
199 Ga0068864_100000096
200 Ga0068863_100000041
201 Ga0068858_100000494
202 Ga0068860_100000115
203 Ga0068860_100000351
204 Ga0068862_100008437
205 Ga0068862_100056266
206 Ga0075428_100000129
207 Ga0075431_100000235
208 Ga0075429_100000514
209 Ga0068865_100007398
210 Ga0105250_10038396
211 Ga0105240_10037238
212 Ga0111539_10049200
213 Ga0114129_10092668
214 Ga0105248_10001990
215 Ga0105248_10070579
216 Ga0105237_10054861
217 Ga0105238_10019578
218 Ga0105238_10155890
219 Ga0105238_10312057
220 Ga0105239_10119126
221 Ga0157369_10002561
222 Ga0163162_10408312
223 Ga0157372_10326121
224 Ga0207705_10042571
225 Ga0207707_10096583
226 Ga0207707_10164465
227 Ga0207695_10266093
228 Ga0207660_10019584
229 Ga0207657_10003177
230 Ga0207657_10064365
231 Ga0207694_10071333
232 Ga0207694_10073208
233 Ga0207690_10000283
234 Ga0207704_10000916
235 Ga0207711_10005497
236 Ga0207711_10059642
237 Ga0207668_10000005
238 Ga0207677_10110252
239 Ga0207703_10000035
240 Ga0207639_10079828
241 Ga0207639_10265836
242 Ga0207641_10000027
243 Ga0207641_10050562
244 Ga0207676_10000093
245 Ga0207698_10086786
246 Ga0207428_10032246
247 Ga0268266_10000003
248 Ga0268266_10002143
249 Ga0268265_10017505
250 Ga0268264_10000002
251 Ga0268264_10001134
252 Ga0307517_10000705
253 Ga0307517_10037098
254 Ga0307517_10053035
255 Ga0307515_10000005
256 Ga0265325_10051438
257 Ga0265340_10009907
258 Ga0265327_10004393
259 Ga0307513_10000208
260 Ga0307513_10000764
261 Ga0307513_10011006
262 Ga0265313_10004108
263 Ga0265314_10009276
264 Ga0307516_10000115
265 Ga0307510_10008320
266 Ga0315911_1000018
267 Ga0373935_0030904
268 Ga0373927_0003701
269 Ga0373937_0206416
270 Ga0373925_0000111
271 Ga0395899_0000666
272 Ga0395899_0077001
273 Ga0395900_0000016
274 Ga0395900_0008966
275 Ga0395900_0035082
276 Ga0395898_0006594
277 Ga0395898_0012978
278 Ga0395898_0014241
279 Ga0395905_0003448
280 Ga0395905_0283349
281 Ga0436364_0805816
282 Ga0436364_0826431
283 Ga0395901_0000022
284 Ga0436365_1611931
285 Ga0436360_0563505
286 Ga0436361_0251140
287 Ga0436361_0626520
288 Ga0439455_0011265
289 Ga0495638_0058283
290 Ga0495584_0026468
291 Ga0495607_0008631
292 Ga0495583_0006736
293 Ga0495616_0008459
294 Ga0495643_0024193
295 Ga0495642_0015992
296 Ga0495609_0000681
297 Ga0495597_0000444
298 Ga0495622_0022123
299 Ga0495668_0020107
300 Ga0495668_0036427
301 Ga0495668_0085688
302 Ga0495611_0035663
303 Ga0495625_0004518
304 Ga0495625_0150606
305 Ga0495659_0005499
306 Ga0495669_0000005
307 Ga0495669_0001354
308 Ga0495649_0024386
309 Ga0495636_0022654
310 Ga0495672_0007777
311 Ga0495672_0031507
312 Ga0495672_0054945
313 Ga0495687_049752
314 Ga0495677_0008533
315 Ga0495681_0006226
316 Ga0496102_0157088
317 Ga0496109_0040643
318 Ga0496112_0024712
319 Ga0496115_0010691
320 Ga0496115_0029921
321 Ga0496117_0031684
322 Ga0496118_0006605
323 Ga0496121_0000053
324 Ga0496121_0145500
325 Ga0496126_0012483
326 Ga0496126_0052454
327 Ga0501257_001134
328 nmdc:mga05p37_73014_c1
329 nmdc:mga09592_4679_c1
330 nmdc:mga06r32_16982_c1
331 nmdc:mga08y16_407_c1
332 Ga0500643_005606
333 Ga0500566_0034388
334 Ga0500641_0005817
335 Ga0500556_0042568
336 Ga0500562_004399
337 Ga0500595_009319
338 Ga0500608_001089
339 Ga0500559_0006406
340 Ga0500603_006211
341 2509147038
342 2513860259
343 2513887578
344 2524536520
345 2793073276
346 2885376024
347 2894772631
348 2903751593
349 2904692482
350 2904709058
351 2908747805
352 2908757218
353 2908762636
354 2922370955

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00375

SDF

Sodium:dicarboxylate symporter family

44

435

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nwl-assembly1.cif.gz_C crystal structure of gltph in complex with l-asp 0.853 15 412
6uwf-assembly1.cif.gz_A gltph in complex with l-aspartate and sodium ions in outward-facing state 0.8525 14 412
2nwx-assembly1.cif.gz_C crystal structure of gltph in complex with l-aspartate and sodium ions 0.8522 18 412
1xfh-assembly1.cif.gz_A structure of glutamate transporter homolog from pyrococcus horikoshii 0.8514 19 411
6uwl-assembly1.cif.gz_A gltph in complex with l-aspartate and sodium ions in intermediate outward-facing state 0.8504 15 412
ID Description Score Start End Superfamily
af_P0A830_1_408_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9435 18 417 1.10.3860.10
af_P21345_1_417_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.925 14 417 1.10.3860.10
af_P0A830_1_408_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9236 18 417 1.10.3860.10
af_P71906_20_424_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9217 21 417 1.10.3860.10
af_P71906_20_424_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9022 21 417 1.10.3860.10
ID Description Score Start End GO Terms
AF-A0A4Y3J673-F1-model_v4 C4-dicarboxylate ABC transporter 0.9694 60 427 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A4Q3W2S4-F1-model_v4 Dicarboxylate/amino acid:cation symporter 0.961 17 426 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A358XU19-F1-model_v4 C4-dicarboxylate transporter DctA 0.961 258 426 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-N8RC33-F1-model_v4 C4-dicarboxylate transporter DctA 0.9593 21 428 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A485H0W4-F1-model_v4 deleted 0.9584 235 427

Map