F270442
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 177 | 138 | 354 | 414 |
Family's Representative Sequence
| Representative Sequence | 3300031456|Ga0307513_10011796|Ga0307513_100117967 |
| Length | 466 |
| Sequence | MPCGEAGAKCRRVRLLPGGFHLSLRRAACGRRTLAFGGRTMGFLRHLRVLYVQVLIGVAWPAFGASLKPLGDAFIKLIKLAIAPVIFCTVAGGIARMGDLKAFGRLGARTLIYFEVVSTLALVVGLIVGKVVHPGAGFNIDVATLDPKVGAEYLAKAEHSESVVAYLLNLIPDTFVGAFAGGQLLQVLVVAVLAGFACTRMGSFGDQVAGVLDDIAKLFFGIIGVVVRLAPIGAFGAMAFTIGKYGVDSLVQLGALIGTFYLTSVLFILIVLGAIARLAGFSILKFIAYIREELLIVLGTSSSESVLPQMMAKMQRLGAGKGTVGLVIPTGYSFNLDGTNIYMTLATLFLAQATNTPLSLTQELTLLGVAMLTSKGASGVTGAGFITLAATLAVIPDLPIAALALLVGIDRFMSECRALTNLVGNGVATVVMARWEGDLDRETLKRELDRGPLAVGDPLLAGAEAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 16 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 20 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 21 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 22 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 23 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 24 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 25 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 26 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 27 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 28 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 56 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 60 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 61 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 62 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 63 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 64 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 65 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 66 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 67 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 68 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 69 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 70 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 71 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 72 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 73 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 74 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 75 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 76 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 77 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 78 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 79 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 80 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 81 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 82 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 83 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 105 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 106 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 107 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 108 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 109 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 110 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 111 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 112 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 113 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 114 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 115 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 116 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 117 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 118 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 119 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 120 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 121 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 122 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 123 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 124 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 125 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 126 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 127 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 128 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 129 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 130 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 131 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 132 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 133 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 134 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 135 | 2904699407 | |||
| 136 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 137 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 138 | 2922368715 |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.14 |
| Metatranscriptomes | 0 |
| Isolates | 6.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.08 |
| Nodule | 6.21 |
| Rhizoplane | 2.82 |
| Rhizosphere | 73.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307513_10011796 | 3300031456 | Bacteria | 10833 |
| 2 | JGI25406J46586_10000556 | 3300003203 | Bacteria | 17608 |
| 3 | Ga0070658_10067662 | 3300005327 | Bacteria | 2918 |
| 4 | Ga0070658_10200342 | 3300005327 | Bacteria | 1684 |
| 5 | Ga0070680_100006282 | 3300005336 | Bacteria | 9018 |
| 6 | Ga0070668_100000480 | 3300005347 | Bacteria | 26516 |
| 7 | Ga0070673_100098353 | 3300005364 | Bacteria | 2405 |
| 8 | Ga0070659_100000143 | 3300005366 | Bacteria | 55183 |
| 9 | Ga0070667_100001176 | 3300005367 | Bacteria | 23798 |
| 10 | Ga0070710_10017449 | 3300005437 | Bacteria | 3674 |
| 11 | Ga0070711_100026730 | 3300005439 | Bacteria | 3784 |
| 12 | Ga0070694_100011072 | 3300005444 | Bacteria | 5583 |
| 13 | Ga0070678_100093680 | 3300005456 | Bacteria | 2310 |
| 14 | Ga0070681_10016591 | 3300005458 | Bacteria | 7354 |
| 15 | Ga0070706_100002303 | 3300005467 | Bacteria | 19295 |
| 16 | Ga0068853_100025597 | 3300005539 | Bacteria | 4953 |
| 17 | Ga0068853_100041618 | 3300005539 | Bacteria | 3926 |
| 18 | Ga0070686_100001944 | 3300005544 | Bacteria | 11473 |
| 19 | Ga0070665_100000144 | 3300005548 | Bacteria | 132302 |
| 20 | Ga0070665_100000304 | 3300005548 | Bacteria | 76931 |
| 21 | Ga0070704_100030137 | 3300005549 | Bacteria | 3632 |
| 22 | Ga0068864_100000096 | 3300005618 | Bacteria | 88306 |
| 23 | Ga0068863_100000041 | 3300005841 | Bacteria | 157478 |
| 24 | Ga0068858_100000494 | 3300005842 | Bacteria | 41195 |
| 25 | Ga0068860_100000115 | 3300005843 | Bacteria | 128506 |
| 26 | Ga0068860_100000351 | 3300005843 | Bacteria | 61888 |
| 27 | Ga0068862_100008437 | 3300005844 | Bacteria | 8523 |
| 28 | Ga0068862_100056266 | 3300005844 | Bacteria | 3370 |
| 29 | Ga0075428_100000129 | 3300006844 | Bacteria | 65954 |
| 30 | Ga0075431_100000235 | 3300006847 | Bacteria | 41569 |
| 31 | Ga0075429_100000514 | 3300006880 | Bacteria | 29300 |
| 32 | Ga0068865_100007398 | 3300006881 | Bacteria | 6758 |
| 33 | Ga0105250_10038396 | 3300009092 | Bacteria | 1920 |
| 34 | Ga0105240_10037238 | 3300009093 | Bacteria | 6252 |
| 35 | Ga0111539_10049200 | 3300009094 | Bacteria | 5029 |
| 36 | Ga0114129_10092668 | 3300009147 | Bacteria | 4186 |
| 37 | Ga0105248_10001990 | 3300009177 | Bacteria | 22723 |
| 38 | Ga0105248_10070579 | 3300009177 | Bacteria | 3923 |
| 39 | Ga0105237_10054861 | 3300009545 | Bacteria | 3992 |
| 40 | Ga0105238_10019578 | 3300009551 | Bacteria | 6892 |
| 41 | Ga0105238_10155890 | 3300009551 | Bacteria | 2259 |
| 42 | Ga0105238_10312057 | 3300009551 | Bacteria | 1558 |
| 43 | Ga0105239_10119126 | 3300010375 | Bacteria | 2930 |
| 44 | Ga0157369_10002561 | 3300013105 | Bacteria | 21760 |
| 45 | Ga0163162_10408312 | 3300013306 | Bacteria | 1491 |
| 46 | Ga0157372_10326121 | 3300013307 | Bacteria | 1788 |
| 47 | Ga0207705_10042571 | 3300025909 | Bacteria | 3260 |
| 48 | Ga0207707_10096583 | 3300025912 | Bacteria | 2582 |
| 49 | Ga0207707_10164465 | 3300025912 | Bacteria | 1939 |
| 50 | Ga0207695_10266093 | 3300025913 | Bacteria | 1611 |
| 51 | Ga0207660_10019584 | 3300025917 | Bacteria | 4525 |
| 52 | Ga0207657_10003177 | 3300025919 | Bacteria | 17574 |
| 53 | Ga0207657_10064365 | 3300025919 | Bacteria | 3130 |
| 54 | Ga0207694_10071333 | 3300025924 | Bacteria | 2714 |
| 55 | Ga0207694_10073208 | 3300025924 | Bacteria | 2680 |
| 56 | Ga0207690_10000283 | 3300025932 | Bacteria | 36051 |
| 57 | Ga0207704_10000916 | 3300025938 | Bacteria | 13028 |
| 58 | Ga0207711_10005497 | 3300025941 | Bacteria | 10712 |
| 59 | Ga0207711_10059642 | 3300025941 | Bacteria | 3286 |
| 60 | Ga0207668_10000005 | 3300025972 | Bacteria | 193572 |
| 61 | Ga0207677_10110252 | 3300026023 | Bacteria | 2048 |
| 62 | Ga0207703_10000035 | 3300026035 | Bacteria | 183082 |
| 63 | Ga0207639_10079828 | 3300026041 | Bacteria | 2587 |
| 64 | Ga0207639_10265836 | 3300026041 | Bacteria | 1502 |
| 65 | Ga0207641_10000027 | 3300026088 | Bacteria | 244787 |
| 66 | Ga0207641_10050562 | 3300026088 | Bacteria | 3517 |
| 67 | Ga0207676_10000093 | 3300026095 | Bacteria | 80702 |
| 68 | Ga0207698_10086786 | 3300026142 | Bacteria | 2546 |
| 69 | Ga0207428_10032246 | 3300027907 | Bacteria | 4311 |
| 70 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 71 | Ga0268266_10002143 | 3300028379 | Bacteria | 21700 |
| 72 | Ga0268265_10017505 | 3300028380 | Bacteria | 4947 |
| 73 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 74 | Ga0268264_10001134 | 3300028381 | Bacteria | 26118 |
| 75 | Ga0307517_10000705 | 3300028786 | Bacteria | 57524 |
| 76 | Ga0307517_10037098 | 3300028786 | Bacteria | 5456 |
| 77 | Ga0307517_10053035 | 3300028786 | Bacteria | 4048 |
| 78 | Ga0307515_10000005 | 3300028794 | Bacteria | 758563 |
| 79 | Ga0265325_10051438 | 3300031241 | Bacteria | 2118 |
| 80 | Ga0265340_10009907 | 3300031247 | Bacteria | 5107 |
| 81 | Ga0265327_10004393 | 3300031251 | Bacteria | 12511 |
| 82 | Ga0307513_10000208 | 3300031456 | Bacteria | 84906 |
| 83 | Ga0307513_10000764 | 3300031456 | Bacteria | 46492 |
| 84 | Ga0307513_10011006 | 3300031456 | Bacteria | 11285 |
| 85 | Ga0265313_10004108 | 3300031595 | Bacteria | 11334 |
| 86 | Ga0265314_10009276 | 3300031711 | Bacteria | 8333 |
| 87 | Ga0307516_10000115 | 3300031730 | Bacteria | 92959 |
| 88 | Ga0307510_10008320 | 3300033180 | Bacteria | 12363 |
| 89 | Ga0315911_1000018 | 3300033442 | Bacteria | 152089 |
| 90 | Ga0373935_0030904 | 3300035692 | Bacteria | 3320 |
| 91 | Ga0373927_0003701 | 3300035695 | Bacteria | 10877 |
| 92 | Ga0373937_0206416 | 3300036401 | Bacteria | 1848 |
| 93 | Ga0373925_0000111 | 3300037068 | Bacteria | 87426 |
| 94 | Ga0395899_0000666 | 3300037312 | Bacteria | 34912 |
| 95 | Ga0395899_0077001 | 3300037312 | Bacteria | 2434 |
| 96 | Ga0395900_0000016 | 3300037418 | Bacteria | 382407 |
| 97 | Ga0395900_0008966 | 3300037418 | Bacteria | 10258 |
| 98 | Ga0395900_0035082 | 3300037418 | Bacteria | 5167 |
| 99 | Ga0395898_0006594 | 3300037466 | Bacteria | 12379 |
| 100 | Ga0395898_0012978 | 3300037466 | Bacteria | 8591 |
| 101 | Ga0395898_0014241 | 3300037466 | Bacteria | 8174 |
| 102 | Ga0395905_0003448 | 3300037471 | Bacteria | 16921 |
| 103 | Ga0395905_0283349 | 3300037471 | Bacteria | 1543 |
| 104 | Ga0436364_0805816 | 3300037853 | Bacteria | 2248 |
| 105 | Ga0436364_0826431 | 3300037853 | Bacteria | 1731 |
| 106 | Ga0395901_0000022 | 3300038443 | Bacteria | 296356 |
| 107 | Ga0436365_1611931 | 3300039437 | Bacteria | 8474 |
| 108 | Ga0436360_0563505 | 3300039438 | Bacteria | 5680 |
| 109 | Ga0436361_0251140 | 3300039447 | Bacteria | 1528 |
| 110 | Ga0436361_0626520 | 3300039447 | Bacteria | 2124 |
| 111 | Ga0439455_0011265 | 3300042012 | Bacteria | 1982 |
| 112 | Ga0495638_0058283 | 3300046460 | Bacteria | 2394 |
| 113 | Ga0495584_0026468 | 3300046491 | Bacteria | 2938 |
| 114 | Ga0495607_0008631 | 3300046501 | Bacteria | 6949 |
| 115 | Ga0495583_0006736 | 3300046506 | Bacteria | 7433 |
| 116 | Ga0495616_0008459 | 3300046513 | Bacteria | 6096 |
| 117 | Ga0495643_0024193 | 3300046522 | Bacteria | 3447 |
| 118 | Ga0495642_0015992 | 3300046528 | Bacteria | 2921 |
| 119 | Ga0495609_0000681 | 3300046538 | Bacteria | 26243 |
| 120 | Ga0495597_0000444 | 3300046542 | Bacteria | 35383 |
| 121 | Ga0495622_0022123 | 3300046557 | Bacteria | 2962 |
| 122 | Ga0495668_0020107 | 3300046616 | Bacteria | 3841 |
| 123 | Ga0495668_0036427 | 3300046616 | Bacteria | 2756 |
| 124 | Ga0495668_0085688 | 3300046616 | Bacteria | 1728 |
| 125 | Ga0495611_0035663 | 3300046648 | Bacteria | 2204 |
| 126 | Ga0495625_0004518 | 3300046660 | Bacteria | 13122 |
| 127 | Ga0495625_0150606 | 3300046660 | Bacteria | 1564 |
| 128 | Ga0495659_0005499 | 3300046664 | Bacteria | 3986 |
| 129 | Ga0495669_0000005 | 3300046684 | Bacteria | 193971 |
| 130 | Ga0495669_0001354 | 3300046684 | Bacteria | 10140 |
| 131 | Ga0495649_0024386 | 3300046694 | Bacteria | 3373 |
| 132 | Ga0495636_0022654 | 3300047318 | Bacteria | 2540 |
| 133 | Ga0495672_0007777 | 3300047320 | Bacteria | 8015 |
| 134 | Ga0495672_0031507 | 3300047320 | Bacteria | 3310 |
| 135 | Ga0495672_0054945 | 3300047320 | Bacteria | 2325 |
| 136 | Ga0495687_049752 | 3300047443 | Bacteria | 1789 |
| 137 | Ga0495677_0008533 | 3300047445 | Bacteria | 3804 |
| 138 | Ga0495681_0006226 | 3300047470 | Bacteria | 7867 |
| 139 | Ga0496102_0157088 | 3300048905 | Bacteria | 2138 |
| 140 | Ga0496109_0040643 | 3300048912 | Bacteria | 4212 |
| 141 | Ga0496112_0024712 | 3300048915 | Bacteria | 5760 |
| 142 | Ga0496115_0010691 | 3300048918 | Bacteria | 6865 |
| 143 | Ga0496115_0029921 | 3300048918 | Bacteria | 4281 |
| 144 | Ga0496117_0031684 | 3300048920 | Bacteria | 4032 |
| 145 | Ga0496118_0006605 | 3300048921 | Bacteria | 12667 |
| 146 | Ga0496121_0000053 | 3300048924 | Bacteria | 312611 |
| 147 | Ga0496121_0145500 | 3300048924 | Bacteria | 1752 |
| 148 | Ga0496126_0012483 | 3300048929 | Bacteria | 8699 |
| 149 | Ga0496126_0052454 | 3300048929 | Bacteria | 3706 |
| 150 | Ga0501257_001134 | 3300049686 | Bacteria | 5431 |
| 151 | nmdc:mga05p37_73014_c1 | 3300050507 | Bacteria | 4222 |
| 152 | nmdc:mga09592_4679_c1 | 3300050508 | Bacteria | 11075 |
| 153 | nmdc:mga06r32_16982_c1 | 3300050510 | Bacteria | 6641 |
| 154 | nmdc:mga08y16_407_c1 | 3300050511 | Bacteria | 39530 |
| 155 | Ga0500643_005606 | 3300053087 | Bacteria | 5380 |
| 156 | Ga0500566_0034388 | 3300053094 | Bacteria | 2949 |
| 157 | Ga0500641_0005817 | 3300053096 | Bacteria | 4365 |
| 158 | Ga0500556_0042568 | 3300053104 | Bacteria | 1607 |
| 159 | Ga0500562_004399 | 3300053108 | Bacteria | 3564 |
| 160 | Ga0500595_009319 | 3300053119 | Bacteria | 3966 |
| 161 | Ga0500608_001089 | 3300053122 | Bacteria | 9690 |
| 162 | Ga0500559_0006406 | 3300053136 | Bacteria | 5318 |
| 163 | Ga0500603_006211 | 3300053150 | Bacteria | 2591 |
| 164 | 2509147038 | 2508501128 | Bacteria | 8613869 |
| 165 | 2513860259 | 2513237137 | Bacteria | 9558895 |
| 166 | 2513887578 | 2513237141 | Bacteria | 8496279 |
| 167 | 2524536520 | 2524023228 | Bacteria | 10118060 |
| 168 | 2793073276 | 2791355197 | Bacteria | 8420563 |
| 169 | 2885376024 | 2885374607 | Bacteria | 8927485 |
| 170 | 2894772631 | 2894772417 | Bacteria | 5305674 |
| 171 | 2903751593 | 2903748898 | Bacteria | 9972761 |
| 172 | 2904692482 | 2904690495 | Bacteria | 9412302 |
| 173 | 2904709058 | |||
| 174 | 2908747805 | 2908739725 | Bacteria | 8628932 |
| 175 | 2908757218 | 2908756301 | Bacteria | 8864324 |
| 176 | 2908762636 | 2908756301 | Bacteria | 8864324 |
| 177 | 2922370955 | |||
| 178 | Ga0307513_10011796 | |||
| 179 | JGI25406J46586_10000556 | |||
| 180 | Ga0070658_10067662 | |||
| 181 | Ga0070658_10200342 | |||
| 182 | Ga0070680_100006282 | |||
| 183 | Ga0070668_100000480 | |||
| 184 | Ga0070673_100098353 | |||
| 185 | Ga0070659_100000143 | |||
| 186 | Ga0070667_100001176 | |||
| 187 | Ga0070710_10017449 | |||
| 188 | Ga0070711_100026730 | |||
| 189 | Ga0070694_100011072 | |||
| 190 | Ga0070678_100093680 | |||
| 191 | Ga0070681_10016591 | |||
| 192 | Ga0070706_100002303 | |||
| 193 | Ga0068853_100025597 | |||
| 194 | Ga0068853_100041618 | |||
| 195 | Ga0070686_100001944 | |||
| 196 | Ga0070665_100000144 | |||
| 197 | Ga0070665_100000304 | |||
| 198 | Ga0070704_100030137 | |||
| 199 | Ga0068864_100000096 | |||
| 200 | Ga0068863_100000041 | |||
| 201 | Ga0068858_100000494 | |||
| 202 | Ga0068860_100000115 | |||
| 203 | Ga0068860_100000351 | |||
| 204 | Ga0068862_100008437 | |||
| 205 | Ga0068862_100056266 | |||
| 206 | Ga0075428_100000129 | |||
| 207 | Ga0075431_100000235 | |||
| 208 | Ga0075429_100000514 | |||
| 209 | Ga0068865_100007398 | |||
| 210 | Ga0105250_10038396 | |||
| 211 | Ga0105240_10037238 | |||
| 212 | Ga0111539_10049200 | |||
| 213 | Ga0114129_10092668 | |||
| 214 | Ga0105248_10001990 | |||
| 215 | Ga0105248_10070579 | |||
| 216 | Ga0105237_10054861 | |||
| 217 | Ga0105238_10019578 | |||
| 218 | Ga0105238_10155890 | |||
| 219 | Ga0105238_10312057 | |||
| 220 | Ga0105239_10119126 | |||
| 221 | Ga0157369_10002561 | |||
| 222 | Ga0163162_10408312 | |||
| 223 | Ga0157372_10326121 | |||
| 224 | Ga0207705_10042571 | |||
| 225 | Ga0207707_10096583 | |||
| 226 | Ga0207707_10164465 | |||
| 227 | Ga0207695_10266093 | |||
| 228 | Ga0207660_10019584 | |||
| 229 | Ga0207657_10003177 | |||
| 230 | Ga0207657_10064365 | |||
| 231 | Ga0207694_10071333 | |||
| 232 | Ga0207694_10073208 | |||
| 233 | Ga0207690_10000283 | |||
| 234 | Ga0207704_10000916 | |||
| 235 | Ga0207711_10005497 | |||
| 236 | Ga0207711_10059642 | |||
| 237 | Ga0207668_10000005 | |||
| 238 | Ga0207677_10110252 | |||
| 239 | Ga0207703_10000035 | |||
| 240 | Ga0207639_10079828 | |||
| 241 | Ga0207639_10265836 | |||
| 242 | Ga0207641_10000027 | |||
| 243 | Ga0207641_10050562 | |||
| 244 | Ga0207676_10000093 | |||
| 245 | Ga0207698_10086786 | |||
| 246 | Ga0207428_10032246 | |||
| 247 | Ga0268266_10000003 | |||
| 248 | Ga0268266_10002143 | |||
| 249 | Ga0268265_10017505 | |||
| 250 | Ga0268264_10000002 | |||
| 251 | Ga0268264_10001134 | |||
| 252 | Ga0307517_10000705 | |||
| 253 | Ga0307517_10037098 | |||
| 254 | Ga0307517_10053035 | |||
| 255 | Ga0307515_10000005 | |||
| 256 | Ga0265325_10051438 | |||
| 257 | Ga0265340_10009907 | |||
| 258 | Ga0265327_10004393 | |||
| 259 | Ga0307513_10000208 | |||
| 260 | Ga0307513_10000764 | |||
| 261 | Ga0307513_10011006 | |||
| 262 | Ga0265313_10004108 | |||
| 263 | Ga0265314_10009276 | |||
| 264 | Ga0307516_10000115 | |||
| 265 | Ga0307510_10008320 | |||
| 266 | Ga0315911_1000018 | |||
| 267 | Ga0373935_0030904 | |||
| 268 | Ga0373927_0003701 | |||
| 269 | Ga0373937_0206416 | |||
| 270 | Ga0373925_0000111 | |||
| 271 | Ga0395899_0000666 | |||
| 272 | Ga0395899_0077001 | |||
| 273 | Ga0395900_0000016 | |||
| 274 | Ga0395900_0008966 | |||
| 275 | Ga0395900_0035082 | |||
| 276 | Ga0395898_0006594 | |||
| 277 | Ga0395898_0012978 | |||
| 278 | Ga0395898_0014241 | |||
| 279 | Ga0395905_0003448 | |||
| 280 | Ga0395905_0283349 | |||
| 281 | Ga0436364_0805816 | |||
| 282 | Ga0436364_0826431 | |||
| 283 | Ga0395901_0000022 | |||
| 284 | Ga0436365_1611931 | |||
| 285 | Ga0436360_0563505 | |||
| 286 | Ga0436361_0251140 | |||
| 287 | Ga0436361_0626520 | |||
| 288 | Ga0439455_0011265 | |||
| 289 | Ga0495638_0058283 | |||
| 290 | Ga0495584_0026468 | |||
| 291 | Ga0495607_0008631 | |||
| 292 | Ga0495583_0006736 | |||
| 293 | Ga0495616_0008459 | |||
| 294 | Ga0495643_0024193 | |||
| 295 | Ga0495642_0015992 | |||
| 296 | Ga0495609_0000681 | |||
| 297 | Ga0495597_0000444 | |||
| 298 | Ga0495622_0022123 | |||
| 299 | Ga0495668_0020107 | |||
| 300 | Ga0495668_0036427 | |||
| 301 | Ga0495668_0085688 | |||
| 302 | Ga0495611_0035663 | |||
| 303 | Ga0495625_0004518 | |||
| 304 | Ga0495625_0150606 | |||
| 305 | Ga0495659_0005499 | |||
| 306 | Ga0495669_0000005 | |||
| 307 | Ga0495669_0001354 | |||
| 308 | Ga0495649_0024386 | |||
| 309 | Ga0495636_0022654 | |||
| 310 | Ga0495672_0007777 | |||
| 311 | Ga0495672_0031507 | |||
| 312 | Ga0495672_0054945 | |||
| 313 | Ga0495687_049752 | |||
| 314 | Ga0495677_0008533 | |||
| 315 | Ga0495681_0006226 | |||
| 316 | Ga0496102_0157088 | |||
| 317 | Ga0496109_0040643 | |||
| 318 | Ga0496112_0024712 | |||
| 319 | Ga0496115_0010691 | |||
| 320 | Ga0496115_0029921 | |||
| 321 | Ga0496117_0031684 | |||
| 322 | Ga0496118_0006605 | |||
| 323 | Ga0496121_0000053 | |||
| 324 | Ga0496121_0145500 | |||
| 325 | Ga0496126_0012483 | |||
| 326 | Ga0496126_0052454 | |||
| 327 | Ga0501257_001134 | |||
| 328 | nmdc:mga05p37_73014_c1 | |||
| 329 | nmdc:mga09592_4679_c1 | |||
| 330 | nmdc:mga06r32_16982_c1 | |||
| 331 | nmdc:mga08y16_407_c1 | |||
| 332 | Ga0500643_005606 | |||
| 333 | Ga0500566_0034388 | |||
| 334 | Ga0500641_0005817 | |||
| 335 | Ga0500556_0042568 | |||
| 336 | Ga0500562_004399 | |||
| 337 | Ga0500595_009319 | |||
| 338 | Ga0500608_001089 | |||
| 339 | Ga0500559_0006406 | |||
| 340 | Ga0500603_006211 | |||
| 341 | 2509147038 | |||
| 342 | 2513860259 | |||
| 343 | 2513887578 | |||
| 344 | 2524536520 | |||
| 345 | 2793073276 | |||
| 346 | 2885376024 | |||
| 347 | 2894772631 | |||
| 348 | 2903751593 | |||
| 349 | 2904692482 | |||
| 350 | 2904709058 | |||
| 351 | 2908747805 | |||
| 352 | 2908757218 | |||
| 353 | 2908762636 | |||
| 354 | 2922370955 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nwl-assembly1.cif.gz_C | crystal structure of gltph in complex with l-asp | 0.853 | 15 | 412 |
| 6uwf-assembly1.cif.gz_A | gltph in complex with l-aspartate and sodium ions in outward-facing state | 0.8525 | 14 | 412 |
| 2nwx-assembly1.cif.gz_C | crystal structure of gltph in complex with l-aspartate and sodium ions | 0.8522 | 18 | 412 |
| 1xfh-assembly1.cif.gz_A | structure of glutamate transporter homolog from pyrococcus horikoshii | 0.8514 | 19 | 411 |
| 6uwl-assembly1.cif.gz_A | gltph in complex with l-aspartate and sodium ions in intermediate outward-facing state | 0.8504 | 15 | 412 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A830_1_408_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9435 | 18 | 417 | 1.10.3860.10 |
| af_P21345_1_417_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.925 | 14 | 417 | 1.10.3860.10 |
| af_P0A830_1_408_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9236 | 18 | 417 | 1.10.3860.10 |
| af_P71906_20_424_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9217 | 21 | 417 | 1.10.3860.10 |
| af_P71906_20_424_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9022 | 21 | 417 | 1.10.3860.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Y3J673-F1-model_v4 | C4-dicarboxylate ABC transporter | 0.9694 | 60 | 427 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |
| AF-A0A4Q3W2S4-F1-model_v4 | Dicarboxylate/amino acid:cation symporter | 0.961 | 17 | 426 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |
| AF-A0A358XU19-F1-model_v4 | C4-dicarboxylate transporter DctA | 0.961 | 258 | 426 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |
| AF-N8RC33-F1-model_v4 | C4-dicarboxylate transporter DctA | 0.9593 | 21 | 428 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |
| AF-A0A485H0W4-F1-model_v4 | deleted | 0.9584 | 235 | 427 |
|