F265406
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 174 | 98 | 348 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300053098|Ga0500650_0000103|Ga0500650_0000103_13432_14490 |
| Length | 352 |
| Sequence | MRTEIISHDTIASEEKLAGLGDNGHTVSMISVVIPMYNEAESVAPLCEQLSEALATAPWRWEIVFVNDGSSDETIAKLTDQVLRFPENFRLVDLQRNFGQTAALMAGIDHARGDIIVPMDGDLQNDPQDIVRLVAKIGEGFDVVSGWRRSRQDASFRRVLPSRIANKLISVISGVHLHDYGCSLKAYRRDVLSGFRLYGEMHRFVPIFARWQGAKITEMVVNHHPRRFGTSKYGLERIFKVLLDLLLVKFLTQYDTKPIYVFGGVGALFFALSGLATLYAIWLKLFSKVSFIQTPLPLMAMFSAMTGIMCILLGLLAEVLVRIYFESQGKTQYAVRSVIGQSGEPLDGKRTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 11 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 12 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 14 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 15 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 16 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 17 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 18 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 19 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 21 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 24 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 25 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 33 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 34 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 35 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 36 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 37 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 38 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 39 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 40 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 41 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 42 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 43 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 44 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 45 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 46 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 47 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 48 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 49 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 50 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 51 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 52 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 53 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 54 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 55 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 56 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 57 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 58 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 59 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 60 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 61 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 62 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 63 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 64 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 75 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 76 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 77 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 78 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 79 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 80 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 81 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 82 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 83 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 84 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 85 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 86 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 87 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 88 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 89 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 90 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 94 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 95 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 96 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 97 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 98 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.85 |
| Metatranscriptomes | 0 |
| Isolates | 1.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.02 |
| Nodule | 0 |
| Rhizoplane | 1.72 |
| Rhizosphere | 90.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500650_0000103 | 3300053098 | Bacteria | 23538 |
| 2 | SwRhRL2b_contig_3726896 | 2162886007 | Bacteria | 6591 |
| 3 | Ga0065704_10072310 | 3300005289 | Bacteria | 8751 |
| 4 | Ga0065704_10112682 | 3300005289 | Bacteria | 1929 |
| 5 | Ga0065707_10000519 | 3300005295 | Bacteria | 44472 |
| 6 | Ga0065707_10001932 | 3300005295 | Bacteria | 6482 |
| 7 | Ga0065707_10082940 | 3300005295 | Bacteria | 11295 |
| 8 | Ga0070691_10029989 | 3300005341 | Bacteria | 2546 |
| 9 | Ga0070700_100046379 | 3300005441 | Bacteria | 2684 |
| 10 | Ga0070694_100288386 | 3300005444 | Bacteria | 1254 |
| 11 | Ga0070681_10004255 | 3300005458 | Bacteria | 13568 |
| 12 | Ga0070681_10218820 | 3300005458 | Bacteria | 1820 |
| 13 | Ga0070698_100184660 | 3300005471 | Bacteria | 2023 |
| 14 | Ga0068861_100392607 | 3300005719 | Bacteria | 1229 |
| 15 | Ga0081540_1043138 | 3300005983 | Unclassified | 2318 |
| 16 | Ga0081540_1051699 | 3300005983 | Bacteria | 2029 |
| 17 | Ga0081539_10002894 | 3300005985 | Bacteria | 22741 |
| 18 | Ga0075365_10002112 | 3300006038 | Bacteria | 9514 |
| 19 | Ga0075369_10003422 | 3300006186 | Bacteria | 5776 |
| 20 | Ga0075434_100211691 | 3300006871 | Unclassified | 1958 |
| 21 | Ga0075429_100019792 | 3300006880 | Bacteria | 5835 |
| 22 | Ga0075429_100048191 | 3300006880 | Bacteria | 3707 |
| 23 | Ga0075429_100056840 | 3300006880 | Bacteria | 3406 |
| 24 | Ga0111539_10102730 | 3300009094 | Bacteria | 3355 |
| 25 | Ga0114129_10000389 | 3300009147 | Bacteria | 51194 |
| 26 | Ga0114129_10005147 | 3300009147 | Bacteria | 18406 |
| 27 | Ga0114129_10023031 | 3300009147 | Bacteria | 8836 |
| 28 | Ga0114129_10279182 | 3300009147 | Bacteria | 2232 |
| 29 | Ga0105249_10109735 | 3300009553 | Unclassified | 2606 |
| 30 | Ga0099796_10000521 | 3300010159 | Bacteria | 6559 |
| 31 | Ga0105239_10189721 | 3300010375 | Bacteria | 2301 |
| 32 | Ga0105246_10052299 | 3300011119 | Unclassified | 2807 |
| 33 | Ga0182008_10034008 | 3300014497 | Bacteria | 2556 |
| 34 | Ga0213875_10000651 | 3300021388 | Bacteria | 27647 |
| 35 | Ga0207707_10012339 | 3300025912 | Bacteria | 7426 |
| 36 | Ga0207687_10354589 | 3300025927 | Bacteria | 1196 |
| 37 | Ga0207709_10071080 | 3300025935 | Bacteria | 2209 |
| 38 | Ga0207703_10438901 | 3300026035 | Bacteria | 1218 |
| 39 | Ga0207708_10061219 | 3300026075 | Bacteria | 2874 |
| 40 | Ga0207702_10083544 | 3300026078 | Bacteria | 2779 |
| 41 | Ga0207675_100156824 | 3300026118 | Archaea | 2169 |
| 42 | Ga0207675_100370092 | 3300026118 | Bacteria | 1407 |
| 43 | Ga0207428_10289351 | 3300027907 | Bacteria | 1214 |
| 44 | Ga0265337_1003191 | 3300028556 | Bacteria | 7199 |
| 45 | Ga0265334_10005187 | 3300028573 | Bacteria | 5710 |
| 46 | Ga0265336_10018921 | 3300028666 | Bacteria | 2226 |
| 47 | Ga0265324_10004010 | 3300029957 | Bacteria | 6780 |
| 48 | Ga0265320_10010206 | 3300031240 | Bacteria | 5608 |
| 49 | Ga0265340_10003075 | 3300031247 | Bacteria | 9475 |
| 50 | Ga0265331_10011943 | 3300031250 | Bacteria | 4734 |
| 51 | Ga0265327_10022890 | 3300031251 | Bacteria | 3717 |
| 52 | Ga0265316_10017437 | 3300031344 | Bacteria | 6207 |
| 53 | Ga0265316_10040481 | 3300031344 | Unclassified | 3736 |
| 54 | Ga0307408_100286051 | 3300031548 | Unclassified | 1375 |
| 55 | Ga0316576_10082387 | 3300031727 | Bacteria | 2389 |
| 56 | Ga0316578_10040027 | 3300031728 | Unclassified | 2708 |
| 57 | Ga0316578_10045749 | 3300031728 | Bacteria | 2549 |
| 58 | Ga0316578_10096638 | 3300031728 | Bacteria | 1769 |
| 59 | Ga0307407_10029225 | 3300031903 | Bacteria | 2958 |
| 60 | Ga0307407_10094839 | 3300031903 | Unclassified | 1838 |
| 61 | Ga0307411_10220736 | 3300032005 | Bacteria | 1470 |
| 62 | Ga0373953_0040491 | 3300035117 | Unclassified | 1851 |
| 63 | Ga0373943_0034004 | 3300035170 | Bacteria | 2431 |
| 64 | Ga0373946_0035508 | 3300035171 | Bacteria | 2018 |
| 65 | Ga0316574_0027376 | 3300035398 | Bacteria | 3434 |
| 66 | Ga0373927_0014102 | 3300035695 | Bacteria | 5299 |
| 67 | Ga0316582_0028181 | 3300036647 | Bacteria | 3400 |
| 68 | Ga0316582_0057547 | 3300036647 | Bacteria | 2484 |
| 69 | Ga0316582_0089212 | 3300036647 | Bacteria | 2027 |
| 70 | Ga0316584_0044898 | 3300036712 | Bacteria | 3297 |
| 71 | Ga0316584_0046452 | 3300036712 | Unclassified | 3243 |
| 72 | Ga0373925_0052627 | 3300037068 | Bacteria | 3042 |
| 73 | Ga0436364_1423953 | 3300037853 | Bacteria | 39549 |
| 74 | Ga0400490_14545 | 3300038726 | Unclassified | 1453 |
| 75 | Ga0400483_012106 | 3300039062 | Unclassified | 1491 |
| 76 | Ga0436361_0312446 | 3300039447 | Bacteria | 2239 |
| 77 | Ga0436361_0658228 | 3300039447 | Bacteria | 1354 |
| 78 | Ga0436362_0002132 | 3300039453 | Bacteria | 3033 |
| 79 | Ga0436362_1166169 | 3300039453 | Bacteria | 1551 |
| 80 | Ga0451577_0003705 | 3300042876 | Bacteria | 16707 |
| 81 | Ga0451577_0007543 | 3300042876 | Bacteria | 10679 |
| 82 | Ga0451577_0056987 | 3300042876 | Bacteria | 3484 |
| 83 | Ga0451577_0075313 | 3300042876 | Bacteria | 3010 |
| 84 | Ga0451577_0186332 | 3300042876 | Bacteria | 1872 |
| 85 | Ga0451577_0203986 | 3300042876 | Unclassified | 1785 |
| 86 | Ga0451577_0223854 | 3300042876 | Bacteria | 1701 |
| 87 | Ga0451577_0258770 | 3300042876 | Bacteria | 1576 |
| 88 | Ga0451577_0269532 | 3300042876 | Bacteria | 1542 |
| 89 | Ga0451577_0281474 | 3300042876 | Unclassified | 1507 |
| 90 | Ga0451577_0413956 | 3300042876 | Bacteria | 1224 |
| 91 | Ga0453683_0000917 | 3300044673 | Bacteria | 28148 |
| 92 | Ga0453683_0006836 | 3300044673 | Bacteria | 7788 |
| 93 | Ga0453683_0012507 | 3300044673 | Bacteria | 5562 |
| 94 | Ga0453683_0048311 | 3300044673 | Unclassified | 2669 |
| 95 | Ga0453683_0075895 | 3300044673 | Bacteria | 2104 |
| 96 | Ga0453683_0082312 | 3300044673 | Unclassified | 2017 |
| 97 | Ga0453683_0093330 | 3300044673 | Bacteria | 1887 |
| 98 | Ga0453684_0000012 | 3300044712 | Bacteria | 1062512 |
| 99 | Ga0453684_0000232 | 3300044712 | Bacteria | 240951 |
| 100 | Ga0453684_0000899 | 3300044712 | Bacteria | 99196 |
| 101 | Ga0453684_0001229 | 3300044712 | Bacteria | 78474 |
| 102 | Ga0453684_0001360 | 3300044712 | Bacteria | 71203 |
| 103 | Ga0453684_0002251 | 3300044712 | Bacteria | 47800 |
| 104 | Ga0453684_0005177 | 3300044712 | Bacteria | 26234 |
| 105 | Ga0453684_0009696 | 3300044712 | Bacteria | 16761 |
| 106 | Ga0453684_0014689 | 3300044712 | Bacteria | 12484 |
| 107 | Ga0453684_0026083 | 3300044712 | Bacteria | 8459 |
| 108 | Ga0453684_0036131 | 3300044712 | Bacteria | 6814 |
| 109 | Ga0453684_0038972 | 3300044712 | Bacteria | 6483 |
| 110 | Ga0453684_0041889 | 3300044712 | Bacteria | 6182 |
| 111 | Ga0453684_0052415 | 3300044712 | Bacteria | 5336 |
| 112 | Ga0453684_0063663 | 3300044712 | Bacteria | 4716 |
| 113 | Ga0453684_0064360 | 3300044712 | Unclassified | 4685 |
| 114 | Ga0453684_0146166 | 3300044712 | Unclassified | 2816 |
| 115 | Ga0453684_0149743 | 3300044712 | Bacteria | 2775 |
| 116 | Ga0453684_0152215 | 3300044712 | Unclassified | 2747 |
| 117 | Ga0453684_0188264 | 3300044712 | Bacteria | 2416 |
| 118 | Ga0453684_0198534 | 3300044712 | Bacteria | 2340 |
| 119 | Ga0453684_0245857 | 3300044712 | Bacteria | 2057 |
| 120 | Ga0453684_0277060 | 3300044712 | Bacteria | 1914 |
| 121 | Ga0453684_0293634 | 3300044712 | Bacteria | 1850 |
| 122 | Ga0453684_0332811 | 3300044712 | Bacteria | 1717 |
| 123 | Ga0453684_0337028 | 3300044712 | Unclassified | 1704 |
| 124 | Ga0453684_0430882 | 3300044712 | Unclassified | 1471 |
| 125 | Ga0453684_0445437 | 3300044712 | Unclassified | 1442 |
| 126 | Ga0453684_0604178 | 3300044712 | Unclassified | 1202 |
| 127 | Ga0451576_0000509 | 3300045051 | Bacteria | 85219 |
| 128 | Ga0451576_0000868 | 3300045051 | Bacteria | 58132 |
| 129 | Ga0451576_0002676 | 3300045051 | Bacteria | 25949 |
| 130 | Ga0451576_0019375 | 3300045051 | Bacteria | 7427 |
| 131 | Ga0451576_0050219 | 3300045051 | Unclassified | 4374 |
| 132 | Ga0451576_0064422 | 3300045051 | Unclassified | 3818 |
| 133 | Ga0451576_0339541 | 3300045051 | Bacteria | 1572 |
| 134 | Ga0451576_0535530 | 3300045051 | Unclassified | 1230 |
| 135 | Ga0495592_0110365 | 3300046454 | Unclassified | 1947 |
| 136 | Ga0495629_0002995 | 3300046459 | Bacteria | 12849 |
| 137 | Ga0495580_0105829 | 3300046472 | Bacteria | 1954 |
| 138 | Ga0495640_0119236 | 3300046533 | Unclassified | 1717 |
| 139 | Ga0495667_0029714 | 3300046559 | Unclassified | 3678 |
| 140 | Ga0495634_0031002 | 3300046642 | Bacteria | 3686 |
| 141 | Ga0495635_0027169 | 3300046663 | Bacteria | 3982 |
| 142 | Ga0495599_0036673 | 3300046678 | Bacteria | 3080 |
| 143 | Ga0495600_0077508 | 3300046809 | Bacteria | 2170 |
| 144 | Ga0495676_0239614 | 3300047321 | Bacteria | 1242 |
| 145 | Ga0496106_0131848 | 3300048909 | Unclassified | 1961 |
| 146 | Ga0496110_0347969 | 3300048913 | Bacteria | 1350 |
| 147 | Ga0496113_0132193 | 3300048916 | Bacteria | 1959 |
| 148 | Ga0496122_0009565 | 3300048925 | Bacteria | 10175 |
| 149 | Ga0501076_0026503 | 3300049592 | Bacteria | 4491 |
| 150 | Ga0501076_0161411 | 3300049592 | Bacteria | 1826 |
| 151 | Ga0501081_0144385 | 3300049743 | Unclassified | 1707 |
| 152 | Ga0501044_0022248 | 3300049823 | Bacteria | 6757 |
| 153 | nmdc:mga0yw44_1381_c1 | 3300050492 | Bacteria | 9623 |
| 154 | nmdc:mga05p37_12000_c1 | 3300050507 | Bacteria | 10340 |
| 155 | nmdc:mga05p37_167315_c1 | 3300050507 | Bacteria | 2682 |
| 156 | nmdc:mga05p37_45826_c1 | 3300050507 | Bacteria | 5378 |
| 157 | nmdc:mga09592_44518_c1 | 3300050508 | Bacteria | 3737 |
| 158 | nmdc:mga09592_92579_c1 | 3300050508 | Bacteria | 2584 |
| 159 | nmdc:mga0qj67_154660_c1 | 3300050509 | Unclassified | 1861 |
| 160 | nmdc:mga08y16_87550_c1 | 3300050511 | Bacteria | 3245 |
| 161 | nmdc:mga0n895_111532_c1 | 3300050512 | Bacteria | 2751 |
| 162 | nmdc:mga0n895_252998_c1 | 3300050512 | Unclassified | 1788 |
| 163 | nmdc:mga08x19_21843_c1 | 3300050514 | Bacteria | 3955 |
| 164 | nmdc:mga0a205_22912_c1 | 3300050515 | Bacteria | 5922 |
| 165 | nmdc:mga0sz30_5310_c1 | 3300050516 | Bacteria | 4721 |
| 166 | Ga0495601_0007914 | 3300053077 | Bacteria | 6261 |
| 167 | Ga0495595_0011063 | 3300053084 | Bacteria | 3766 |
| 168 | Ga0495619_0017667 | 3300053085 | Bacteria | 4518 |
| 169 | Ga0500568_0019282 | 3300053139 | Bacteria | 2967 |
| 170 | Ga0500604_0000125 | 3300053151 | Bacteria | 23468 |
| 171 | Ga0501084_0228685 | 3300054114 | Unclassified | 1570 |
| 172 | Ga0530510_0210155 | 3300061734 | Bacteria | 1446 |
| 173 | 2512037671 | 2511231221 | Bacteria | 6846400 |
| 174 | 8054006570 | 8054002106 | Bacteria | 7987183 |
| 175 | Ga0500650_0000103 | |||
| 176 | SwRhRL2b_contig_3726896 | |||
| 177 | Ga0065704_10072310 | |||
| 178 | Ga0065704_10112682 | |||
| 179 | Ga0065707_10000519 | |||
| 180 | Ga0065707_10001932 | |||
| 181 | Ga0065707_10082940 | |||
| 182 | Ga0070691_10029989 | |||
| 183 | Ga0070700_100046379 | |||
| 184 | Ga0070694_100288386 | |||
| 185 | Ga0070681_10004255 | |||
| 186 | Ga0070681_10218820 | |||
| 187 | Ga0070698_100184660 | |||
| 188 | Ga0068861_100392607 | |||
| 189 | Ga0081540_1043138 | |||
| 190 | Ga0081540_1051699 | |||
| 191 | Ga0081539_10002894 | |||
| 192 | Ga0075365_10002112 | |||
| 193 | Ga0075369_10003422 | |||
| 194 | Ga0075434_100211691 | |||
| 195 | Ga0075429_100019792 | |||
| 196 | Ga0075429_100048191 | |||
| 197 | Ga0075429_100056840 | |||
| 198 | Ga0111539_10102730 | |||
| 199 | Ga0114129_10000389 | |||
| 200 | Ga0114129_10005147 | |||
| 201 | Ga0114129_10023031 | |||
| 202 | Ga0114129_10279182 | |||
| 203 | Ga0105249_10109735 | |||
| 204 | Ga0099796_10000521 | |||
| 205 | Ga0105239_10189721 | |||
| 206 | Ga0105246_10052299 | |||
| 207 | Ga0182008_10034008 | |||
| 208 | Ga0213875_10000651 | |||
| 209 | Ga0207707_10012339 | |||
| 210 | Ga0207687_10354589 | |||
| 211 | Ga0207709_10071080 | |||
| 212 | Ga0207703_10438901 | |||
| 213 | Ga0207708_10061219 | |||
| 214 | Ga0207702_10083544 | |||
| 215 | Ga0207675_100156824 | |||
| 216 | Ga0207675_100370092 | |||
| 217 | Ga0207428_10289351 | |||
| 218 | Ga0265337_1003191 | |||
| 219 | Ga0265334_10005187 | |||
| 220 | Ga0265336_10018921 | |||
| 221 | Ga0265324_10004010 | |||
| 222 | Ga0265320_10010206 | |||
| 223 | Ga0265340_10003075 | |||
| 224 | Ga0265331_10011943 | |||
| 225 | Ga0265327_10022890 | |||
| 226 | Ga0265316_10017437 | |||
| 227 | Ga0265316_10040481 | |||
| 228 | Ga0307408_100286051 | |||
| 229 | Ga0316576_10082387 | |||
| 230 | Ga0316578_10040027 | |||
| 231 | Ga0316578_10045749 | |||
| 232 | Ga0316578_10096638 | |||
| 233 | Ga0307407_10029225 | |||
| 234 | Ga0307407_10094839 | |||
| 235 | Ga0307411_10220736 | |||
| 236 | Ga0373953_0040491 | |||
| 237 | Ga0373943_0034004 | |||
| 238 | Ga0373946_0035508 | |||
| 239 | Ga0316574_0027376 | |||
| 240 | Ga0373927_0014102 | |||
| 241 | Ga0316582_0028181 | |||
| 242 | Ga0316582_0057547 | |||
| 243 | Ga0316582_0089212 | |||
| 244 | Ga0316584_0044898 | |||
| 245 | Ga0316584_0046452 | |||
| 246 | Ga0373925_0052627 | |||
| 247 | Ga0436364_1423953 | |||
| 248 | Ga0400490_14545 | |||
| 249 | Ga0400483_012106 | |||
| 250 | Ga0436361_0312446 | |||
| 251 | Ga0436361_0658228 | |||
| 252 | Ga0436362_0002132 | |||
| 253 | Ga0436362_1166169 | |||
| 254 | Ga0451577_0003705 | |||
| 255 | Ga0451577_0007543 | |||
| 256 | Ga0451577_0056987 | |||
| 257 | Ga0451577_0075313 | |||
| 258 | Ga0451577_0186332 | |||
| 259 | Ga0451577_0203986 | |||
| 260 | Ga0451577_0223854 | |||
| 261 | Ga0451577_0258770 | |||
| 262 | Ga0451577_0269532 | |||
| 263 | Ga0451577_0281474 | |||
| 264 | Ga0451577_0413956 | |||
| 265 | Ga0453683_0000917 | |||
| 266 | Ga0453683_0006836 | |||
| 267 | Ga0453683_0012507 | |||
| 268 | Ga0453683_0048311 | |||
| 269 | Ga0453683_0075895 | |||
| 270 | Ga0453683_0082312 | |||
| 271 | Ga0453683_0093330 | |||
| 272 | Ga0453684_0000012 | |||
| 273 | Ga0453684_0000232 | |||
| 274 | Ga0453684_0000899 | |||
| 275 | Ga0453684_0001229 | |||
| 276 | Ga0453684_0001360 | |||
| 277 | Ga0453684_0002251 | |||
| 278 | Ga0453684_0005177 | |||
| 279 | Ga0453684_0009696 | |||
| 280 | Ga0453684_0014689 | |||
| 281 | Ga0453684_0026083 | |||
| 282 | Ga0453684_0036131 | |||
| 283 | Ga0453684_0038972 | |||
| 284 | Ga0453684_0041889 | |||
| 285 | Ga0453684_0052415 | |||
| 286 | Ga0453684_0063663 | |||
| 287 | Ga0453684_0064360 | |||
| 288 | Ga0453684_0146166 | |||
| 289 | Ga0453684_0149743 | |||
| 290 | Ga0453684_0152215 | |||
| 291 | Ga0453684_0188264 | |||
| 292 | Ga0453684_0198534 | |||
| 293 | Ga0453684_0245857 | |||
| 294 | Ga0453684_0277060 | |||
| 295 | Ga0453684_0293634 | |||
| 296 | Ga0453684_0332811 | |||
| 297 | Ga0453684_0337028 | |||
| 298 | Ga0453684_0430882 | |||
| 299 | Ga0453684_0445437 | |||
| 300 | Ga0453684_0604178 | |||
| 301 | Ga0451576_0000509 | |||
| 302 | Ga0451576_0000868 | |||
| 303 | Ga0451576_0002676 | |||
| 304 | Ga0451576_0019375 | |||
| 305 | Ga0451576_0050219 | |||
| 306 | Ga0451576_0064422 | |||
| 307 | Ga0451576_0339541 | |||
| 308 | Ga0451576_0535530 | |||
| 309 | Ga0495592_0110365 | |||
| 310 | Ga0495629_0002995 | |||
| 311 | Ga0495580_0105829 | |||
| 312 | Ga0495640_0119236 | |||
| 313 | Ga0495667_0029714 | |||
| 314 | Ga0495634_0031002 | |||
| 315 | Ga0495635_0027169 | |||
| 316 | Ga0495599_0036673 | |||
| 317 | Ga0495600_0077508 | |||
| 318 | Ga0495676_0239614 | |||
| 319 | Ga0496106_0131848 | |||
| 320 | Ga0496110_0347969 | |||
| 321 | Ga0496113_0132193 | |||
| 322 | Ga0496122_0009565 | |||
| 323 | Ga0501076_0026503 | |||
| 324 | Ga0501076_0161411 | |||
| 325 | Ga0501081_0144385 | |||
| 326 | Ga0501044_0022248 | |||
| 327 | nmdc:mga0yw44_1381_c1 | |||
| 328 | nmdc:mga05p37_12000_c1 | |||
| 329 | nmdc:mga05p37_167315_c1 | |||
| 330 | nmdc:mga05p37_45826_c1 | |||
| 331 | nmdc:mga09592_44518_c1 | |||
| 332 | nmdc:mga09592_92579_c1 | |||
| 333 | nmdc:mga0qj67_154660_c1 | |||
| 334 | nmdc:mga08y16_87550_c1 | |||
| 335 | nmdc:mga0n895_111532_c1 | |||
| 336 | nmdc:mga0n895_252998_c1 | |||
| 337 | nmdc:mga08x19_21843_c1 | |||
| 338 | nmdc:mga0a205_22912_c1 | |||
| 339 | nmdc:mga0sz30_5310_c1 | |||
| 340 | Ga0495601_0007914 | |||
| 341 | Ga0495595_0011063 | |||
| 342 | Ga0495619_0017667 | |||
| 343 | Ga0500568_0019282 | |||
| 344 | Ga0500604_0000125 | |||
| 345 | Ga0501084_0228685 | |||
| 346 | Ga0530510_0210155 | |||
| 347 | 2512037671 | |||
| 348 | 8054006570 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ekp-assembly1.cif.gz_A | structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) | 0.7784 | 1 | 318 |
| 5ekp-assembly1.cif.gz_D | structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) | 0.7768 | 1 | 317 |
| 5eke-assembly1.cif.gz_D | structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) | 0.7734 | 1 | 317 |
| 5eke-assembly1.cif.gz_A | structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) | 0.7725 | 1 | 318 |
| 5ekp-assembly1.cif.gz_A | structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) | 0.7615 | 1 | 318 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53493_586_855_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8903 | 2 | 223 | 3.90.550.10 |
| af_Q57964_2_229_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8885 | 5 | 224 | 3.90.550.10 |
| af_P77757_4_230_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8714 | 2 | 221 | 3.90.550.10 |
| af_Q7XKE1_11_124_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.8634 | 232 | 296 | 1.20.140.150 |
| af_B4FD22_11_124_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.8601 | 232 | 296 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2J9K3-F1-model_v4 | Glycosyltransferase | 0.9891 | 1 | 104 |
GO:0005886
GO:0016757 |
| AF-A0A849ES91-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9664 | 1 | 224 |
GO:0005886
GO:0099621 |
| AF-A0A1F7CWQ3-F1-model_v4 | Glycosyltransferase 2-like domain-containing protein | 0.9664 | 2 | 223 |
GO:0005886
GO:0016757 |
| AF-A0A1G2VV75-F1-model_v4 | Glycosyl transferase | 0.9633 | 1 | 225 |
GO:0005886
GO:0099621 |
| AF-A0A2V9L848-F1-model_v4 | Glycosyltransferase | 0.9629 | 2 | 224 |
GO:0005886
GO:0099621 |