F265406

General Info

Members Datasets Scaffolds Average Seq Length
174 98 348 323

Family's Representative Sequence

Representative Sequence 3300053098|Ga0500650_0000103|Ga0500650_0000103_13432_14490
Length 352
Sequence MRTEIISHDTIASEEKLAGLGDNGHTVSMISVVIPMYNEAESVAPLCEQLSEALATAPWRWEIVFVNDGSSDETIAKLTDQVLRFPENFRLVDLQRNFGQTAALMAGIDHARGDIIVPMDGDLQNDPQDIVRLVAKIGEGFDVVSGWRRSRQDASFRRVLPSRIANKLISVISGVHLHDYGCSLKAYRRDVLSGFRLYGEMHRFVPIFARWQGAKITEMVVNHHPRRFGTSKYGLERIFKVLLDLLLVKFLTQYDTKPIYVFGGVGALFFALSGLATLYAIWLKLFSKVSFIQTPLPLMAMFSAMTGIMCILLGLLAEVLVRIYFESQGKTQYAVRSVIGQSGEPLDGKRTA

Samples

Sample ID Description Type Environment
1 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
11 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
15 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
16 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
17 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
20 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
25 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
33 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
34 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
35 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
36 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
37 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
38 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
39 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
40 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
41 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
44 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
47 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
48 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
49 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
50 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
51 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
52 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
53 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
54 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
55 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
56 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
57 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
58 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
59 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
60 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
61 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
65 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
66 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
67 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
68 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
69 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
70 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
71 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
72 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
73 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
74 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
75 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
76 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
77 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
78 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
79 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
80 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
81 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
82 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
83 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
84 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
85 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
86 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
87 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
88 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
89 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
90 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
91 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
92 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
93 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
94 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
95 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
96 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
97 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
98 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.02
Nodule 0
Rhizoplane 1.72
Rhizosphere 90.8
Stem 0
Stem Tuber 0
Unclassified 19.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500650_0000103 3300053098 Bacteria 23538
2 SwRhRL2b_contig_3726896 2162886007 Bacteria 6591
3 Ga0065704_10072310 3300005289 Bacteria 8751
4 Ga0065704_10112682 3300005289 Bacteria 1929
5 Ga0065707_10000519 3300005295 Bacteria 44472
6 Ga0065707_10001932 3300005295 Bacteria 6482
7 Ga0065707_10082940 3300005295 Bacteria 11295
8 Ga0070691_10029989 3300005341 Bacteria 2546
9 Ga0070700_100046379 3300005441 Bacteria 2684
10 Ga0070694_100288386 3300005444 Bacteria 1254
11 Ga0070681_10004255 3300005458 Bacteria 13568
12 Ga0070681_10218820 3300005458 Bacteria 1820
13 Ga0070698_100184660 3300005471 Bacteria 2023
14 Ga0068861_100392607 3300005719 Bacteria 1229
15 Ga0081540_1043138 3300005983 Unclassified 2318
16 Ga0081540_1051699 3300005983 Bacteria 2029
17 Ga0081539_10002894 3300005985 Bacteria 22741
18 Ga0075365_10002112 3300006038 Bacteria 9514
19 Ga0075369_10003422 3300006186 Bacteria 5776
20 Ga0075434_100211691 3300006871 Unclassified 1958
21 Ga0075429_100019792 3300006880 Bacteria 5835
22 Ga0075429_100048191 3300006880 Bacteria 3707
23 Ga0075429_100056840 3300006880 Bacteria 3406
24 Ga0111539_10102730 3300009094 Bacteria 3355
25 Ga0114129_10000389 3300009147 Bacteria 51194
26 Ga0114129_10005147 3300009147 Bacteria 18406
27 Ga0114129_10023031 3300009147 Bacteria 8836
28 Ga0114129_10279182 3300009147 Bacteria 2232
29 Ga0105249_10109735 3300009553 Unclassified 2606
30 Ga0099796_10000521 3300010159 Bacteria 6559
31 Ga0105239_10189721 3300010375 Bacteria 2301
32 Ga0105246_10052299 3300011119 Unclassified 2807
33 Ga0182008_10034008 3300014497 Bacteria 2556
34 Ga0213875_10000651 3300021388 Bacteria 27647
35 Ga0207707_10012339 3300025912 Bacteria 7426
36 Ga0207687_10354589 3300025927 Bacteria 1196
37 Ga0207709_10071080 3300025935 Bacteria 2209
38 Ga0207703_10438901 3300026035 Bacteria 1218
39 Ga0207708_10061219 3300026075 Bacteria 2874
40 Ga0207702_10083544 3300026078 Bacteria 2779
41 Ga0207675_100156824 3300026118 Archaea 2169
42 Ga0207675_100370092 3300026118 Bacteria 1407
43 Ga0207428_10289351 3300027907 Bacteria 1214
44 Ga0265337_1003191 3300028556 Bacteria 7199
45 Ga0265334_10005187 3300028573 Bacteria 5710
46 Ga0265336_10018921 3300028666 Bacteria 2226
47 Ga0265324_10004010 3300029957 Bacteria 6780
48 Ga0265320_10010206 3300031240 Bacteria 5608
49 Ga0265340_10003075 3300031247 Bacteria 9475
50 Ga0265331_10011943 3300031250 Bacteria 4734
51 Ga0265327_10022890 3300031251 Bacteria 3717
52 Ga0265316_10017437 3300031344 Bacteria 6207
53 Ga0265316_10040481 3300031344 Unclassified 3736
54 Ga0307408_100286051 3300031548 Unclassified 1375
55 Ga0316576_10082387 3300031727 Bacteria 2389
56 Ga0316578_10040027 3300031728 Unclassified 2708
57 Ga0316578_10045749 3300031728 Bacteria 2549
58 Ga0316578_10096638 3300031728 Bacteria 1769
59 Ga0307407_10029225 3300031903 Bacteria 2958
60 Ga0307407_10094839 3300031903 Unclassified 1838
61 Ga0307411_10220736 3300032005 Bacteria 1470
62 Ga0373953_0040491 3300035117 Unclassified 1851
63 Ga0373943_0034004 3300035170 Bacteria 2431
64 Ga0373946_0035508 3300035171 Bacteria 2018
65 Ga0316574_0027376 3300035398 Bacteria 3434
66 Ga0373927_0014102 3300035695 Bacteria 5299
67 Ga0316582_0028181 3300036647 Bacteria 3400
68 Ga0316582_0057547 3300036647 Bacteria 2484
69 Ga0316582_0089212 3300036647 Bacteria 2027
70 Ga0316584_0044898 3300036712 Bacteria 3297
71 Ga0316584_0046452 3300036712 Unclassified 3243
72 Ga0373925_0052627 3300037068 Bacteria 3042
73 Ga0436364_1423953 3300037853 Bacteria 39549
74 Ga0400490_14545 3300038726 Unclassified 1453
75 Ga0400483_012106 3300039062 Unclassified 1491
76 Ga0436361_0312446 3300039447 Bacteria 2239
77 Ga0436361_0658228 3300039447 Bacteria 1354
78 Ga0436362_0002132 3300039453 Bacteria 3033
79 Ga0436362_1166169 3300039453 Bacteria 1551
80 Ga0451577_0003705 3300042876 Bacteria 16707
81 Ga0451577_0007543 3300042876 Bacteria 10679
82 Ga0451577_0056987 3300042876 Bacteria 3484
83 Ga0451577_0075313 3300042876 Bacteria 3010
84 Ga0451577_0186332 3300042876 Bacteria 1872
85 Ga0451577_0203986 3300042876 Unclassified 1785
86 Ga0451577_0223854 3300042876 Bacteria 1701
87 Ga0451577_0258770 3300042876 Bacteria 1576
88 Ga0451577_0269532 3300042876 Bacteria 1542
89 Ga0451577_0281474 3300042876 Unclassified 1507
90 Ga0451577_0413956 3300042876 Bacteria 1224
91 Ga0453683_0000917 3300044673 Bacteria 28148
92 Ga0453683_0006836 3300044673 Bacteria 7788
93 Ga0453683_0012507 3300044673 Bacteria 5562
94 Ga0453683_0048311 3300044673 Unclassified 2669
95 Ga0453683_0075895 3300044673 Bacteria 2104
96 Ga0453683_0082312 3300044673 Unclassified 2017
97 Ga0453683_0093330 3300044673 Bacteria 1887
98 Ga0453684_0000012 3300044712 Bacteria 1062512
99 Ga0453684_0000232 3300044712 Bacteria 240951
100 Ga0453684_0000899 3300044712 Bacteria 99196
101 Ga0453684_0001229 3300044712 Bacteria 78474
102 Ga0453684_0001360 3300044712 Bacteria 71203
103 Ga0453684_0002251 3300044712 Bacteria 47800
104 Ga0453684_0005177 3300044712 Bacteria 26234
105 Ga0453684_0009696 3300044712 Bacteria 16761
106 Ga0453684_0014689 3300044712 Bacteria 12484
107 Ga0453684_0026083 3300044712 Bacteria 8459
108 Ga0453684_0036131 3300044712 Bacteria 6814
109 Ga0453684_0038972 3300044712 Bacteria 6483
110 Ga0453684_0041889 3300044712 Bacteria 6182
111 Ga0453684_0052415 3300044712 Bacteria 5336
112 Ga0453684_0063663 3300044712 Bacteria 4716
113 Ga0453684_0064360 3300044712 Unclassified 4685
114 Ga0453684_0146166 3300044712 Unclassified 2816
115 Ga0453684_0149743 3300044712 Bacteria 2775
116 Ga0453684_0152215 3300044712 Unclassified 2747
117 Ga0453684_0188264 3300044712 Bacteria 2416
118 Ga0453684_0198534 3300044712 Bacteria 2340
119 Ga0453684_0245857 3300044712 Bacteria 2057
120 Ga0453684_0277060 3300044712 Bacteria 1914
121 Ga0453684_0293634 3300044712 Bacteria 1850
122 Ga0453684_0332811 3300044712 Bacteria 1717
123 Ga0453684_0337028 3300044712 Unclassified 1704
124 Ga0453684_0430882 3300044712 Unclassified 1471
125 Ga0453684_0445437 3300044712 Unclassified 1442
126 Ga0453684_0604178 3300044712 Unclassified 1202
127 Ga0451576_0000509 3300045051 Bacteria 85219
128 Ga0451576_0000868 3300045051 Bacteria 58132
129 Ga0451576_0002676 3300045051 Bacteria 25949
130 Ga0451576_0019375 3300045051 Bacteria 7427
131 Ga0451576_0050219 3300045051 Unclassified 4374
132 Ga0451576_0064422 3300045051 Unclassified 3818
133 Ga0451576_0339541 3300045051 Bacteria 1572
134 Ga0451576_0535530 3300045051 Unclassified 1230
135 Ga0495592_0110365 3300046454 Unclassified 1947
136 Ga0495629_0002995 3300046459 Bacteria 12849
137 Ga0495580_0105829 3300046472 Bacteria 1954
138 Ga0495640_0119236 3300046533 Unclassified 1717
139 Ga0495667_0029714 3300046559 Unclassified 3678
140 Ga0495634_0031002 3300046642 Bacteria 3686
141 Ga0495635_0027169 3300046663 Bacteria 3982
142 Ga0495599_0036673 3300046678 Bacteria 3080
143 Ga0495600_0077508 3300046809 Bacteria 2170
144 Ga0495676_0239614 3300047321 Bacteria 1242
145 Ga0496106_0131848 3300048909 Unclassified 1961
146 Ga0496110_0347969 3300048913 Bacteria 1350
147 Ga0496113_0132193 3300048916 Bacteria 1959
148 Ga0496122_0009565 3300048925 Bacteria 10175
149 Ga0501076_0026503 3300049592 Bacteria 4491
150 Ga0501076_0161411 3300049592 Bacteria 1826
151 Ga0501081_0144385 3300049743 Unclassified 1707
152 Ga0501044_0022248 3300049823 Bacteria 6757
153 nmdc:mga0yw44_1381_c1 3300050492 Bacteria 9623
154 nmdc:mga05p37_12000_c1 3300050507 Bacteria 10340
155 nmdc:mga05p37_167315_c1 3300050507 Bacteria 2682
156 nmdc:mga05p37_45826_c1 3300050507 Bacteria 5378
157 nmdc:mga09592_44518_c1 3300050508 Bacteria 3737
158 nmdc:mga09592_92579_c1 3300050508 Bacteria 2584
159 nmdc:mga0qj67_154660_c1 3300050509 Unclassified 1861
160 nmdc:mga08y16_87550_c1 3300050511 Bacteria 3245
161 nmdc:mga0n895_111532_c1 3300050512 Bacteria 2751
162 nmdc:mga0n895_252998_c1 3300050512 Unclassified 1788
163 nmdc:mga08x19_21843_c1 3300050514 Bacteria 3955
164 nmdc:mga0a205_22912_c1 3300050515 Bacteria 5922
165 nmdc:mga0sz30_5310_c1 3300050516 Bacteria 4721
166 Ga0495601_0007914 3300053077 Bacteria 6261
167 Ga0495595_0011063 3300053084 Bacteria 3766
168 Ga0495619_0017667 3300053085 Bacteria 4518
169 Ga0500568_0019282 3300053139 Bacteria 2967
170 Ga0500604_0000125 3300053151 Bacteria 23468
171 Ga0501084_0228685 3300054114 Unclassified 1570
172 Ga0530510_0210155 3300061734 Bacteria 1446
173 2512037671 2511231221 Bacteria 6846400
174 8054006570 8054002106 Bacteria 7987183
175 Ga0500650_0000103
176 SwRhRL2b_contig_3726896
177 Ga0065704_10072310
178 Ga0065704_10112682
179 Ga0065707_10000519
180 Ga0065707_10001932
181 Ga0065707_10082940
182 Ga0070691_10029989
183 Ga0070700_100046379
184 Ga0070694_100288386
185 Ga0070681_10004255
186 Ga0070681_10218820
187 Ga0070698_100184660
188 Ga0068861_100392607
189 Ga0081540_1043138
190 Ga0081540_1051699
191 Ga0081539_10002894
192 Ga0075365_10002112
193 Ga0075369_10003422
194 Ga0075434_100211691
195 Ga0075429_100019792
196 Ga0075429_100048191
197 Ga0075429_100056840
198 Ga0111539_10102730
199 Ga0114129_10000389
200 Ga0114129_10005147
201 Ga0114129_10023031
202 Ga0114129_10279182
203 Ga0105249_10109735
204 Ga0099796_10000521
205 Ga0105239_10189721
206 Ga0105246_10052299
207 Ga0182008_10034008
208 Ga0213875_10000651
209 Ga0207707_10012339
210 Ga0207687_10354589
211 Ga0207709_10071080
212 Ga0207703_10438901
213 Ga0207708_10061219
214 Ga0207702_10083544
215 Ga0207675_100156824
216 Ga0207675_100370092
217 Ga0207428_10289351
218 Ga0265337_1003191
219 Ga0265334_10005187
220 Ga0265336_10018921
221 Ga0265324_10004010
222 Ga0265320_10010206
223 Ga0265340_10003075
224 Ga0265331_10011943
225 Ga0265327_10022890
226 Ga0265316_10017437
227 Ga0265316_10040481
228 Ga0307408_100286051
229 Ga0316576_10082387
230 Ga0316578_10040027
231 Ga0316578_10045749
232 Ga0316578_10096638
233 Ga0307407_10029225
234 Ga0307407_10094839
235 Ga0307411_10220736
236 Ga0373953_0040491
237 Ga0373943_0034004
238 Ga0373946_0035508
239 Ga0316574_0027376
240 Ga0373927_0014102
241 Ga0316582_0028181
242 Ga0316582_0057547
243 Ga0316582_0089212
244 Ga0316584_0044898
245 Ga0316584_0046452
246 Ga0373925_0052627
247 Ga0436364_1423953
248 Ga0400490_14545
249 Ga0400483_012106
250 Ga0436361_0312446
251 Ga0436361_0658228
252 Ga0436362_0002132
253 Ga0436362_1166169
254 Ga0451577_0003705
255 Ga0451577_0007543
256 Ga0451577_0056987
257 Ga0451577_0075313
258 Ga0451577_0186332
259 Ga0451577_0203986
260 Ga0451577_0223854
261 Ga0451577_0258770
262 Ga0451577_0269532
263 Ga0451577_0281474
264 Ga0451577_0413956
265 Ga0453683_0000917
266 Ga0453683_0006836
267 Ga0453683_0012507
268 Ga0453683_0048311
269 Ga0453683_0075895
270 Ga0453683_0082312
271 Ga0453683_0093330
272 Ga0453684_0000012
273 Ga0453684_0000232
274 Ga0453684_0000899
275 Ga0453684_0001229
276 Ga0453684_0001360
277 Ga0453684_0002251
278 Ga0453684_0005177
279 Ga0453684_0009696
280 Ga0453684_0014689
281 Ga0453684_0026083
282 Ga0453684_0036131
283 Ga0453684_0038972
284 Ga0453684_0041889
285 Ga0453684_0052415
286 Ga0453684_0063663
287 Ga0453684_0064360
288 Ga0453684_0146166
289 Ga0453684_0149743
290 Ga0453684_0152215
291 Ga0453684_0188264
292 Ga0453684_0198534
293 Ga0453684_0245857
294 Ga0453684_0277060
295 Ga0453684_0293634
296 Ga0453684_0332811
297 Ga0453684_0337028
298 Ga0453684_0430882
299 Ga0453684_0445437
300 Ga0453684_0604178
301 Ga0451576_0000509
302 Ga0451576_0000868
303 Ga0451576_0002676
304 Ga0451576_0019375
305 Ga0451576_0050219
306 Ga0451576_0064422
307 Ga0451576_0339541
308 Ga0451576_0535530
309 Ga0495592_0110365
310 Ga0495629_0002995
311 Ga0495580_0105829
312 Ga0495640_0119236
313 Ga0495667_0029714
314 Ga0495634_0031002
315 Ga0495635_0027169
316 Ga0495599_0036673
317 Ga0495600_0077508
318 Ga0495676_0239614
319 Ga0496106_0131848
320 Ga0496110_0347969
321 Ga0496113_0132193
322 Ga0496122_0009565
323 Ga0501076_0026503
324 Ga0501076_0161411
325 Ga0501081_0144385
326 Ga0501044_0022248
327 nmdc:mga0yw44_1381_c1
328 nmdc:mga05p37_12000_c1
329 nmdc:mga05p37_167315_c1
330 nmdc:mga05p37_45826_c1
331 nmdc:mga09592_44518_c1
332 nmdc:mga09592_92579_c1
333 nmdc:mga0qj67_154660_c1
334 nmdc:mga08y16_87550_c1
335 nmdc:mga0n895_111532_c1
336 nmdc:mga0n895_252998_c1
337 nmdc:mga08x19_21843_c1
338 nmdc:mga0a205_22912_c1
339 nmdc:mga0sz30_5310_c1
340 Ga0495601_0007914
341 Ga0495595_0011063
342 Ga0495619_0017667
343 Ga0500568_0019282
344 Ga0500604_0000125
345 Ga0501084_0228685
346 Ga0530510_0210155
347 2512037671
348 8054006570

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

31

195

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ekp-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.7784 1 318
5ekp-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.7768 1 317
5eke-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7734 1 317
5eke-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7725 1 318
5ekp-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.7615 1 318
ID Description Score Start End Superfamily
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8903 2 223 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8885 5 224 3.90.550.10
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8714 2 221 3.90.550.10
af_Q7XKE1_11_124_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8634 232 296 1.20.140.150
af_B4FD22_11_124_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8601 232 296 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A3D2J9K3-F1-model_v4 Glycosyltransferase 0.9891 1 104 GO:0005886
GO:0016757
AF-A0A849ES91-F1-model_v4 Glycosyltransferase family 2 protein 0.9664 1 224 GO:0005886
GO:0099621
AF-A0A1F7CWQ3-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9664 2 223 GO:0005886
GO:0016757
AF-A0A1G2VV75-F1-model_v4 Glycosyl transferase 0.9633 1 225 GO:0005886
GO:0099621
AF-A0A2V9L848-F1-model_v4 Glycosyltransferase 0.9629 2 224 GO:0005886
GO:0099621

Map