F264760

General Info

Members Datasets Scaffolds Average Seq Length
174 132 153 277

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10009293|Ga0265334_100092934
Length 303
Sequence VSRAAWCTSLPDRVAVIVPSERPDVGAVDRAPLPDLHALYAMPSDAAARFASDGHTLLPGLASAHEVSAYRPYLEAAAASSNRERRPISERDTYSAAFLQSFNLWRVNDACRRFVFSPRFAKAAADLLGVRGVRLYHDQALFKEPGGGHTPWHQDQFYWPFDTEKTITMWMPLADLDPRVGSMTFATGSHTSGKLRGHAISDESEEEFERLVRSEHLPEHTYGVIRAGDATFHAGWTLHRAGSNPTDRMRPVMTVIYFADGARVSEPDSVYQQFDLGVWLPGLRPGDVAATEINPLLWPVDPD

Samples

Sample ID Description Type Environment
1 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
2 2818991459 Paenibacillus sp. 597 Isolate Unclassified
3 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
4 2857472729 Cohnella sp. R-74144 Isolate Unclassified
5 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
6 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
7 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
8 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
9 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
10 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
11 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
12 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
67 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
111 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
128 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
129 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
130 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
131 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
132 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.36
Metatranscriptomes 0.57
Isolates 12.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.02
Nodule 0.57
Rhizoplane 2.3
Rhizosphere 85.63
Stem 0
Stem Tuber 0
Unclassified 7.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10044384 3300002067 Bacteria 1291
2 Ga0070666_10000275 3300005335 Bacteria 34059
3 Ga0070691_10000203 3300005341 Bacteria 19881
4 Ga0070667_100126949 3300005367 Bacteria 2223
5 Ga0070681_10145451 3300005458 Bacteria 2300
6 Ga0070695_100156797 3300005545 Bacteria 1594
7 Ga0070695_100161338 3300005545 Bacteria 1574
8 Ga0070693_100038283 3300005547 Bacteria 2679
9 Ga0070704_100019970 3300005549 Bacteria 4311
10 Ga0068855_100029615 3300005563 Bacteria 6543
11 Ga0068855_100064593 3300005563 Unclassified 4269
12 Ga0068855_100221295 3300005563 Unclassified 2122
13 Ga0068855_100298875 3300005563 Bacteria 1783
14 Ga0068857_100026843 3300005577 Bacteria 5078
15 Ga0068856_100043088 3300005614 Bacteria 4441
16 Ga0068852_100006155 3300005616 Bacteria 8656
17 Ga0068858_100197663 3300005842 Bacteria 1901
18 Ga0075365_10159887 3300006038 Bacteria 1569
19 Ga0075363_100004370 3300006048 Bacteria 6170
20 Ga0075364_10283046 3300006051 Bacteria 1128
21 Ga0070712_100000703 3300006175 Bacteria 19715
22 Ga0075431_100006176 3300006847 Bacteria 11890
23 Ga0075434_100017901 3300006871 Bacteria 6834
24 Ga0075434_100101857 3300006871 Bacteria 2879
25 Ga0068865_100175621 3300006881 Bacteria 1646
26 Ga0075436_100028231 3300006914 Bacteria 3860
27 Ga0075436_100136417 3300006914 Bacteria 1723
28 Ga0075435_100002269 3300007076 Bacteria 12701
29 Ga0105240_10018775 3300009093 Bacteria 9264
30 Ga0105245_10063598 3300009098 Bacteria 3332
31 Ga0105245_10359267 3300009098 Bacteria 1445
32 Ga0114129_10420981 3300009147 Bacteria 1757
33 Ga0105241_10357025 3300009174 Bacteria 1271
34 Ga0105242_10027059 3300009176 Bacteria 4549
35 Ga0105237_10000057 3300009545 Bacteria 149427
36 Ga0105237_10001801 3300009545 Bacteria 27675
37 Ga0105238_10004248 3300009551 Bacteria 14237
38 Ga0105246_10381767 3300011119 Bacteria 1164
39 Ga0157373_10011046 3300013100 Bacteria 6651
40 Ga0157370_10000832 3300013104 Bacteria 39082
41 Ga0157370_10049264 3300013104 Bacteria 4032
42 Ga0157374_10269375 3300013296 Unclassified 1679
43 Ga0157372_10085308 3300013307 Unclassified 3581
44 Ga0157372_10502771 3300013307 Bacteria 1413
45 Ga0157379_10000985 3300014968 Bacteria 23098
46 Ga0157379_10135545 3300014968 Bacteria 2218
47 Ga0206356_10317917 3300020070 Bacteria 1406
48 Ga0213873_10004159 3300021358 Bacteria 2676
49 Ga0213872_10000406 3300021361 Bacteria 35349
50 Ga0213872_10018346 3300021361 Bacteria 3228
51 Ga0209566_100259 3300025225 Bacteria 50462
52 Ga0207680_10000138 3300025903 Bacteria 34644
53 Ga0207707_10050242 3300025912 Bacteria 3632
54 Ga0207707_10154044 3300025912 Bacteria 2010
55 Ga0207671_10340334 3300025914 Bacteria 1189
56 Ga0207693_10000079 3300025915 Bacteria 86388
57 Ga0207687_10219214 3300025927 Bacteria 1497
58 Ga0207687_10497298 3300025927 Bacteria 1017
59 Ga0207686_10042708 3300025934 Bacteria 2773
60 Ga0207711_10242485 3300025941 Bacteria 1653
61 Ga0207667_10021192 3300025949 Bacteria 7206
62 Ga0207667_10032371 3300025949 Bacteria 5636
63 Ga0207667_10046221 3300025949 Bacteria 4610
64 Ga0207667_10140385 3300025949 Unclassified 2488
65 Ga0207658_10031124 3300025986 Bacteria 3786
66 Ga0207703_10064540 3300026035 Bacteria 3006
67 Ga0207708_10207983 3300026075 Bacteria 1563
68 Ga0207702_10024605 3300026078 Bacteria 4997
69 Ga0207702_10184135 3300026078 Bacteria 1925
70 Ga0207674_10001401 3300026116 Bacteria 31105
71 Ga0207698_10524361 3300026142 Bacteria 1157
72 Ga0265334_10009293 3300028573 Bacteria 4159
73 Ga0307515_10045893 3300028794 Bacteria 6696
74 Ga0265338_10002588 3300028800 Bacteria 26746
75 Ga0265338_10077869 3300028800 Bacteria 2800
76 Ga0265324_10090136 3300029957 Bacteria 1043
77 Ga0265325_10000326 3300031241 Bacteria 33654
78 Ga0265340_10130124 3300031247 Bacteria 1155
79 Ga0265327_10009786 3300031251 Bacteria 6855
80 Ga0265327_10026543 3300031251 Bacteria 3351
81 Ga0265313_10000383 3300031595 Bacteria 47643
82 Ga0265313_10050951 3300031595 Bacteria 1983
83 Ga0265314_10016857 3300031711 Bacteria 5757
84 Ga0265314_10106778 3300031711 Unclassified 1788
85 Ga0307409_100144015 3300031995 Bacteria 2058
86 Ga0307416_100662027 3300032002 Bacteria 1130
87 Ga0307414_10198480 3300032004 Bacteria 1630
88 Ga0307411_10034526 3300032005 Bacteria 3149
89 Ga0373931_0111143 3300035691 Bacteria 1555
90 Ga0373935_0195980 3300035692 Bacteria 1394
91 Ga0373937_0005483 3300036401 Bacteria 10870
92 Ga0373937_0151786 3300036401 Bacteria 2170
93 Ga0373937_0430595 3300036401 Bacteria 1252
94 Ga0373925_0049138 3300037068 Bacteria 3144
95 Ga0373925_0122159 3300037068 Bacteria 2023
96 Ga0395899_0067820 3300037312 Bacteria 2617
97 Ga0395899_0113457 3300037312 Unclassified 1946
98 Ga0395900_0004106 3300037418 Bacteria 15517
99 Ga0395900_0179332 3300037418 Unclassified 2153
100 Ga0395898_0173409 3300037466 Unclassified 2061
101 Ga0395898_0272089 3300037466 Bacteria 1615
102 Ga0395905_0024475 3300037471 Bacteria 5698
103 Ga0395905_0024704 3300037471 Bacteria 5670
104 Ga0395901_0077830 3300038443 Bacteria 3461
105 Ga0395901_0277099 3300038443 Bacteria 1743
106 Ga0436365_0544621 3300039437 Bacteria 2065
107 Ga0436361_0782964 3300039447 Bacteria 10446
108 Ga0436363_1497755 3300039450 Bacteria 1228
109 Ga0436362_0143891 3300039453 Unclassified 1594
110 Ga0436362_0550221 3300039453 Bacteria 7172
111 Ga0451577_0002484 3300042876 Bacteria 21919
112 Ga0453684_0029264 3300044712 Bacteria 7832
113 Ga0453684_0586213 3300044712 Bacteria 1224
114 Ga0466957_0051670 3300044842 Bacteria 2502
115 Ga0466959_0055618 3300045049 Bacteria 2888
116 Ga0466959_0105415 3300045049 Bacteria 2016
117 Ga0451576_0034043 3300045051 Bacteria 5412
118 Ga0495580_0236146 3300046472 Bacteria 1254
119 Ga0495580_0310475 3300046472 Bacteria 1073
120 Ga0495606_0072486 3300046507 Bacteria 2164
121 Ga0495630_0017617 3300046517 Bacteria 5236
122 Ga0495645_0300429 3300046543 Bacteria 1049
123 Ga0495624_0141268 3300046690 Bacteria 1475
124 Ga0495674_0391125 3300047319 Bacteria 1124
125 Ga0495672_0056301 3300047320 Bacteria 2289
126 Ga0495684_0325941 3300047471 Bacteria 1097
127 Ga0495686_0000965 3300047472 Bacteria 35434
128 Ga0496109_0000818 3300048912 Bacteria 25933
129 Ga0496110_0015875 3300048913 Bacteria 6279
130 Ga0496110_0519613 3300048913 Bacteria 1083
131 Ga0496112_0052081 3300048915 Bacteria 4017
132 Ga0501042_0258095 3300049578 Bacteria 1258
133 Ga0501068_0018219 3300049584 Bacteria 4067
134 Ga0501068_0253901 3300049584 Bacteria 1121
135 Ga0501069_0005633 3300049585 Bacteria 6517
136 Ga0501070_0000036 3300049586 Bacteria 124955
137 Ga0501071_0030331 3300049587 Bacteria 3824
138 Ga0501072_0254938 3300049588 Bacteria 1397
139 Ga0501076_0155765 3300049592 Bacteria 1860
140 Ga0501076_0304107 3300049592 Bacteria 1308
141 Ga0501080_0000675 3300049742 Bacteria 27217
142 Ga0501083_0080759 3300049744 Bacteria 2156
143 nmdc:mga03n38_32276_c1 3300050490 Bacteria 2217
144 nmdc:mga00v17_169491_c1 3300050491 Bacteria 1407
145 nmdc:mga05p37_380903_c1 3300050507 Bacteria 1653
146 nmdc:mga06r32_3646_c2 3300050510 Bacteria 7248
147 nmdc:mga08y16_226891_c1 3300050511 Bacteria 1932
148 nmdc:mga0n895_14383_c1 3300050512 Bacteria 7184
149 nmdc:mga0n895_263210_c1 3300050512 Bacteria 1750
150 nmdc:mga0rr50_2917_c1 3300050513 Bacteria 9760
151 nmdc:mga08x19_34529_c1 3300050514 Bacteria 3197
152 Ga0500616_0002688 3300053153 Bacteria 14461
153 Ga0501082_0177558 3300060353 Bacteria 1852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10009786 Ga0265327_100097867 245
2 iso_pu_bacteria 2929206907 2929207769 250
3 3300049584 Ga0501068_0018219 Ga0501068_0018219_1832_2605 256
4 3300060353 Ga0501082_0177558 Ga0501082_0177558_215_988 256
5 3300037312 Ga0395899_0067820 Ga0395899_0067820_1545_2345 266
6 iso_pu_bacteria 2910245624 2910246789 266
7 iso_pu_bacteria 8054795415 8054801243 266
8 3300048915 Ga0496112_0052081 Ga0496112_0052081_1237_2085 267
9 3300028794 Ga0307515_10045893 Ga0307515_100458933 268
10 3300042876 Ga0451577_0002484 Ga0451577_0002484_18123_18929 268
11 3300006871 Ga0075434_100101857 Ga0075434_1001018572 269
12 3300006914 Ga0075436_100136417 Ga0075436_1001364172 269
13 3300036401 Ga0373937_0151786 Ga0373937_0151786_1168_1977 269
14 3300049588 Ga0501072_0254938 Ga0501072_0254938_22_834 269
15 3300050512 nmdc:mga0n895_263210_c1 nmdc:mga0n895_263210_c1_715_1524 269
16 iso_pu_bacteria 8054280661 8054283704 269
17 3300005335 Ga0070666_10000275 Ga0070666_1000027531 270
18 3300005341 Ga0070691_10000203 Ga0070691_100002033 270
19 3300005367 Ga0070667_100126949 Ga0070667_1001269492 270
20 3300005545 Ga0070695_100161338 Ga0070695_1001613382 270
21 3300005563 Ga0068855_100298875 Ga0068855_1002988752 270
22 3300005577 Ga0068857_100026843 Ga0068857_1000268434 270
23 3300005616 Ga0068852_100006155 Ga0068852_10000615510 270
24 3300005842 Ga0068858_100197663 Ga0068858_1001976632 270
25 3300006914 Ga0075436_100028231 Ga0075436_1000282314 270
26 3300009093 Ga0105240_10018775 Ga0105240_100187756 270
27 3300009174 Ga0105241_10357025 Ga0105241_103570252 270
28 3300009545 Ga0105237_10001801 Ga0105237_100018012 270
29 3300009551 Ga0105238_10004248 Ga0105238_1000424810 270
30 3300013100 Ga0157373_10011046 Ga0157373_100110462 270
31 3300013104 Ga0157370_10000832 Ga0157370_100008329 270
32 3300013307 Ga0157372_10502771 Ga0157372_105027712 270
33 3300020070 Ga0206356_10317917 Ga0206356_103179172 270
34 3300021361 Ga0213872_10000406 Ga0213872_1000040632 270
35 3300021361 Ga0213872_10018346 Ga0213872_100183462 270
36 3300025903 Ga0207680_10000138 Ga0207680_100001386 270
37 3300025914 Ga0207671_10340334 Ga0207671_103403342 270
38 3300025941 Ga0207711_10242485 Ga0207711_102424852 270
39 3300025949 Ga0207667_10032371 Ga0207667_100323714 270
40 3300025986 Ga0207658_10031124 Ga0207658_100311243 270
41 3300026078 Ga0207702_10024605 Ga0207702_100246052 270
42 3300026116 Ga0207674_10001401 Ga0207674_100014019 270
43 3300029957 Ga0265324_10090136 Ga0265324_100901361 270
44 3300031251 Ga0265327_10026543 Ga0265327_100265433 270
45 3300031595 Ga0265313_10050951 Ga0265313_100509512 270
46 3300032004 Ga0307414_10198480 Ga0307414_101984802 270
47 3300032005 Ga0307411_10034526 Ga0307411_100345263 270
48 3300035691 Ga0373931_0111143 Ga0373931_0111143_619_1449 270
49 3300036401 Ga0373937_0005483 Ga0373937_0005483_2018_2863 270
50 3300036401 Ga0373937_0430595 Ga0373937_0430595_173_1003 270
51 3300039447 Ga0436361_0782964 Ga0436361_0782964_2707_3519 270
52 3300050514 nmdc:mga08x19_34529_c1 nmdc:mga08x19_34529_c1_1187_2011 270
53 iso_pu_bacteria 2857472729 2857476564 270
54 3300013104 Ga0157370_10049264 Ga0157370_100492645 271
55 3300046472 Ga0495580_0236146 Ga0495580_0236146_220_1035 271
56 3300049744 Ga0501083_0080759 Ga0501083_0080759_1009_1827 271
57 iso_pu_bacteria 2862290372 2862291882 271
58 3300005547 Ga0070693_100038283 Ga0070693_1000382832 272
59 3300005563 Ga0068855_100029615 Ga0068855_1000296154 272
60 3300005563 Ga0068855_100064593 Ga0068855_1000645933 272
61 3300006175 Ga0070712_100000703 Ga0070712_1000007032 272
62 3300014968 Ga0157379_10000985 Ga0157379_1000098510 272
63 3300014968 Ga0157379_10135545 Ga0157379_101355452 272
64 3300025915 Ga0207693_10000079 Ga0207693_1000007983 272
65 3300025949 Ga0207667_10046221 Ga0207667_100462212 272
66 3300025949 Ga0207667_10140385 Ga0207667_101403851 272
67 3300026035 Ga0207703_10064540 Ga0207703_100645402 272
68 3300026142 Ga0207698_10524361 Ga0207698_105243612 272
69 3300037068 Ga0373925_0049138 Ga0373925_0049138_879_1697 272
70 3300039450 Ga0436363_1497755 Ga0436363_1497755_183_1001 272
71 3300039453 Ga0436362_0143891 Ga0436362_0143891_112_936 272
72 3300046472 Ga0495580_0310475 Ga0495580_0310475_152_982 272
73 3300047320 Ga0495672_0056301 Ga0495672_0056301_513_1331 272
74 3300053153 Ga0500616_0002688 Ga0500616_0002688_13584_14402 272
75 iso_pu_bacteria 2857453340 2857455015 272
76 iso_pu_bacteria 8002317523 8002320073 272
77 iso_pu_bacteria 8046991243 8046998343 272
78 iso_pu_bacteria 8056533031 8056538981 272
79 3300046507 Ga0495606_0072486 Ga0495606_0072486_238_1059 273
80 3300047472 Ga0495686_0000965 Ga0495686_0000965_27377_28198 273
81 iso_pu_bacteria 2888578766 2888580276 273
82 iso_pu_bacteria 2888578766 2888580513 273
83 iso_pu_bacteria 2889049205 2889050833 273
84 iso_pu_bacteria 2889049205 2889054022 273
85 3300005563 Ga0068855_100221295 Ga0068855_1002212952 274
86 3300013307 Ga0157372_10085308 Ga0157372_100853083 274
87 3300025912 Ga0207707_10154044 Ga0207707_101540443 274
88 3300025949 Ga0207667_10021192 Ga0207667_100211925 274
89 3300049584 Ga0501068_0253901 Ga0501068_0253901_281_1108 274
90 3300049585 Ga0501069_0005633 Ga0501069_0005633_976_1803 274
91 3300049586 Ga0501070_0000036 Ga0501070_0000036_123727_124554 274
92 3300049587 Ga0501071_0030331 Ga0501071_0030331_2845_3672 274
93 3300049592 Ga0501076_0304107 Ga0501076_0304107_191_1015 274
94 3300049742 Ga0501080_0000675 Ga0501080_0000675_204_1031 274
95 iso_pu_bacteria 2904755435 2904758921 274
96 3300006048 Ga0075363_100004370 Ga0075363_1000043703 275
97 3300006051 Ga0075364_10283046 Ga0075364_102830461 275
98 3300045049 Ga0466959_0055618 Ga0466959_0055618_1952_2797 275
99 3300045049 Ga0466959_0105415 Ga0466959_0105415_159_998 275
100 3300050490 nmdc:mga03n38_32276_c1 nmdc:mga03n38_32276_c1_134_964 275
101 3300050491 nmdc:mga00v17_169491_c1 nmdc:mga00v17_169491_c1_370_1197 275
102 3300005549 Ga0070704_100019970 Ga0070704_1000199701 276
103 3300006871 Ga0075434_100017901 Ga0075434_1000179017 276
104 3300007076 Ga0075435_100002269 Ga0075435_1000022699 276
105 3300028800 Ga0265338_10077869 Ga0265338_100778691 276
106 3300031995 Ga0307409_100144015 Ga0307409_1001440152 276
107 3300032002 Ga0307416_100662027 Ga0307416_1006620271 276
108 3300037312 Ga0395899_0113457 Ga0395899_0113457_360_1199 276
109 3300037418 Ga0395900_0004106 Ga0395900_0004106_1055_1894 276
110 3300037418 Ga0395900_0179332 Ga0395900_0179332_539_1378 276
111 3300037466 Ga0395898_0173409 Ga0395898_0173409_835_1674 276
112 3300037466 Ga0395898_0272089 Ga0395898_0272089_436_1275 276
113 3300037471 Ga0395905_0024475 Ga0395905_0024475_4084_4923 276
114 3300037471 Ga0395905_0024704 Ga0395905_0024704_2129_2968 276
115 3300038443 Ga0395901_0077830 Ga0395901_0077830_1847_2686 276
116 3300038443 Ga0395901_0277099 Ga0395901_0277099_469_1308 276
117 3300044712 Ga0453684_0586213 Ga0453684_0586213_195_1052 276
118 3300045051 Ga0451576_0034043 Ga0451576_0034043_4148_4993 276
119 3300050512 nmdc:mga0n895_14383_c1 nmdc:mga0n895_14383_c1_1092_1931 276
120 3300050513 nmdc:mga0rr50_2917_c1 nmdc:mga0rr50_2917_c1_6387_7226 276
121 iso_pu_bacteria 2643221676 2644427878 276
122 iso_pu_bacteria 2818991459 2819672026 276
123 iso_pu_bacteria 2857453340 2857455955 276
124 iso_pu_bacteria 2919425241 2919426133 276
125 iso_pu_bacteria 2971410472 2971412027 276
126 iso_pu_bacteria 8056533031 8056535030 276
127 3300005545 Ga0070695_100156797 Ga0070695_1001567972 277
128 3300006847 Ga0075431_100006176 Ga0075431_1000061766 277
129 3300009098 Ga0105245_10063598 Ga0105245_100635983 277
130 3300009098 Ga0105245_10359267 Ga0105245_103592672 277
131 3300009147 Ga0114129_10420981 Ga0114129_104209812 277
132 3300009176 Ga0105242_10027059 Ga0105242_100270594 277
133 3300009545 Ga0105237_10000057 Ga0105237_1000005795 277
134 3300013296 Ga0157374_10269375 Ga0157374_102693752 277
135 3300025927 Ga0207687_10219214 Ga0207687_102192142 277
136 3300025934 Ga0207686_10042708 Ga0207686_100427082 277
137 3300031247 Ga0265340_10130124 Ga0265340_101301242 277
138 3300031711 Ga0265314_10016857 Ga0265314_100168577 277
139 3300035692 Ga0373935_0195980 Ga0373935_0195980_44_886 277
140 3300037068 Ga0373925_0122159 Ga0373925_0122159_141_983 277
141 3300044712 Ga0453684_0029264 Ga0453684_0029264_466_1356 277
142 3300046517 Ga0495630_0017617 Ga0495630_0017617_2024_2866 277
143 3300046543 Ga0495645_0300429 Ga0495645_0300429_70_912 277
144 3300046690 Ga0495624_0141268 Ga0495624_0141268_571_1413 277
145 3300047319 Ga0495674_0391125 Ga0495674_0391125_210_1052 277
146 3300047471 Ga0495684_0325941 Ga0495684_0325941_182_1024 277
147 3300048912 Ga0496109_0000818 Ga0496109_0000818_19336_20178 277
148 3300048913 Ga0496110_0015875 Ga0496110_0015875_1237_2079 277
149 3300048913 Ga0496110_0519613 Ga0496110_0519613_133_975 277
150 3300050507 nmdc:mga05p37_380903_c1 nmdc:mga05p37_380903_c1_365_1201 277
151 3300050510 nmdc:mga06r32_3646_c2 nmdc:mga06r32_3646_c2_6207_7043 277
152 3300002067 JGI24735J21928_10044384 JGI24735J21928_100443841 278
153 3300005458 Ga0070681_10145451 Ga0070681_101454512 278
154 3300005614 Ga0068856_100043088 Ga0068856_1000430882 278
155 3300006038 Ga0075365_10159887 Ga0075365_101598872 278
156 3300006881 Ga0068865_100175621 Ga0068865_1001756212 278
157 3300011119 Ga0105246_10381767 Ga0105246_103817672 278
158 3300021358 Ga0213873_10004159 Ga0213873_100041592 278
159 3300025225 Ga0209566_100259 Ga0209566_10025913 278
160 3300025912 Ga0207707_10050242 Ga0207707_100502422 278
161 3300025927 Ga0207687_10497298 Ga0207687_104972981 278
162 3300026075 Ga0207708_10207983 Ga0207708_102079832 278
163 3300026078 Ga0207702_10184135 Ga0207702_101841352 278
164 3300028573 Ga0265334_10009293 Ga0265334_100092934 278
165 3300028800 Ga0265338_10002588 Ga0265338_1000258813 278
166 3300031241 Ga0265325_10000326 Ga0265325_1000032626 278
167 3300031595 Ga0265313_10000383 Ga0265313_1000038335 278
168 3300031711 Ga0265314_10106778 Ga0265314_101067782 278
169 3300039437 Ga0436365_0544621 Ga0436365_0544621_618_1463 278
170 3300039453 Ga0436362_0550221 Ga0436362_0550221_649_1491 278
171 3300044842 Ga0466957_0051670 Ga0466957_0051670_96_974 278
172 3300049578 Ga0501042_0258095 Ga0501042_0258095_146_997 278
173 3300049592 Ga0501076_0155765 Ga0501076_0155765_942_1793 278
174 3300050511 nmdc:mga08y16_226891_c1 nmdc:mga08y16_226891_c1_434_1276 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05721

PhyH

Phytanoyl-CoA dioxygenase (PhyH)

50

252

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ep9-assembly4.cif.gz_D crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.859 22 274
5ep9-assembly3.cif.gz_C crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.8533 22 274
5epa-assembly6.cif.gz_F crystal structure of non-heme alpha ketoglutarate dependent carbocyclase snok from nogalamycin biosynthesis 0.8385 15 273
5epa-assembly1.cif.gz_A crystal structure of non-heme alpha ketoglutarate dependent carbocyclase snok from nogalamycin biosynthesis 0.8352 15 273
5ep9-assembly4.cif.gz_D crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.8321 22 274
ID Description Score Start End Superfamily
5ep9C00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8533 22 274 2.60.120.620
5epaF00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8385 15 273 2.60.120.620
5ep9C00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8263 22 274 2.60.120.620
5epaF00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8261 15 273 2.60.120.620
af_Q4DSV6_209_433_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8065 78 273 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A7V1WAM7-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9963 46 278 GO:0046872
GO:0051213
AF-F4L0K7-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9957 9 273 GO:0051213
AF-A0A136KX43-F1-model_v4 Protein involved in biosynthesis of mitomycin antibiotics/polyketide fumonisin 0.995 48 277
AF-A0A3N7HA42-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9932 7 274 GO:0051213
AF-A0A4Q3DEH3-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.993 58 274 GO:0051213

Feature Viewer

pLDDT pTM Quality
94.82 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map