F264758

General Info

Members Datasets Scaffolds Average Seq Length
174 96 173 230

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1000665|Ga0265319_100066515
Length 256
Sequence MAGRRQSSRNQILVSPSLSSPSSLLPSPGGSPDLALRCEELHRYLGAGEGRVHVLRGVSFAARPGQVTAIVGPSGCGKSTLLYLLGLLDQPDGGAIWIRDRLMSNSSDLDRTAARCEHIGFVFQFHFLMLEFSALDNVMMPMRKLGRLTEAQMADRARALLGDVGLGDKTHRLATHLSGGEQQRVAVARALANQPAIILADEPTGNLDVRNSTIVFDLLTRLAKENGQAVVLVTHNPDIAKRCDEIKPMRDGEFVP

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
27 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
28 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
43 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
44 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
45 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
46 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
47 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
48 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
51 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
52 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
53 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
74 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
81 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
82 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
83 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
91 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
92 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
95 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
96 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 0.57
Rhizosphere 94.83
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10008628 3300003320 Bacteria 7057
2 rootH1_10008644 3300003323 Bacteria 13887
3 rootH1_10031345 3300003323 Bacteria 8779
4 rootH1_10141502 3300003323 Bacteria 7109
5 Ga0070658_10000041 3300005327 Bacteria 134208
6 Ga0070683_100002455 3300005329 Bacteria 14752
7 Ga0068869_100000010 3300005334 Bacteria 76243
8 Ga0070680_100078819 3300005336 Bacteria 2714
9 Ga0068868_100008114 3300005338 Bacteria 7511
10 Ga0070691_10034914 3300005341 Bacteria 2368
11 Ga0070659_100132579 3300005366 Bacteria 2024
12 Ga0068867_100000301 3300005459 Bacteria 32487
13 Ga0070679_100008039 3300005530 Bacteria 9911
14 Ga0070679_100014434 3300005530 Bacteria 7586
15 Ga0070684_100048078 3300005535 Bacteria 3700
16 Ga0068855_100009584 3300005563 Bacteria 11685
17 Ga0068857_100012238 3300005577 Bacteria 7464
18 Ga0068856_100000714 3300005614 Bacteria 36072
19 Ga0070717_10000016 3300006028 Bacteria 205932
20 Ga0097621_100044276 3300006237 Bacteria 3591
21 Ga0068871_100003817 3300006358 Bacteria 10389
22 Ga0068865_100001675 3300006881 Bacteria 12976
23 Ga0105240_10108220 3300009093 Bacteria 3368
24 Ga0105240_10737676 3300009093 Bacteria 1072
25 Ga0105237_10002254 3300009545 Bacteria 24008
26 Ga0157370_10162780 3300013104 Bacteria 2076
27 Ga0157369_10602138 3300013105 Bacteria 1134
28 Ga0157374_10538180 3300013296 Unclassified 1175
29 Ga0157376_10434073 3300014969 Bacteria 1277
30 Ga0213872_10004592 3300021361 Bacteria 7294
31 Ga0207705_10000068 3300025909 Bacteria 134316
32 Ga0207695_10913944 3300025913 Bacteria 757
33 Ga0207671_10003579 3300025914 Bacteria 15380
34 Ga0207671_10539055 3300025914 Bacteria 930
35 Ga0207660_10113193 3300025917 Bacteria 2045
36 Ga0207652_10005776 3300025921 Bacteria 10039
37 Ga0207652_10066839 3300025921 Bacteria 3117
38 Ga0207700_10020059 3300025928 Bacteria 4530
39 Ga0207704_10005783 3300025938 Bacteria 5718
40 Ga0207689_10000039 3300025942 Bacteria 93515
41 Ga0207661_10015603 3300025944 Bacteria 5595
42 Ga0207667_10012376 3300025949 Bacteria 9835
43 Ga0207677_10011703 3300026023 Bacteria 5010
44 Ga0207702_10002459 3300026078 Bacteria 17542
45 Ga0207648_10002565 3300026089 Bacteria 19471
46 Ga0207674_10011640 3300026116 Bacteria 9879
47 Ga0265337_1009470 3300028556 Bacteria 3474
48 Ga0265319_1000665 3300028563 Bacteria 22578
49 Ga0265319_1001980 3300028563 Bacteria 11551
50 Ga0265319_1004152 3300028563 Bacteria 7264
51 Ga0265319_1004281 3300028563 Bacteria 7106
52 Ga0265319_1005493 3300028563 Bacteria 6063
53 Ga0265319_1006171 3300028563 Bacteria 5593
54 Ga0265319_1006976 3300028563 Bacteria 5147
55 Ga0265319_1008048 3300028563 Bacteria 4661
56 Ga0265334_10010697 3300028573 Bacteria 3871
57 Ga0265318_10000548 3300028577 Bacteria 26669
58 Ga0265318_10000958 3300028577 Bacteria 18520
59 Ga0265318_10001547 3300028577 Bacteria 13394
60 Ga0265318_10136475 3300028577 Bacteria 901
61 Ga0265323_10019793 3300028653 Bacteria 2594
62 Ga0265323_10021578 3300028653 Bacteria 2467
63 Ga0265323_10027787 3300028653 Bacteria 2123
64 Ga0265323_10049606 3300028653 Bacteria 1494
65 Ga0265322_10018276 3300028654 Bacteria 2016
66 Ga0265322_10051839 3300028654 Bacteria 1165
67 Ga0265336_10019936 3300028666 Bacteria 2158
68 Ga0265336_10023549 3300028666 Bacteria 1952
69 Ga0265338_10043179 3300028800 Bacteria 4185
70 Ga0265338_10062391 3300028800 Bacteria 3257
71 Ga0265338_10199664 3300028800 Bacteria 1509
72 Ga0265324_10027441 3300029957 Bacteria 2011
73 Ga0265324_10032568 3300029957 Bacteria 1820
74 Ga0265324_10037834 3300029957 Bacteria 1676
75 Ga0265324_10047650 3300029957 Bacteria 1474
76 Ga0265330_10027925 3300031235 Bacteria 2547
77 Ga0265330_10113471 3300031235 Bacteria 1156
78 Ga0265330_10116574 3300031235 Bacteria 1139
79 Ga0265320_10000996 3300031240 Bacteria 21016
80 Ga0265320_10001746 3300031240 Bacteria 15409
81 Ga0265320_10001816 3300031240 Bacteria 15138
82 Ga0265320_10005106 3300031240 Bacteria 8480
83 Ga0265320_10017134 3300031240 Bacteria 4033
84 Ga0265320_10020187 3300031240 Bacteria 3620
85 Ga0265320_10040054 3300031240 Bacteria 2339
86 Ga0265320_10056009 3300031240 Bacteria 1896
87 Ga0265320_10102811 3300031240 Bacteria 1315
88 Ga0265320_10219370 3300031240 Bacteria 847
89 Ga0265325_10008187 3300031241 Bacteria 6193
90 Ga0265325_10149840 3300031241 Bacteria 1104
91 Ga0265339_10039623 3300031249 Bacteria 2622
92 Ga0265339_10044891 3300031249 Bacteria 2435
93 Ga0265331_10005944 3300031250 Bacteria 7287
94 Ga0265331_10020709 3300031250 Bacteria 3372
95 Ga0265331_10209527 3300031250 Bacteria 877
96 Ga0265327_10000063 3300031251 Bacteria 232763
97 Ga0265327_10003018 3300031251 Bacteria 16684
98 Ga0265327_10014508 3300031251 Bacteria 5150
99 Ga0265327_10208069 3300031251 Unclassified 884
100 Ga0265316_10000485 3300031344 Bacteria 45047
101 Ga0265316_10111314 3300031344 Bacteria 2073
102 Ga0265316_10147582 3300031344 Bacteria 1763
103 Ga0265316_10389212 3300031344 Bacteria 1005
104 Ga0265316_10400902 3300031344 Bacteria 988
105 Ga0265316_10408422 3300031344 Bacteria 977
106 Ga0307408_100000011 3300031548 Bacteria 414737
107 Ga0265313_10000973 3300031595 Bacteria 28336
108 Ga0265313_10006306 3300031595 Bacteria 8446
109 Ga0265313_10010830 3300031595 Bacteria 5727
110 Ga0265313_10013198 3300031595 Bacteria 4976
111 Ga0265313_10034927 3300031595 Bacteria 2536
112 Ga0265313_10088112 3300031595 Bacteria 1398
113 Ga0265313_10142629 3300031595 Bacteria 1029
114 Ga0307508_10000229 3300031616 Bacteria 68303
115 Ga0265314_10010949 3300031711 Bacteria 7528
116 Ga0265314_10027836 3300031711 Bacteria 4225
117 Ga0265314_10032692 3300031711 Bacteria 3823
118 Ga0265314_10033759 3300031711 Bacteria 3745
119 Ga0265314_10120888 3300031711 Bacteria 1649
120 Ga0265314_10285643 3300031711 Bacteria 931
121 Ga0265342_10008212 3300031712 Bacteria 7520
122 Ga0265342_10201986 3300031712 Bacteria 1079
123 Ga0265342_10368177 3300031712 Bacteria 746
124 Ga0307410_10000004 3300031852 Bacteria 120355
125 Ga0307407_10002163 3300031903 Bacteria 7561
126 Ga0307407_10228812 3300031903 Bacteria 1261
127 Ga0307409_100000058 3300031995 Bacteria 39990
128 Ga0307416_100000035 3300032002 Bacteria 144188
129 Ga0307411_10034239 3300032005 Bacteria 3159
130 Ga0395899_0081824 3300037312 Bacteria 2349
131 Ga0395900_0000314 3300037418 Bacteria 71758
132 Ga0395900_0009528 3300037418 Bacteria 9958
133 Ga0395900_0659976 3300037418 Bacteria 982
134 Ga0395898_0359679 3300037466 Bacteria 1388
135 Ga0395905_0000026 3300037471 Bacteria 315051
136 Ga0395905_0000477 3300037471 Bacteria 55299
137 Ga0395901_0056551 3300038443 Bacteria 4081
138 Ga0436361_0273501 3300039447 Bacteria 22249
139 Ga0451797_0852051 3300041453 Bacteria 854
140 Ga0451577_0000167 3300042876 Bacteria 144675
141 Ga0451577_0378751 3300042876 Bacteria 1284
142 Ga0451577_0560001 3300042876 Bacteria 1038
143 Ga0453684_0037211 3300044712 Bacteria 6683
144 Ga0453684_0231315 3300044712 Bacteria 2134
145 Ga0466971_0036639 3300044719 Bacteria 2200
146 Ga0451576_0016212 3300045051 Bacteria 8229
147 Ga0451576_0079145 3300045051 Bacteria 3420
148 Ga0451576_0082999 3300045051 Bacteria 3334
149 Ga0466967_0024689 3300045976 Bacteria 4946
150 Ga0495583_0181137 3300046506 Unclassified 862
151 Ga0495687_022395 3300047443 Bacteria 3033
152 Ga0495677_0001635 3300047445 Bacteria 9007
153 Ga0501032_0000259 3300049569 Bacteria 44300
154 Ga0501033_0054955 3300049570 Bacteria 2944
155 Ga0501034_0696851 3300049571 Bacteria 914
156 Ga0501038_0351881 3300049574 Bacteria 1147
157 Ga0501046_0001857 3300049580 Bacteria 20108
158 Ga0501046_0004029 3300049580 Bacteria 13408
159 Ga0501046_0039817 3300049580 Bacteria 3760
160 Ga0501047_0015515 3300049581 Bacteria 7258
161 Ga0501047_0051858 3300049581 Bacteria 3965
162 Ga0501048_0051278 3300049582 Bacteria 2938
163 Ga0501243_000069 3300049675 Bacteria 10232
164 Ga0501083_0000237 3300049744 Bacteria 35480
165 Ga0501035_0000828 3300049822 Bacteria 33006
166 Ga0501035_0024973 3300049822 Bacteria 5480
167 Ga0501035_0391141 3300049822 Bacteria 1158
168 Ga0501044_0000358 3300049823 Bacteria 57147
169 Ga0501044_0004865 3300049823 Bacteria 15012
170 Ga0501044_0039962 3300049823 Bacteria 4891
171 Ga0500608_000702 3300053122 Bacteria 12271
172 Ga0500568_0070635 3300053139 Bacteria 1337
173 Ga0466962_0157852 3300061719 Bacteria 1102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046506 Ga0495583_0181137 Ga0495583_0181137_12_596 184
2 3300031240 Ga0265320_10017134 Ga0265320_100171344 204
3 3300031616 Ga0307508_10000229 Ga0307508_1000022913 204
4 3300049675 Ga0501243_000069 Ga0501243_000069_8003_8647 214
5 3300049571 Ga0501034_0696851 Ga0501034_0696851_243_893 215
6 3300031251 Ga0265327_10000063 Ga0265327_100000634 221
7 3300047443 Ga0495687_022395 Ga0495687_022395_1149_1847 222
8 3300047445 Ga0495677_0001635 Ga0495677_0001635_4444_5142 222
9 3300005327 Ga0070658_10000041 Ga0070658_10000041119 223
10 3300005366 Ga0070659_100132579 Ga0070659_1001325792 223
11 3300005563 Ga0068855_100009584 Ga0068855_1000095846 223
12 3300009093 Ga0105240_10108220 Ga0105240_101082202 223
13 3300009093 Ga0105240_10737676 Ga0105240_107376762 223
14 3300009545 Ga0105237_10002254 Ga0105237_100022545 223
15 3300013296 Ga0157374_10538180 Ga0157374_105381802 223
16 3300021361 Ga0213872_10004592 Ga0213872_100045924 223
17 3300025909 Ga0207705_10000068 Ga0207705_100000685 223
18 3300025913 Ga0207695_10913944 Ga0207695_109139441 223
19 3300025914 Ga0207671_10003579 Ga0207671_100035795 223
20 3300025914 Ga0207671_10539055 Ga0207671_105390551 223
21 3300025949 Ga0207667_10012376 Ga0207667_100123765 223
22 3300031251 Ga0265327_10208069 Ga0265327_102080691 223
23 3300037418 Ga0395900_0000314 Ga0395900_0000314_49450_50121 223
24 3300037418 Ga0395900_0659976 Ga0395900_0659976_70_741 223
25 3300039447 Ga0436361_0273501 Ga0436361_0273501_2624_3313 223
26 3300041453 Ga0451797_0852051 Ga0451797_0852051_151_834 223
27 3300053122 Ga0500608_000702 Ga0500608_000702_3559_4233 223
28 3300005336 Ga0070680_100078819 Ga0070680_1000788192 224
29 3300005341 Ga0070691_10034914 Ga0070691_100349142 224
30 3300005530 Ga0070679_100014434 Ga0070679_1000144342 224
31 3300013104 Ga0157370_10162780 Ga0157370_101627802 224
32 3300025917 Ga0207660_10113193 Ga0207660_101131932 224
33 3300025921 Ga0207652_10066839 Ga0207652_100668393 224
34 3300031241 Ga0265325_10008187 Ga0265325_100081873 224
35 3300031249 Ga0265339_10039623 Ga0265339_100396232 224
36 3300031344 Ga0265316_10400902 Ga0265316_104009021 224
37 3300031595 Ga0265313_10034927 Ga0265313_100349272 224
38 3300037312 Ga0395899_0081824 Ga0395899_0081824_554_1234 224
39 3300037418 Ga0395900_0009528 Ga0395900_0009528_4932_5612 224
40 3300037466 Ga0395898_0359679 Ga0395898_0359679_529_1209 224
41 3300037471 Ga0395905_0000477 Ga0395905_0000477_3722_4402 224
42 3300038443 Ga0395901_0056551 Ga0395901_0056551_1912_2592 224
43 iso_pu_bacteria 2786546940 2788435045 225
44 3300028653 Ga0265323_10027787 Ga0265323_100277872 226
45 3300031344 Ga0265316_10389212 Ga0265316_103892122 226
46 3300003323 rootH1_10031345 rootH1_100313455 228
47 3300005334 Ga0068869_100000010 Ga0068869_10000001045 228
48 3300005338 Ga0068868_100008114 Ga0068868_1000081145 228
49 3300005459 Ga0068867_100000301 Ga0068867_10000030118 228
50 3300006237 Ga0097621_100044276 Ga0097621_1000442763 228
51 3300006358 Ga0068871_100003817 Ga0068871_1000038175 228
52 3300006881 Ga0068865_100001675 Ga0068865_1000016753 228
53 3300025938 Ga0207704_10005783 Ga0207704_100057833 228
54 3300025942 Ga0207689_10000039 Ga0207689_1000003945 228
55 3300026023 Ga0207677_10011703 Ga0207677_100117034 228
56 3300026089 Ga0207648_10002565 Ga0207648_1000256514 228
57 3300028577 Ga0265318_10000958 Ga0265318_1000095816 228
58 3300028577 Ga0265318_10001547 Ga0265318_1000154710 228
59 3300028577 Ga0265318_10136475 Ga0265318_101364751 228
60 3300028666 Ga0265336_10019936 Ga0265336_100199361 228
61 3300028800 Ga0265338_10043179 Ga0265338_100431792 228
62 3300028800 Ga0265338_10062391 Ga0265338_100623912 228
63 3300028800 Ga0265338_10199664 Ga0265338_101996642 228
64 3300029957 Ga0265324_10032568 Ga0265324_100325682 228
65 3300029957 Ga0265324_10037834 Ga0265324_100378342 228
66 3300031240 Ga0265320_10000996 Ga0265320_1000099612 228
67 3300031240 Ga0265320_10001816 Ga0265320_100018164 228
68 3300031250 Ga0265331_10209527 Ga0265331_102095272 228
69 3300031251 Ga0265327_10014508 Ga0265327_100145083 228
70 3300031344 Ga0265316_10111314 Ga0265316_101113142 228
71 3300031548 Ga0307408_100000011 Ga0307408_10000001149 228
72 3300031595 Ga0265313_10000973 Ga0265313_1000097320 228
73 3300031595 Ga0265313_10088112 Ga0265313_100881122 228
74 3300031595 Ga0265313_10142629 Ga0265313_101426291 228
75 3300031711 Ga0265314_10027836 Ga0265314_100278363 228
76 3300031712 Ga0265342_10201986 Ga0265342_102019861 228
77 3300031712 Ga0265342_10368177 Ga0265342_103681771 228
78 3300031852 Ga0307410_10000004 Ga0307410_10000004101 228
79 3300031903 Ga0307407_10002163 Ga0307407_100021636 228
80 3300031903 Ga0307407_10228812 Ga0307407_102288122 228
81 3300031995 Ga0307409_100000058 Ga0307409_10000005822 228
82 3300032002 Ga0307416_100000035 Ga0307416_10000003536 228
83 3300032005 Ga0307411_10034239 Ga0307411_100342391 228
84 3300037471 Ga0395905_0000026 Ga0395905_0000026_59180_59866 228
85 3300042876 Ga0451577_0378751 Ga0451577_0378751_302_991 228
86 3300042876 Ga0451577_0560001 Ga0451577_0560001_71_757 228
87 3300049570 Ga0501033_0054955 Ga0501033_0054955_559_1245 228
88 3300049574 Ga0501038_0351881 Ga0501038_0351881_136_822 228
89 3300049580 Ga0501046_0001857 Ga0501046_0001857_10726_11412 228
90 3300049580 Ga0501046_0039817 Ga0501046_0039817_2947_3633 228
91 3300049581 Ga0501047_0015515 Ga0501047_0015515_602_1288 228
92 3300049581 Ga0501047_0051858 Ga0501047_0051858_655_1341 228
93 3300049582 Ga0501048_0051278 Ga0501048_0051278_2054_2740 228
94 3300049822 Ga0501035_0024973 Ga0501035_0024973_404_1090 228
95 3300049822 Ga0501035_0391141 Ga0501035_0391141_240_926 228
96 3300049823 Ga0501044_0004865 Ga0501044_0004865_982_1668 228
97 3300003320 rootH2_10008628 rootH2_100086285 229
98 3300003323 rootH1_10008644 rootH1_100086444 229
99 3300003323 rootH1_10141502 rootH1_101415023 229
100 3300005329 Ga0070683_100002455 Ga0070683_1000024554 229
101 3300005530 Ga0070679_100008039 Ga0070679_1000080394 229
102 3300005535 Ga0070684_100048078 Ga0070684_1000480784 229
103 3300005577 Ga0068857_100012238 Ga0068857_1000122384 229
104 3300005614 Ga0068856_100000714 Ga0068856_10000071431 229
105 3300006028 Ga0070717_10000016 Ga0070717_1000001657 229
106 3300013105 Ga0157369_10602138 Ga0157369_106021382 229
107 3300014969 Ga0157376_10434073 Ga0157376_104340731 229
108 3300025921 Ga0207652_10005776 Ga0207652_100057764 229
109 3300025928 Ga0207700_10020059 Ga0207700_100200592 229
110 3300025944 Ga0207661_10015603 Ga0207661_100156034 229
111 3300026078 Ga0207702_10002459 Ga0207702_1000245912 229
112 3300026116 Ga0207674_10011640 Ga0207674_100116404 229
113 3300028556 Ga0265337_1009470 Ga0265337_10094702 229
114 3300028563 Ga0265319_1000665 Ga0265319_100066515 229
115 3300028563 Ga0265319_1001980 Ga0265319_10019803 229
116 3300028563 Ga0265319_1004152 Ga0265319_10041523 229
117 3300028563 Ga0265319_1004281 Ga0265319_10042811 229
118 3300028563 Ga0265319_1005493 Ga0265319_10054934 229
119 3300028563 Ga0265319_1006171 Ga0265319_10061712 229
120 3300028563 Ga0265319_1006976 Ga0265319_10069763 229
121 3300028563 Ga0265319_1008048 Ga0265319_10080482 229
122 3300028573 Ga0265334_10010697 Ga0265334_100106972 229
123 3300028577 Ga0265318_10000548 Ga0265318_100005489 229
124 3300028653 Ga0265323_10019793 Ga0265323_100197932 229
125 3300028653 Ga0265323_10021578 Ga0265323_100215783 229
126 3300028653 Ga0265323_10049606 Ga0265323_100496061 229
127 3300028654 Ga0265322_10018276 Ga0265322_100182761 229
128 3300028654 Ga0265322_10051839 Ga0265322_100518392 229
129 3300028666 Ga0265336_10023549 Ga0265336_100235492 229
130 3300029957 Ga0265324_10027441 Ga0265324_100274412 229
131 3300029957 Ga0265324_10047650 Ga0265324_100476502 229
132 3300031235 Ga0265330_10027925 Ga0265330_100279252 229
133 3300031235 Ga0265330_10113471 Ga0265330_101134712 229
134 3300031235 Ga0265330_10116574 Ga0265330_101165741 229
135 3300031240 Ga0265320_10001746 Ga0265320_100017466 229
136 3300031240 Ga0265320_10005106 Ga0265320_100051061 229
137 3300031240 Ga0265320_10020187 Ga0265320_100201872 229
138 3300031240 Ga0265320_10040054 Ga0265320_100400542 229
139 3300031240 Ga0265320_10056009 Ga0265320_100560092 229
140 3300031240 Ga0265320_10102811 Ga0265320_101028112 229
141 3300031240 Ga0265320_10219370 Ga0265320_102193702 229
142 3300031241 Ga0265325_10149840 Ga0265325_101498402 229
143 3300031249 Ga0265339_10044891 Ga0265339_100448912 229
144 3300031250 Ga0265331_10005944 Ga0265331_100059442 229
145 3300031250 Ga0265331_10020709 Ga0265331_100207094 229
146 3300031251 Ga0265327_10003018 Ga0265327_1000301814 229
147 3300031344 Ga0265316_10000485 Ga0265316_100004852 229
148 3300031344 Ga0265316_10147582 Ga0265316_101475822 229
149 3300031344 Ga0265316_10408422 Ga0265316_104084221 229
150 3300031595 Ga0265313_10006306 Ga0265313_100063063 229
151 3300031595 Ga0265313_10010830 Ga0265313_100108305 229
152 3300031595 Ga0265313_10013198 Ga0265313_100131984 229
153 3300031711 Ga0265314_10010949 Ga0265314_100109492 229
154 3300031711 Ga0265314_10032692 Ga0265314_100326922 229
155 3300031711 Ga0265314_10033759 Ga0265314_100337594 229
156 3300031711 Ga0265314_10120888 Ga0265314_101208882 229
157 3300031711 Ga0265314_10285643 Ga0265314_102856431 229
158 3300031712 Ga0265342_10008212 Ga0265342_100082124 229
159 3300042876 Ga0451577_0000167 Ga0451577_0000167_61254_61946 229
160 3300044712 Ga0453684_0037211 Ga0453684_0037211_3853_4551 229
161 3300044712 Ga0453684_0231315 Ga0453684_0231315_294_986 229
162 3300044719 Ga0466971_0036639 Ga0466971_0036639_1257_1976 229
163 3300045051 Ga0451576_0016212 Ga0451576_0016212_22_714 229
164 3300045051 Ga0451576_0079145 Ga0451576_0079145_1265_1963 229
165 3300045051 Ga0451576_0082999 Ga0451576_0082999_299_1012 229
166 3300045976 Ga0466967_0024689 Ga0466967_0024689_4145_4864 229
167 3300049569 Ga0501032_0000259 Ga0501032_0000259_42936_43628 229
168 3300049580 Ga0501046_0004029 Ga0501046_0004029_822_1514 229
169 3300049744 Ga0501083_0000237 Ga0501083_0000237_17098_17805 229
170 3300049822 Ga0501035_0000828 Ga0501035_0000828_23534_24226 229
171 3300049823 Ga0501044_0000358 Ga0501044_0000358_9248_9940 229
172 3300049823 Ga0501044_0039962 Ga0501044_0039962_2701_3411 229
173 3300053139 Ga0500568_0070635 Ga0500568_0070635_276_983 229
174 3300061719 Ga0466962_0157852 Ga0466962_0157852_202_921 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

55

205

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.9621 8 229
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9609 8 229
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9602 8 229
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9512 10 228
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9486 9 229
ID Description Score Start End Superfamily
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9684 38 229 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9634 9 229 3.40.50.300
af_Q2FVR1_1_221_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9604 9 229 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9602 8 229 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9594 8 228 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6L3ZZ40-F1-model_v4 ABC transporter ATP-binding protein 0.973 39 229 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A2D4VMT8-F1-model_v4 ABC transporter 0.971 8 229 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0044874
GO:0089705
AF-Q7V2N9-F1-model_v4 Possible ABC transporter, ATP binding protein 0.9705 6 229 GO:0005524
GO:0016887
AF-A0A2G1UQ51-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9688 7 229 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A436W3Z4-F1-model_v4 ABC transporter ATP-binding protein 0.9685 105 214 GO:0005524
GO:0016887
GO:0022857
GO:0043190

Feature Viewer

pLDDT pTM Quality
91.28 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map