F264154

General Info

Members Datasets Scaffolds Average Seq Length
174 117 348 271

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100220406|Ga0070696_1002204061
Length 299
Sequence VSRIVYRNVSDLKGFSLKNCPSMPDPTRVLMCPPDHYDVLDVKNPFMAGHVGSVNKGLARKQWDDLKAAFESAGKPVTHIDPVPGLEDMVFCANQTFVGVDPKMEKICLLGQMRHSSRRREVPAFEAWFKSQGYRIVKLKDSAVLFEGAGDAIWHPGKRLIWGGHGFRSQPEVYEEVARAFDSPVVLLKLVNERFYHLDTCFCPLTPEAVLIYPSAFDAESLELILKIFPIVLTAGEGEAVRSMACNAAVVDGKTAILQKGAASVSRHMAVMGLKVIEVDTSEYIKSGGSVYCMKMFCY

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
33 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
43 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
46 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
47 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
48 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
49 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
55 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
56 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
57 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
58 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
59 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
64 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
65 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
66 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
69 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
70 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
71 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
87 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
90 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
91 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
92 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
93 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
94 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
95 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
99 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
100 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
103 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
112 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
115 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
116 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
117 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.87
Nodule 0
Rhizoplane 1.72
Rhizosphere 91.95
Stem 0
Stem Tuber 0
Unclassified 10.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100220406 3300005546 Bacteria 1423
2 JGI25405J52794_10009485 3300003911 Bacteria 1838
3 Ga0065707_10133699 3300005295 Unclassified 1877
4 Ga0070689_100019313 3300005340 Bacteria 5038
5 Ga0070689_100150061 3300005340 Bacteria 1879
6 Ga0070714_100266350 3300005435 Bacteria 1588
7 Ga0070714_100706189 3300005435 Bacteria 973
8 Ga0070713_100120617 3300005436 Bacteria 2299
9 Ga0070701_10000989 3300005438 Bacteria 10311
10 Ga0070706_100301501 3300005467 Bacteria 1495
11 Ga0070697_100099577 3300005536 Bacteria 2413
12 Ga0070697_100380153 3300005536 Bacteria 1223
13 Ga0070686_100137249 3300005544 Bacteria 1698
14 Ga0070695_100060068 3300005545 Bacteria 2463
15 Ga0070665_100022099 3300005548 Bacteria 6400
16 Ga0070704_100132341 3300005549 Bacteria 1935
17 Ga0068855_100111782 3300005563 Bacteria 3136
18 Ga0068856_100016723 3300005614 Bacteria 7106
19 Ga0068859_100073898 3300005617 Unclassified 3448
20 Ga0081455_10003454 3300005937 Bacteria 18168
21 Ga0081455_10032926 3300005937 Bacteria 4663
22 Ga0081538_10009997 3300005981 Bacteria 7825
23 Ga0070717_10428050 3300006028 Bacteria 1191
24 Ga0075363_100127954 3300006048 Bacteria 1423
25 Ga0075367_10150366 3300006178 Unclassified 1445
26 Ga0075367_10302898 3300006178 Bacteria 1006
27 Ga0075428_100005602 3300006844 Bacteria 13949
28 Ga0075428_100036133 3300006844 Bacteria 5444
29 Ga0075428_100769175 3300006844 Bacteria 1024
30 Ga0075431_100220807 3300006847 Archaea 1933
31 Ga0097620_100073902 3300006931 Unclassified 3448
32 Ga0105240_10000417 3300009093 Bacteria 78680
33 Ga0111539_10000024 3300009094 Bacteria 197871
34 Ga0111539_10274147 3300009094 Bacteria 1963
35 Ga0105247_10179995 3300009101 Bacteria 1410
36 Ga0114129_10015223 3300009147 Bacteria 10948
37 Ga0114129_10277573 3300009147 Bacteria 2240
38 Ga0114129_10454519 3300009147 Bacteria 1679
39 Ga0105237_10272210 3300009545 Bacteria 1696
40 Ga0157378_10362351 3300013297 Unclassified 1419
41 Ga0157379_10307762 3300014968 Bacteria 1445
42 Ga0213873_10003020 3300021358 Bacteria 2988
43 Ga0213872_10036823 3300021361 Bacteria 2235
44 Ga0213875_10135911 3300021388 Unclassified 1150
45 Ga0207695_10000593 3300025913 Bacteria 72987
46 Ga0207671_10029657 3300025914 Bacteria 4083
47 Ga0207664_10297274 3300025929 Bacteria 1420
48 Ga0207670_10042080 3300025936 Bacteria 3008
49 Ga0207667_10153918 3300025949 Bacteria 2366
50 Ga0207703_10336128 3300026035 Bacteria 1387
51 Ga0207702_10542309 3300026078 Bacteria 1137
52 Ga0207428_10000044 3300027907 Bacteria 198046
53 Ga0265334_10006160 3300028573 Bacteria 5194
54 Ga0265338_10007152 3300028800 Bacteria 13974
55 Ga0265325_10000732 3300031241 Bacteria 23758
56 Ga0265339_10001288 3300031249 Bacteria 18753
57 Ga0265331_10000201 3300031250 Bacteria 72952
58 Ga0307408_100079212 3300031548 Bacteria 2451
59 Ga0265313_10003368 3300031595 Bacteria 13015
60 Ga0265314_10000448 3300031711 Bacteria 55160
61 Ga0307406_10389822 3300031901 Bacteria 1101
62 Ga0307412_10359392 3300031911 Bacteria 1172
63 Ga0307416_100046566 3300032002 Bacteria 3424
64 Ga0373926_0047228 3300035083 Bacteria 1546
65 Ga0373944_0058334 3300035089 Bacteria 1233
66 Ga0373939_0057506 3300035114 Bacteria 1227
67 Ga0373931_0029465 3300035691 Bacteria 2818
68 Ga0373947_0047465 3300035725 Bacteria 2573
69 Ga0373947_0131358 3300035725 Bacteria 1599
70 Ga0373925_0219115 3300037068 Bacteria 1518
71 Ga0395905_0101526 3300037471 Bacteria 2700
72 Ga0436364_0253483 3300037853 Unclassified 1537
73 Ga0436364_0852354 3300037853 Bacteria 1735
74 Ga0395901_0847892 3300038443 Bacteria 899
75 Ga0436360_0408854 3300039438 Bacteria 10475
76 Ga0436360_1266724 3300039438 Bacteria 1311
77 Ga0436361_1204986 3300039447 Bacteria 4970
78 Ga0436362_0826413 3300039453 Bacteria 8454
79 Ga0453683_0000741 3300044673 Bacteria 33173
80 Ga0466967_0658719 3300045976 Bacteria 1036
81 Ga0496104_0790839 3300048907 Unclassified 855
82 Ga0496109_0143683 3300048912 Bacteria 2232
83 Ga0496109_0581604 3300048912 Bacteria 1055
84 Ga0496126_0272876 3300048929 Unclassified 1403
85 Ga0501031_0013870 3300049568 Bacteria 5251
86 Ga0501031_0035240 3300049568 Bacteria 3264
87 Ga0501032_0014094 3300049569 Bacteria 5669
88 Ga0501032_0167142 3300049569 Bacteria 1443
89 Ga0501033_0004155 3300049570 Bacteria 11664
90 Ga0501033_0020030 3300049570 Bacteria 5057
91 Ga0501033_0037489 3300049570 Bacteria 3628
92 Ga0501034_0002927 3300049571 Bacteria 19796
93 Ga0501034_0095842 3300049571 Bacteria 2963
94 Ga0501034_0123767 3300049571 Bacteria 2572
95 Ga0501034_0593878 3300049571 Bacteria 1013
96 Ga0501036_0259339 3300049572 Bacteria 1456
97 Ga0501037_0013949 3300049573 Bacteria 5923
98 Ga0501037_0233478 3300049573 Bacteria 1291
99 Ga0501038_0020577 3300049574 Bacteria 5929
100 Ga0501039_0003100 3300049575 Bacteria 12431
101 Ga0501040_0000046 3300049576 Bacteria 55778
102 Ga0501040_0247006 3300049576 Unclassified 1272
103 Ga0501041_0000211 3300049577 Bacteria 26969
104 Ga0501042_0000175 3300049578 Bacteria 29670
105 Ga0501042_0024290 3300049578 Bacteria 4250
106 Ga0501042_0237506 3300049578 Bacteria 1315
107 Ga0501043_0029629 3300049579 Bacteria 4301
108 Ga0501043_0070211 3300049579 Bacteria 2751
109 Ga0501046_0002270 3300049580 Bacteria 18141
110 Ga0501046_0003668 3300049580 Bacteria 14067
111 Ga0501046_0104682 3300049580 Bacteria 2168
112 Ga0501046_0301664 3300049580 Bacteria 1170
113 Ga0501047_0139905 3300049581 Bacteria 2299
114 Ga0501047_0147148 3300049581 Bacteria 2232
115 Ga0501048_0000766 3300049582 Bacteria 23566
116 Ga0501068_0003208 3300049584 Bacteria 8759
117 Ga0501068_0010902 3300049584 Bacteria 5116
118 Ga0501069_0042456 3300049585 Bacteria 2515
119 Ga0501070_0092903 3300049586 Bacteria 2497
120 Ga0501070_0211073 3300049586 Bacteria 1593
121 Ga0501071_0001839 3300049587 Bacteria 12590
122 Ga0501072_0000542 3300049588 Bacteria 27098
123 Ga0501073_0013978 3300049589 Bacteria 5834
124 Ga0501073_0042064 3300049589 Bacteria 3226
125 Ga0501073_0194282 3300049589 Bacteria 1404
126 Ga0501074_0014762 3300049590 Bacteria 5681
127 Ga0501074_0064490 3300049590 Bacteria 2637
128 Ga0501075_0000442 3300049591 Bacteria 24526
129 Ga0501075_0117854 3300049591 Bacteria 2018
130 Ga0501076_0000131 3300049592 Bacteria 41935
131 Ga0501076_0132355 3300049592 Unclassified 2023
132 Ga0501076_0160593 3300049592 Unclassified 1831
133 Ga0501077_0000087 3300049593 Bacteria 46560
134 Ga0501077_0072609 3300049593 Bacteria 2180
135 Ga0501079_0000090 3300049741 Bacteria 44426
136 Ga0501079_0048167 3300049741 Bacteria 3288
137 Ga0501080_0020942 3300049742 Bacteria 6051
138 Ga0501080_0156451 3300049742 Bacteria 2105
139 Ga0501080_0532094 3300049742 Bacteria 1048
140 Ga0501081_0000467 3300049743 Bacteria 22403
141 Ga0501081_0102072 3300049743 Bacteria 2028
142 Ga0501083_0016364 3300049744 Bacteria 5192
143 Ga0501035_0010940 3300049822 Bacteria 8402
144 Ga0501044_0014112 3300049823 Bacteria 8625
145 Ga0501044_0026098 3300049823 Bacteria 6187
146 Ga0501044_0252301 3300049823 Bacteria 1705
147 Ga0501045_0001778 3300049824 Bacteria 14559
148 nmdc:mga06z11_114334_c1 3300050494 Bacteria 1498
149 nmdc:mga05p37_258457_c1 3300050507 Unclassified 2086
150 nmdc:mga05p37_44890_c1 3300050507 Bacteria 5437
151 nmdc:mga05p37_574009_c1 3300050507 Bacteria 1279
152 nmdc:mga05p37_75135_c1 3300050507 Bacteria 4160
153 nmdc:mga05p37_77339_c1 3300050507 Archaea 4097
154 nmdc:mga05p37_997235_c1 3300050507 Unclassified 890
155 nmdc:mga09592_184939_c1 3300050508 Archaea 1803
156 nmdc:mga08y16_29_c1 3300050511 Bacteria 198046
157 nmdc:mga0n895_159512_c1 3300050512 Unclassified 2287
158 nmdc:mga0rr50_308644_c1 3300050513 Unclassified 1325
159 nmdc:mga08x19_53774_c1 3300050514 Bacteria 2591
160 Ga0495601_0087744 3300053077 Bacteria 2000
161 Ga0495619_0033582 3300053085 Bacteria 3332
162 Ga0495619_0072745 3300053085 Bacteria 2303
163 Ga0495619_0127881 3300053085 Unclassified 1745
164 Ga0500616_0069126 3300053153 Bacteria 1806
165 Ga0501084_0000318 3300054114 Bacteria 36653
166 Ga0501084_0054514 3300054114 Bacteria 3345
167 Ga0501084_0512454 3300054114 Bacteria 1014
168 Ga0501082_0000300 3300060353 Bacteria 43696
169 Ga0501082_0016325 3300060353 Bacteria 6391
170 Ga0530510_0019269 3300061734 Bacteria 4842
171 Ga0530510_0070917 3300061734 Unclassified 2529
172 Ga0530510_0179314 3300061734 Bacteria 1570
173 2673167736 2671180531 Bacteria 9045424
174 2688066940 2687453257 Bacteria 6784659
175 Ga0070696_100220406
176 JGI25405J52794_10009485
177 Ga0065707_10133699
178 Ga0070689_100019313
179 Ga0070689_100150061
180 Ga0070714_100266350
181 Ga0070714_100706189
182 Ga0070713_100120617
183 Ga0070701_10000989
184 Ga0070706_100301501
185 Ga0070697_100099577
186 Ga0070697_100380153
187 Ga0070686_100137249
188 Ga0070695_100060068
189 Ga0070665_100022099
190 Ga0070704_100132341
191 Ga0068855_100111782
192 Ga0068856_100016723
193 Ga0068859_100073898
194 Ga0081455_10003454
195 Ga0081455_10032926
196 Ga0081538_10009997
197 Ga0070717_10428050
198 Ga0075363_100127954
199 Ga0075367_10150366
200 Ga0075367_10302898
201 Ga0075428_100005602
202 Ga0075428_100036133
203 Ga0075428_100769175
204 Ga0075431_100220807
205 Ga0097620_100073902
206 Ga0105240_10000417
207 Ga0111539_10000024
208 Ga0111539_10274147
209 Ga0105247_10179995
210 Ga0114129_10015223
211 Ga0114129_10277573
212 Ga0114129_10454519
213 Ga0105237_10272210
214 Ga0157378_10362351
215 Ga0157379_10307762
216 Ga0213873_10003020
217 Ga0213872_10036823
218 Ga0213875_10135911
219 Ga0207695_10000593
220 Ga0207671_10029657
221 Ga0207664_10297274
222 Ga0207670_10042080
223 Ga0207667_10153918
224 Ga0207703_10336128
225 Ga0207702_10542309
226 Ga0207428_10000044
227 Ga0265334_10006160
228 Ga0265338_10007152
229 Ga0265325_10000732
230 Ga0265339_10001288
231 Ga0265331_10000201
232 Ga0307408_100079212
233 Ga0265313_10003368
234 Ga0265314_10000448
235 Ga0307406_10389822
236 Ga0307412_10359392
237 Ga0307416_100046566
238 Ga0373926_0047228
239 Ga0373944_0058334
240 Ga0373939_0057506
241 Ga0373931_0029465
242 Ga0373947_0047465
243 Ga0373947_0131358
244 Ga0373925_0219115
245 Ga0395905_0101526
246 Ga0436364_0253483
247 Ga0436364_0852354
248 Ga0395901_0847892
249 Ga0436360_0408854
250 Ga0436360_1266724
251 Ga0436361_1204986
252 Ga0436362_0826413
253 Ga0453683_0000741
254 Ga0466967_0658719
255 Ga0496104_0790839
256 Ga0496109_0143683
257 Ga0496109_0581604
258 Ga0496126_0272876
259 Ga0501031_0013870
260 Ga0501031_0035240
261 Ga0501032_0014094
262 Ga0501032_0167142
263 Ga0501033_0004155
264 Ga0501033_0020030
265 Ga0501033_0037489
266 Ga0501034_0002927
267 Ga0501034_0095842
268 Ga0501034_0123767
269 Ga0501034_0593878
270 Ga0501036_0259339
271 Ga0501037_0013949
272 Ga0501037_0233478
273 Ga0501038_0020577
274 Ga0501039_0003100
275 Ga0501040_0000046
276 Ga0501040_0247006
277 Ga0501041_0000211
278 Ga0501042_0000175
279 Ga0501042_0024290
280 Ga0501042_0237506
281 Ga0501043_0029629
282 Ga0501043_0070211
283 Ga0501046_0002270
284 Ga0501046_0003668
285 Ga0501046_0104682
286 Ga0501046_0301664
287 Ga0501047_0139905
288 Ga0501047_0147148
289 Ga0501048_0000766
290 Ga0501068_0003208
291 Ga0501068_0010902
292 Ga0501069_0042456
293 Ga0501070_0092903
294 Ga0501070_0211073
295 Ga0501071_0001839
296 Ga0501072_0000542
297 Ga0501073_0013978
298 Ga0501073_0042064
299 Ga0501073_0194282
300 Ga0501074_0014762
301 Ga0501074_0064490
302 Ga0501075_0000442
303 Ga0501075_0117854
304 Ga0501076_0000131
305 Ga0501076_0132355
306 Ga0501076_0160593
307 Ga0501077_0000087
308 Ga0501077_0072609
309 Ga0501079_0000090
310 Ga0501079_0048167
311 Ga0501080_0020942
312 Ga0501080_0156451
313 Ga0501080_0532094
314 Ga0501081_0000467
315 Ga0501081_0102072
316 Ga0501083_0016364
317 Ga0501035_0010940
318 Ga0501044_0014112
319 Ga0501044_0026098
320 Ga0501044_0252301
321 Ga0501045_0001778
322 nmdc:mga06z11_114334_c1
323 nmdc:mga05p37_258457_c1
324 nmdc:mga05p37_44890_c1
325 nmdc:mga05p37_574009_c1
326 nmdc:mga05p37_75135_c1
327 nmdc:mga05p37_77339_c1
328 nmdc:mga05p37_997235_c1
329 nmdc:mga09592_184939_c1
330 nmdc:mga08y16_29_c1
331 nmdc:mga0n895_159512_c1
332 nmdc:mga0rr50_308644_c1
333 nmdc:mga08x19_53774_c1
334 Ga0495601_0087744
335 Ga0495619_0033582
336 Ga0495619_0072745
337 Ga0495619_0127881
338 Ga0500616_0069126
339 Ga0501084_0000318
340 Ga0501084_0054514
341 Ga0501084_0512454
342 Ga0501082_0000300
343 Ga0501082_0016325
344 Ga0530510_0019269
345 Ga0530510_0070917
346 Ga0530510_0179314
347 2673167736
348 2688066940

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19420

DDAH_eukar

N,N dimethylarginine dimethylhydrolase, eukaryotic

40

298

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6juy-assembly1.cif.gz_C crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.9651 2 260
6lrf-assembly1.cif.gz_A-2 crystal structure of unliganded agre 0.9609 2 260
6lrg-assembly1.cif.gz_A crystal structure of the ternary complex of agre with ornithine and nad+ 0.9609 2 260
6lrh-assembly1.cif.gz_A-2 crystal structure of the binary complex of agre c264a mutant with l-arginine 0.9609 2 260
6juz-assembly1.cif.gz_A crystal structure of n-terminal domain of argz(n71s) covalently bond to a reaction intermediate 0.9606 2 263
ID Description Score Start End Superfamily
af_P71889_53_299_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9825 13 261 3.75.10.10
af_P71889_53_299_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9747 13 261 3.75.10.10
af_Q23042_14_281_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.966 2 261 3.75.10.10
af_A0A7I9BCB0_10_272_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9528 2 262 3.75.10.10
af_Q23042_14_281_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9515 2 261 3.75.10.10
ID Description Score Start End GO Terms
AF-A0A535B1N4-F1-model_v4 Amidinotransferase 0.9997 1 263 GO:0000052
GO:0006525
GO:0016403
GO:0016597
GO:0016740
GO:0045429
AF-A0A534U4G3-F1-model_v4 Amidinotransferase 0.9979 1 225 GO:0016740
AF-A0A7C3Q7E9-F1-model_v4 Amidinotransferase 0.9958 1 97 GO:0016740
AF-A0A356R860-F1-model_v4 Amidinotransferase 0.9956 5 88 GO:0016740
AF-A0A1F7RH05-F1-model_v4 Amidinotransferase 0.9946 2 262

Map