F262947

General Info

Members Datasets Scaffolds Average Seq Length
173 141 171 138

Family's Representative Sequence

Representative Sequence 3300034816|Ga0373930_0139574|Ga0373930_0139574_34_501
Length 155
Sequence MAIDSIGAASLAVNTPQNAVVGQEEFLKILLTQLRFQDPLKPMDNQEFIAQLAQFSSLEFTRQQGERIDALLTIQSASQSLTLIGRTVEVATDGGGREVGAVTAIRFDNGNPLLTIRTAAGAFLTDVRLAQVSLVNNSAATASDTTGTPATTGTP

Samples

Sample ID Description Type Environment
1 2831864461 Roseateles noduli HZ7 Isolate Nodule
2 2928058823 Ralstonia sp. 1138 Isolate Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
72 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
73 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
74 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
75 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
76 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
77 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
78 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
79 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
80 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
88 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
89 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
90 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
91 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
109 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
110 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
111 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
124 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
125 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
126 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
127 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
139 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.05
Nodule 0.58
Rhizoplane 3.47
Rhizosphere 87.86
Stem 0
Stem Tuber 0
Unclassified 4.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10099687 3300003316 Bacteria 3712
2 rootH1_10063325 3300003323 Bacteria 11402
3 Ga0065707_10391439 3300005295 Bacteria 856
4 Ga0070658_10054664 3300005327 Bacteria 3241
5 Ga0070690_100270551 3300005330 Bacteria 1208
6 Ga0068869_100770320 3300005334 Bacteria 825
7 Ga0070682_100010210 3300005337 Bacteria 5324
8 Ga0070689_100097201 3300005340 Bacteria 2328
9 Ga0070661_100176530 3300005344 Bacteria 1624
10 Ga0070673_100120147 3300005364 Bacteria 2191
11 Ga0070673_100173044 3300005364 Bacteria 1844
12 Ga0070684_100912319 3300005535 Bacteria 823
13 Ga0070695_101136855 3300005545 Bacteria 640
14 Ga0070695_101236396 3300005545 Bacteria 615
15 Ga0070693_100330521 3300005547 Bacteria 1037
16 Ga0068855_100000759 3300005563 Bacteria 39710
17 Ga0068855_100288696 3300005563 Bacteria 1819
18 Ga0068856_100259344 3300005614 Bacteria 1754
19 Ga0070702_100227735 3300005615 Bacteria 1250
20 Ga0068863_100158349 3300005841 Bacteria 2168
21 Ga0068863_100279091 3300005841 Bacteria 1618
22 Ga0068858_100108910 3300005842 Bacteria 2586
23 Ga0068862_100159450 3300005844 Bacteria 2013
24 Ga0068862_101680405 3300005844 Bacteria 643
25 Ga0075365_10074961 3300006038 Bacteria 2283
26 Ga0068871_100558578 3300006358 Unclassified 1037
27 Ga0075428_100124020 3300006844 Bacteria 2812
28 Ga0075430_100367280 3300006846 Bacteria 1188
29 Ga0075433_10016821 3300006852 Bacteria 6041
30 Ga0075433_10105238 3300006852 Bacteria 2500
31 Ga0075434_100005445 3300006871 Bacteria 11593
32 Ga0075429_100004670 3300006880 Bacteria 11793
33 Ga0075429_100817437 3300006880 Bacteria 816
34 Ga0075436_100003519 3300006914 Bacteria 10737
35 Ga0075435_100001375 3300007076 Bacteria 15713
36 Ga0105240_10732074 3300009093 Bacteria 1077
37 Ga0105240_11647357 3300009093 Unclassified 671
38 Ga0111539_10041970 3300009094 Bacteria 5496
39 Ga0105245_10113201 3300009098 Bacteria 2526
40 Ga0114129_10019434 3300009147 Bacteria 9672
41 Ga0105243_10039931 3300009148 Bacteria 3662
42 Ga0105242_10075683 3300009176 Bacteria 2804
43 Ga0105242_10723916 3300009176 Bacteria 976
44 Ga0105249_10412883 3300009553 Unclassified 1382
45 Ga0157370_10599494 3300013104 Bacteria 1009
46 Ga0157374_11209712 3300013296 Unclassified 777
47 Ga0157380_10599235 3300014326 Bacteria 1090
48 Ga0157376_10314218 3300014969 Bacteria 1487
49 Ga0163161_10281767 3300017792 Unclassified 1304
50 Ga0213872_10000292 3300021361 Bacteria 42585
51 Ga0213872_10003068 3300021361 Bacteria 9409
52 Ga0213872_10003128 3300021361 Bacteria 9303
53 Ga0207705_10056375 3300025909 Bacteria 2833
54 Ga0207695_10961035 3300025913 Bacteria 734
55 Ga0207649_10564790 3300025920 Bacteria 872
56 Ga0207687_10247103 3300025927 Bacteria 1416
57 Ga0207686_10003521 3300025934 Bacteria 8406
58 Ga0207709_10050174 3300025935 Bacteria 2550
59 Ga0207670_10185535 3300025936 Bacteria 1570
60 Ga0207704_11982152 3300025938 Bacteria 501
61 Ga0207689_10740541 3300025942 Bacteria 829
62 Ga0207667_10001752 3300025949 Bacteria 27305
63 Ga0207651_10093678 3300025960 Bacteria 2206
64 Ga0207651_10747093 3300025960 Bacteria 864
65 Ga0207703_10088506 3300026035 Bacteria 2599
66 Ga0207702_10124260 3300026078 Bacteria 2314
67 Ga0207641_10058451 3300026088 Bacteria 3282
68 Ga0207641_10135751 3300026088 Bacteria 2214
69 Ga0207698_10393587 3300026142 Bacteria 1322
70 Ga0207428_10004082 3300027907 Bacteria 13988
71 Ga0268265_10121081 3300028380 Bacteria 2156
72 Ga0268264_10117199 3300028381 Bacteria 2342
73 Ga0307515_10003325 3300028794 Bacteria 33978
74 Ga0307515_10314170 3300028794 Unclassified 1239
75 Ga0307512_10006983 3300030522 Bacteria 11270
76 Ga0307408_100395655 3300031548 Bacteria 1185
77 Ga0307413_10260232 3300031824 Bacteria 1293
78 Ga0307410_11738936 3300031852 Unclassified 553
79 Ga0307406_10586739 3300031901 Bacteria 917
80 Ga0307412_11186291 3300031911 Unclassified 683
81 Ga0307416_100598677 3300032002 Bacteria 1182
82 Ga0307415_100177871 3300032126 Unclassified 1666
83 Ga0373930_0139574 3300034816 Bacteria 601
84 Ga0373928_0065526 3300035084 Bacteria 887
85 Ga0373949_0091439 3300035090 Bacteria 823
86 Ga0373949_0110008 3300035090 Bacteria 764
87 Ga0373951_0011521 3300035091 Bacteria 1986
88 Ga0373932_0057813 3300035112 Bacteria 1170
89 Ga0373941_0034546 3300035115 Bacteria 1526
90 Ga0373960_0009184 3300035121 Bacteria 2388
91 Ga0373942_0006013 3300035207 Bacteria 2804
92 Ga0373942_0071856 3300035207 Bacteria 1012
93 Ga0373961_0018718 3300035241 Bacteria 1812
94 Ga0373962_0008614 3300035242 Bacteria 2513
95 Ga0395899_0005463 3300037312 Bacteria 9857
96 Ga0395900_0000201 3300037418 Bacteria 94279
97 Ga0395898_0553404 3300037466 Unclassified 1093
98 Ga0395898_1229762 3300037466 Unclassified 680
99 Ga0395905_0020211 3300037471 Bacteria 6308
100 Ga0395905_0069395 3300037471 Bacteria 3301
101 Ga0395905_0674643 3300037471 Bacteria 936
102 Ga0395901_1967837 3300038443 Bacteria 531
103 Ga0436361_0684989 3300039447 Bacteria 9496
104 Ga0436361_0709841 3300039447 Bacteria 56493
105 Ga0436361_1172855 3300039447 Bacteria 39928
106 Ga0451800_1260016 3300041459 Bacteria 748
107 Ga0451807_0100831 3300041486 Unclassified 591
108 Ga0439455_0137798 3300042012 Bacteria 690
109 Ga0450899_001216 3300042135 Bacteria 2924
110 Ga0450918_000314 3300042531 Bacteria 10866
111 Ga0451577_0000323 3300042876 Bacteria 89451
112 Ga0451577_0783020 3300042876 Bacteria 862
113 Ga0466965_0135861 3300044683 Bacteria 1277
114 Ga0453684_0007070 3300044712 Bacteria 20966
115 Ga0466957_0001491 3300044842 Bacteria 12285
116 Ga0466957_0035262 3300044842 Unclassified 3002
117 Ga0466959_0250080 3300045049 Unclassified 1223
118 Ga0466959_0713438 3300045049 Unclassified 672
119 Ga0451576_0442248 3300045051 Bacteria 1364
120 Ga0451576_1002246 3300045051 Bacteria 875
121 Ga0466958_0102142 3300045836 Bacteria 1784
122 Ga0466967_0032536 3300045976 Bacteria 4404
123 Ga0495603_0533982 3300046455 Bacteria 672
124 Ga0495629_0002215 3300046459 Bacteria 14994
125 Ga0495584_0000001 3300046491 Bacteria 649329
126 Ga0495583_0003194 3300046506 Bacteria 12856
127 Ga0495606_0005031 3300046507 Bacteria 12872
128 Ga0495616_0000628 3300046513 Bacteria 26392
129 Ga0495631_0046006 3300046518 Bacteria 1920
130 Ga0495643_0018913 3300046522 Bacteria 3990
131 Ga0495642_0224664 3300046528 Bacteria 820
132 Ga0495654_0004413 3300046530 Bacteria 8354
133 Ga0495654_0349893 3300046530 Unclassified 594
134 Ga0495609_0068927 3300046538 Unclassified 1556
135 Ga0495597_0001043 3300046542 Bacteria 21162
136 Ga0495597_0320859 3300046542 Bacteria 598
137 Ga0495668_0004002 3300046616 Bacteria 10730
138 Ga0495625_0008683 3300046660 Bacteria 8632
139 Ga0495661_0421416 3300046665 Bacteria 646
140 Ga0495670_0306625 3300046691 Bacteria 851
141 Ga0495649_0001837 3300046694 Bacteria 15575
142 Ga0495649_0504969 3300046694 Bacteria 601
143 Ga0495674_0163440 3300047319 Bacteria 1861
144 Ga0495680_0634975 3300047322 Unclassified 711
145 Ga0496104_0093714 3300048907 Bacteria 2873
146 Ga0496110_0480076 3300048913 Bacteria 1132
147 Ga0496110_1830447 3300048913 Unclassified 517
148 Ga0496114_0661808 3300048917 Unclassified 918
149 Ga0496121_0195489 3300048924 Bacteria 1446
150 Ga0501207_011348 3300049654 Bacteria 1326
151 Ga0501252_001406 3300049682 Bacteria 2214
152 Ga0501234_030749 3300049707 Unclassified 867
153 Ga0501279_007789 3300049775 Unclassified 1423
154 Ga0501280_106860 3300049776 Bacteria 543
155 nmdc:mga0k408_239026_c1 3300050493 Bacteria 1084
156 nmdc:mga05p37_1549_c1 3300050507 Bacteria 26717
157 nmdc:mga09592_898537_c1 3300050508 Bacteria 745
158 nmdc:mga0qj67_441237_c1 3300050509 Bacteria 1049
159 nmdc:mga06r32_358489_c1 3300050510 Unclassified 1442
160 nmdc:mga08y16_132324_c1 3300050511 Bacteria 2593
161 nmdc:mga0n895_1270997_c1 3300050512 Bacteria 708
162 nmdc:mga0n895_2171_c1 3300050512 Bacteria 15170
163 nmdc:mga0rr50_1327_c1 3300050513 Bacteria 13491
164 nmdc:mga08x19_104153_c1 3300050514 Bacteria 1885
165 nmdc:mga08x19_16525_c1 3300050514 Bacteria 4502
166 nmdc:mga0a205_457_c1 3300050515 Bacteria 31670
167 Ga0500643_005549 3300053087 Bacteria 5420
168 Ga0500555_097108 3300053103 Unclassified 752
169 Ga0500622_0004973 3300053156 Bacteria 8101
170 Ga0500622_0122084 3300053156 Bacteria 1262
171 Ga0500634_0072137 3300053161 Bacteria 1804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046518 Ga0495631_0046006 Ga0495631_0046006_478_810 109
2 3300046530 Ga0495654_0349893 Ga0495654_0349893_204_551 114
3 3300030522 Ga0307512_10006983 Ga0307512_1000698311 117
4 3300014969 Ga0157376_10314218 Ga0157376_103142182 121
5 3300045836 Ga0466958_0102142 Ga0466958_0102142_1237_1644 123
6 3300053156 Ga0500622_0122084 Ga0500622_0122084_605_1009 126
7 3300013296 Ga0157374_11209712 Ga0157374_112097122 127
8 3300037466 Ga0395898_1229762 Ga0395898_1229762_269_664 127
9 3300045976 Ga0466967_0032536 Ga0466967_0032536_337_741 127
10 3300046528 Ga0495642_0224664 Ga0495642_0224664_424_810 127
11 3300042012 Ga0439455_0137798 Ga0439455_0137798_176_565 128
12 3300017792 Ga0163161_10281767 Ga0163161_102817672 129
13 3300037471 Ga0395905_0674643 Ga0395905_0674643_278_670 129
14 iso_pu_bacteria 2831864461 2831868578 129
15 iso_pu_bacteria 2928058823 2928062421 129
16 3300046691 Ga0495670_0306625 Ga0495670_0306625_107_502 130
17 3300048924 Ga0496121_0195489 Ga0496121_0195489_983_1378 130
18 3300053087 Ga0500643_005549 Ga0500643_005549_2623_3018 130
19 3300053161 Ga0500634_0072137 Ga0500634_0072137_166_561 130
20 3300021361 Ga0213872_10003068 Ga0213872_1000306811 131
21 3300039447 Ga0436361_0684989 Ga0436361_0684989_1477_1875 131
22 3300045049 Ga0466959_0713438 Ga0466959_0713438_124_522 131
23 3300005334 Ga0068869_100770320 Ga0068869_1007703202 132
24 3300005364 Ga0070673_100173044 Ga0070673_1001730442 132
25 3300005563 Ga0068855_100288696 Ga0068855_1002886961 132
26 3300006038 Ga0075365_10074961 Ga0075365_100749613 132
27 3300006844 Ga0075428_100124020 Ga0075428_1001240203 132
28 3300009093 Ga0105240_11647357 Ga0105240_116473571 132
29 3300009553 Ga0105249_10412883 Ga0105249_104128833 132
30 3300025913 Ga0207695_10961035 Ga0207695_109610351 132
31 3300025938 Ga0207704_11982152 Ga0207704_119821521 132
32 3300025942 Ga0207689_10740541 Ga0207689_107405412 132
33 3300037312 Ga0395899_0005463 Ga0395899_0005463_7074_7475 132
34 3300037471 Ga0395905_0069395 Ga0395905_0069395_59_463 132
35 3300041459 Ga0451800_1260016 Ga0451800_1260016_11_409 132
36 3300042135 Ga0450899_001216 Ga0450899_001216_1257_1661 132
37 3300042876 Ga0451577_0000323 Ga0451577_0000323_60270_60683 132
38 3300044842 Ga0466957_0001491 Ga0466957_0001491_4460_4861 132
39 3300044842 Ga0466957_0035262 Ga0466957_0035262_585_986 132
40 3300046491 Ga0495584_0000001 Ga0495584_0000001_629065_629466 132
41 3300046506 Ga0495583_0003194 Ga0495583_0003194_8750_9151 132
42 3300046507 Ga0495606_0005031 Ga0495606_0005031_440_841 132
43 3300046694 Ga0495649_0504969 Ga0495649_0504969_180_587 132
44 3300047322 Ga0495680_0634975 Ga0495680_0634975_74_481 132
45 3300049776 Ga0501280_106860 Ga0501280_106860_97_498 132
46 3300050510 nmdc:mga06r32_358489_c1 nmdc:mga06r32_358489_c1_887_1294 132
47 3300053156 Ga0500622_0004973 Ga0500622_0004973_674_1084 132
48 3300005337 Ga0070682_100010210 Ga0070682_1000102102 133
49 3300005344 Ga0070661_100176530 Ga0070661_1001765301 133
50 3300005545 Ga0070695_101136855 Ga0070695_1011368552 133
51 3300005545 Ga0070695_101236396 Ga0070695_1012363962 133
52 3300005615 Ga0070702_100227735 Ga0070702_1002277352 133
53 3300005844 Ga0068862_100159450 Ga0068862_1001594503 133
54 3300006358 Ga0068871_100558578 Ga0068871_1005585782 133
55 3300006880 Ga0075429_100817437 Ga0075429_1008174372 133
56 3300009098 Ga0105245_10113201 Ga0105245_101132013 133
57 3300009148 Ga0105243_10039931 Ga0105243_100399313 133
58 3300009176 Ga0105242_10075683 Ga0105242_100756834 133
59 3300009176 Ga0105242_10723916 Ga0105242_107239162 133
60 3300014326 Ga0157380_10599235 Ga0157380_105992352 133
61 3300025920 Ga0207649_10564790 Ga0207649_105647901 133
62 3300025927 Ga0207687_10247103 Ga0207687_102471032 133
63 3300025934 Ga0207686_10003521 Ga0207686_100035217 133
64 3300025935 Ga0207709_10050174 Ga0207709_100501743 133
65 3300028794 Ga0307515_10003325 Ga0307515_100033259 133
66 3300031548 Ga0307408_100395655 Ga0307408_1003956552 133
67 3300031824 Ga0307413_10260232 Ga0307413_102602321 133
68 3300031852 Ga0307410_11738936 Ga0307410_117389362 133
69 3300031901 Ga0307406_10586739 Ga0307406_105867392 133
70 3300031911 Ga0307412_11186291 Ga0307412_111862912 133
71 3300032002 Ga0307416_100598677 Ga0307416_1005986772 133
72 3300032126 Ga0307415_100177871 Ga0307415_1001778712 133
73 3300037418 Ga0395900_0000201 Ga0395900_0000201_83607_84011 133
74 3300038443 Ga0395901_1967837 Ga0395901_1967837_71_484 133
75 3300042531 Ga0450918_000314 Ga0450918_000314_4764_5168 133
76 3300044683 Ga0466965_0135861 Ga0466965_0135861_703_1107 133
77 3300044712 Ga0453684_0007070 Ga0453684_0007070_6553_6957 133
78 3300045049 Ga0466959_0250080 Ga0466959_0250080_234_638 133
79 3300045051 Ga0451576_1002246 Ga0451576_1002246_422_832 133
80 3300046455 Ga0495603_0533982 Ga0495603_0533982_79_495 133
81 3300046459 Ga0495629_0002215 Ga0495629_0002215_14095_14499 133
82 3300046522 Ga0495643_0018913 Ga0495643_0018913_2331_2735 133
83 3300046530 Ga0495654_0004413 Ga0495654_0004413_327_731 133
84 3300046538 Ga0495609_0068927 Ga0495609_0068927_188_592 133
85 3300046542 Ga0495597_0320859 Ga0495597_0320859_40_456 133
86 3300046616 Ga0495668_0004002 Ga0495668_0004002_1212_1616 133
87 3300046660 Ga0495625_0008683 Ga0495625_0008683_3253_3669 133
88 3300046665 Ga0495661_0421416 Ga0495661_0421416_76_480 133
89 3300046694 Ga0495649_0001837 Ga0495649_0001837_1162_1578 133
90 3300047319 Ga0495674_0163440 Ga0495674_0163440_1307_1711 133
91 3300048907 Ga0496104_0093714 Ga0496104_0093714_2109_2513 133
92 3300048913 Ga0496110_1830447 Ga0496110_1830447_14_418 133
93 3300048917 Ga0496114_0661808 Ga0496114_0661808_55_459 133
94 3300049682 Ga0501252_001406 Ga0501252_001406_1049_1453 133
95 3300050493 nmdc:mga0k408_239026_c1 nmdc:mga0k408_239026_c1_348_752 133
96 3300053103 Ga0500555_097108 Ga0500555_097108_224_637 133
97 3300005327 Ga0070658_10054664 Ga0070658_100546642 134
98 3300005364 Ga0070673_100120147 Ga0070673_1001201472 134
99 3300005563 Ga0068855_100000759 Ga0068855_10000075925 134
100 3300009093 Ga0105240_10732074 Ga0105240_107320742 134
101 3300013104 Ga0157370_10599494 Ga0157370_105994941 134
102 3300021361 Ga0213872_10000292 Ga0213872_1000029213 134
103 3300021361 Ga0213872_10003128 Ga0213872_100031288 134
104 3300025909 Ga0207705_10056375 Ga0207705_100563754 134
105 3300025949 Ga0207667_10001752 Ga0207667_1000175215 134
106 3300025960 Ga0207651_10093678 Ga0207651_100936782 134
107 3300026142 Ga0207698_10393587 Ga0207698_103935872 134
108 3300028794 Ga0307515_10314170 Ga0307515_103141702 134
109 3300035090 Ga0373949_0110008 Ga0373949_0110008_122_535 134
110 3300035121 Ga0373960_0009184 Ga0373960_0009184_1662_2075 134
111 3300035207 Ga0373942_0071856 Ga0373942_0071856_155_568 134
112 3300039447 Ga0436361_0709841 Ga0436361_0709841_18619_19029 134
113 3300039447 Ga0436361_1172855 Ga0436361_1172855_31343_31753 134
114 3300041486 Ga0451807_0100831 Ga0451807_0100831_17_424 134
115 3300046513 Ga0495616_0000628 Ga0495616_0000628_8628_9035 134
116 3300046542 Ga0495597_0001043 Ga0495597_0001043_15897_16304 134
117 3300049654 Ga0501207_011348 Ga0501207_011348_392_799 134
118 3300049707 Ga0501234_030749 Ga0501234_030749_262_669 134
119 3300049775 Ga0501279_007789 Ga0501279_007789_907_1314 134
120 3300050509 nmdc:mga0qj67_441237_c1 nmdc:mga0qj67_441237_c1_504_932 134
121 3300050514 nmdc:mga08x19_104153_c1 nmdc:mga08x19_104153_c1_1070_1483 134
122 3300003323 rootH1_10063325 rootH1_100633254 135
123 3300005295 Ga0065707_10391439 Ga0065707_103914392 135
124 3300005330 Ga0070690_100270551 Ga0070690_1002705512 135
125 3300005340 Ga0070689_100097201 Ga0070689_1000972013 135
126 3300005535 Ga0070684_100912319 Ga0070684_1009123192 135
127 3300005547 Ga0070693_100330521 Ga0070693_1003305212 135
128 3300005614 Ga0068856_100259344 Ga0068856_1002593442 135
129 3300005841 Ga0068863_100158349 Ga0068863_1001583493 135
130 3300005841 Ga0068863_100279091 Ga0068863_1002790912 135
131 3300005842 Ga0068858_100108910 Ga0068858_1001089104 135
132 3300005844 Ga0068862_101680405 Ga0068862_1016804051 135
133 3300006846 Ga0075430_100367280 Ga0075430_1003672803 135
134 3300006852 Ga0075433_10016821 Ga0075433_100168216 135
135 3300006852 Ga0075433_10105238 Ga0075433_101052384 135
136 3300006871 Ga0075434_100005445 Ga0075434_10000544511 135
137 3300006880 Ga0075429_100004670 Ga0075429_1000046703 135
138 3300006914 Ga0075436_100003519 Ga0075436_1000035199 135
139 3300007076 Ga0075435_100001375 Ga0075435_10000137517 135
140 3300009094 Ga0111539_10041970 Ga0111539_100419706 135
141 3300009147 Ga0114129_10019434 Ga0114129_1001943411 135
142 3300025936 Ga0207670_10185535 Ga0207670_101855352 135
143 3300025960 Ga0207651_10747093 Ga0207651_107470932 135
144 3300026035 Ga0207703_10088506 Ga0207703_100885061 135
145 3300026078 Ga0207702_10124260 Ga0207702_101242603 135
146 3300026088 Ga0207641_10058451 Ga0207641_100584514 135
147 3300026088 Ga0207641_10135751 Ga0207641_101357513 135
148 3300027907 Ga0207428_10004082 Ga0207428_100040822 135
149 3300028380 Ga0268265_10121081 Ga0268265_101210811 135
150 3300028381 Ga0268264_10117199 Ga0268264_101171993 135
151 3300034816 Ga0373930_0139574 Ga0373930_0139574_34_501 135
152 3300035084 Ga0373928_0065526 Ga0373928_0065526_380_847 135
153 3300035090 Ga0373949_0091439 Ga0373949_0091439_117_599 135
154 3300035091 Ga0373951_0011521 Ga0373951_0011521_1379_1861 135
155 3300035112 Ga0373932_0057813 Ga0373932_0057813_233_715 135
156 3300035115 Ga0373941_0034546 Ga0373941_0034546_584_1051 135
157 3300035207 Ga0373942_0006013 Ga0373942_0006013_198_665 135
158 3300035241 Ga0373961_0018718 Ga0373961_0018718_894_1376 135
159 3300035242 Ga0373962_0008614 Ga0373962_0008614_1025_1492 135
160 3300037466 Ga0395898_0553404 Ga0395898_0553404_249_665 135
161 3300037471 Ga0395905_0020211 Ga0395905_0020211_2952_3368 135
162 3300042876 Ga0451577_0783020 Ga0451577_0783020_131_616 135
163 3300045051 Ga0451576_0442248 Ga0451576_0442248_167_652 135
164 3300048913 Ga0496110_0480076 Ga0496110_0480076_142_558 135
165 3300050507 nmdc:mga05p37_1549_c1 nmdc:mga05p37_1549_c1_25034_25498 135
166 3300050508 nmdc:mga09592_898537_c1 nmdc:mga09592_898537_c1_38_502 135
167 3300050511 nmdc:mga08y16_132324_c1 nmdc:mga08y16_132324_c1_1838_2314 135
168 3300050512 nmdc:mga0n895_1270997_c1 nmdc:mga0n895_1270997_c1_107_592 135
169 3300050512 nmdc:mga0n895_2171_c1 nmdc:mga0n895_2171_c1_11968_12444 135
170 3300050513 nmdc:mga0rr50_1327_c1 nmdc:mga0rr50_1327_c1_2459_2935 135
171 3300050514 nmdc:mga08x19_16525_c1 nmdc:mga08x19_16525_c1_1816_2292 135
172 3300050515 nmdc:mga0a205_457_c1 nmdc:mga0a205_457_c1_4760_5236 135
173 3300003316 rootH1_10099687 rootH1_100996874 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03963

FlgD

Flagellar hook capping protein - N-terminal region

6

69

0.9

Feature Viewer

pLDDT pTM Quality
69.79 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map