F262425
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 173 | 109 | 346 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300006846|Ga0075430_100575097|Ga0075430_1005750972 |
| Length | 180 |
| Sequence | MFELVLYEPEIPPNTGNVLRLAANAGALLHLVRPLGFALRDRQLARAGLDYGDFAAVTIHDDWAACRTYFEKRTLFAVTTRGAMRYDLPRYAAGDVFVFGPETRGLPDSVLDSFAAERRIRIPMLPGNRSMNLSNAVAVVLYEGWRQNGFSVPPSAPDEGVRPLQPAPDVRQQARDKPRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 2 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 11 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 18 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 19 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 20 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 22 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 23 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 24 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 25 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 59 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 60 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 61 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 62 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 63 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 64 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 65 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 66 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 67 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 68 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 69 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 70 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 71 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 72 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 73 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 74 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 75 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 76 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 77 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 78 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 79 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 80 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 81 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 82 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 83 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 84 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 85 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 86 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 87 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 88 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 89 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 90 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 91 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 92 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 93 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 94 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 95 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 97 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 98 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 99 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 100 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 101 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 102 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 103 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 104 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 105 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 106 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 107 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 108 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 109 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.42 |
| Metatranscriptomes | 0.58 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.05 |
| Rhizosphere | 72.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075430_100575097 | 3300006846 | Bacteria | 929 |
| 2 | Ga0070677_10016890 | 3300005333 | Bacteria | 2605 |
| 3 | Ga0070680_100118833 | 3300005336 | Bacteria | 2205 |
| 4 | Ga0068868_100032136 | 3300005338 | Bacteria | 4036 |
| 5 | Ga0070671_100002775 | 3300005355 | Bacteria | 13603 |
| 6 | Ga0070673_100061688 | 3300005364 | Bacteria | 2975 |
| 7 | Ga0070667_100654572 | 3300005367 | Bacteria | 970 |
| 8 | Ga0070700_100694198 | 3300005441 | Bacteria | 808 |
| 9 | Ga0070662_100147601 | 3300005457 | Bacteria | 1828 |
| 10 | Ga0068867_100311867 | 3300005459 | Bacteria | 1300 |
| 11 | Ga0070699_101171909 | 3300005518 | Bacteria | 705 |
| 12 | Ga0070684_100238317 | 3300005535 | Bacteria | 1662 |
| 13 | Ga0070695_100360161 | 3300005545 | Bacteria | 1092 |
| 14 | Ga0070696_101406251 | 3300005546 | Bacteria | 595 |
| 15 | Ga0070693_100353634 | 3300005547 | Bacteria | 1006 |
| 16 | Ga0070664_100059822 | 3300005564 | Bacteria | 3242 |
| 17 | Ga0068852_100003864 | 3300005616 | Bacteria | 10522 |
| 18 | Ga0068866_10380079 | 3300005718 | Bacteria | 905 |
| 19 | Ga0068863_100162442 | 3300005841 | Bacteria | 2140 |
| 20 | Ga0097621_100203332 | 3300006237 | Bacteria | 1720 |
| 21 | Ga0068871_100001670 | 3300006358 | Bacteria | 14917 |
| 22 | Ga0075428_100374192 | 3300006844 | Bacteria | 1527 |
| 23 | Ga0075430_100255624 | 3300006846 | Bacteria | 1451 |
| 24 | Ga0075431_100375233 | 3300006847 | Bacteria | 1427 |
| 25 | Ga0075429_100291291 | 3300006880 | Bacteria | 1429 |
| 26 | Ga0111539_11670941 | 3300009094 | Bacteria | 738 |
| 27 | Ga0114129_10926682 | 3300009147 | Bacteria | 1102 |
| 28 | Ga0105243_10214206 | 3300009148 | Bacteria | 1698 |
| 29 | Ga0157374_10020750 | 3300013296 | Bacteria | 5833 |
| 30 | Ga0157378_10072756 | 3300013297 | Bacteria | 3089 |
| 31 | Ga0163162_10032786 | 3300013306 | Bacteria | 5159 |
| 32 | Ga0157375_10007422 | 3300013308 | Bacteria | 9597 |
| 33 | Ga0163163_11484817 | 3300014325 | Bacteria | 739 |
| 34 | Ga0157380_12439595 | 3300014326 | Bacteria | 588 |
| 35 | Ga0157376_10002235 | 3300014969 | Bacteria | 13043 |
| 36 | Ga0157376_10344782 | 3300014969 | Bacteria | 1424 |
| 37 | Ga0163161_10055854 | 3300017792 | Bacteria | 2867 |
| 38 | Ga0207697_10075585 | 3300025315 | Bacteria | 1415 |
| 39 | Ga0207642_10311120 | 3300025899 | Bacteria | 917 |
| 40 | Ga0207645_10219678 | 3300025907 | Bacteria | 1252 |
| 41 | Ga0207705_10275688 | 3300025909 | Bacteria | 1287 |
| 42 | Ga0207659_10093858 | 3300025926 | Bacteria | 2247 |
| 43 | Ga0207644_10029802 | 3300025931 | Bacteria | 3788 |
| 44 | Ga0207706_10424952 | 3300025933 | Bacteria | 1151 |
| 45 | Ga0207669_10078955 | 3300025937 | Bacteria | 2099 |
| 46 | Ga0207691_10000740 | 3300025940 | Bacteria | 32242 |
| 47 | Ga0207679_10056632 | 3300025945 | Bacteria | 2895 |
| 48 | Ga0207651_10080344 | 3300025960 | Bacteria | 2346 |
| 49 | Ga0207677_10010478 | 3300026023 | Bacteria | 5246 |
| 50 | Ga0207641_10047650 | 3300026088 | Bacteria | 3615 |
| 51 | Ga0207648_10040224 | 3300026089 | Bacteria | 4109 |
| 52 | Ga0207676_10252145 | 3300026095 | Bacteria | 1589 |
| 53 | Ga0207683_10000179 | 3300026121 | Bacteria | 54292 |
| 54 | Ga0207698_10355509 | 3300026142 | Bacteria | 1385 |
| 55 | Ga0209969_1000173 | 3300027360 | Bacteria | 8619 |
| 56 | Ga0209981_1047402 | 3300027378 | Bacteria | 648 |
| 57 | Ga0209995_1000344 | 3300027471 | Bacteria | 7249 |
| 58 | Ga0209970_1076136 | 3300027614 | Bacteria | 627 |
| 59 | Ga0209974_10003581 | 3300027876 | Bacteria | 5584 |
| 60 | Ga0265325_10002008 | 3300031241 | Bacteria | 13973 |
| 61 | Ga0307408_100079004 | 3300031548 | Bacteria | 2454 |
| 62 | Ga0316575_10000102 | 3300031665 | Bacteria | 21168 |
| 63 | Ga0316575_10033665 | 3300031665 | Bacteria | 2011 |
| 64 | Ga0316575_10067792 | 3300031665 | Bacteria | 1431 |
| 65 | Ga0316575_10137487 | 3300031665 | Bacteria | 1004 |
| 66 | Ga0316579_10012286 | 3300031691 | Bacteria | 3660 |
| 67 | Ga0316579_10326653 | 3300031691 | Bacteria | 742 |
| 68 | Ga0316576_10000294 | 3300031727 | Bacteria | 22007 |
| 69 | Ga0316576_10000687 | 3300031727 | Bacteria | 16577 |
| 70 | Ga0316576_10010183 | 3300031727 | Bacteria | 6099 |
| 71 | Ga0316576_10010673 | 3300031727 | Bacteria | 5982 |
| 72 | Ga0316576_10061048 | 3300031727 | Bacteria | 2762 |
| 73 | Ga0316578_10024795 | 3300031728 | Bacteria | 3367 |
| 74 | Ga0316578_10074301 | 3300031728 | Bacteria | 2015 |
| 75 | Ga0316578_10120898 | 3300031728 | Bacteria | 1574 |
| 76 | Ga0316578_10163958 | 3300031728 | Unclassified | 1339 |
| 77 | Ga0316578_10384139 | 3300031728 | Bacteria | 833 |
| 78 | Ga0316577_10097003 | 3300031733 | Bacteria | 1651 |
| 79 | Ga0316577_10390033 | 3300031733 | Unclassified | 791 |
| 80 | Ga0307413_10156083 | 3300031824 | Bacteria | 1597 |
| 81 | Ga0307406_10239650 | 3300031901 | Bacteria | 1360 |
| 82 | Ga0307407_10611634 | 3300031903 | Bacteria | 812 |
| 83 | Ga0307409_101867434 | 3300031995 | Unclassified | 630 |
| 84 | Ga0307416_101269035 | 3300032002 | Bacteria | 842 |
| 85 | Ga0307414_10039739 | 3300032004 | Bacteria | 3172 |
| 86 | Ga0307411_10808148 | 3300032005 | Bacteria | 826 |
| 87 | Ga0307415_100307411 | 3300032126 | Bacteria | 1316 |
| 88 | Ga0316583_10000187 | 3300032133 | Bacteria | 16005 |
| 89 | Ga0316583_10080702 | 3300032133 | Bacteria | 1137 |
| 90 | Ga0316583_10088271 | 3300032133 | Bacteria | 1082 |
| 91 | Ga0316585_10227632 | 3300032137 | Unclassified | 617 |
| 92 | Ga0316580_10001117 | 3300032139 | Bacteria | 6785 |
| 93 | Ga0316580_10017513 | 3300032139 | Bacteria | 2204 |
| 94 | Ga0316596_1021097 | 3300033541 | Bacteria | 1659 |
| 95 | Ga0316574_0010156 | 3300035398 | Bacteria | 5306 |
| 96 | Ga0316574_0024955 | 3300035398 | Bacteria | 3583 |
| 97 | Ga0316574_0034677 | 3300035398 | Unclassified | 3078 |
| 98 | Ga0316574_0111331 | 3300035398 | Bacteria | 1755 |
| 99 | Ga0316574_0124889 | 3300035398 | Bacteria | 1653 |
| 100 | Ga0316574_0226633 | 3300035398 | Unclassified | 1196 |
| 101 | Ga0316582_0000215 | 3300036647 | Bacteria | 18762 |
| 102 | Ga0316582_0022737 | 3300036647 | Bacteria | 3727 |
| 103 | Ga0316582_0073994 | 3300036647 | Bacteria | 2211 |
| 104 | Ga0316582_0122640 | 3300036647 | Bacteria | 1740 |
| 105 | Ga0316582_0645283 | 3300036647 | Bacteria | 728 |
| 106 | Ga0316584_0009000 | 3300036712 | Bacteria | 6906 |
| 107 | Ga0316584_0063707 | 3300036712 | Bacteria | 2760 |
| 108 | Ga0316584_0096417 | 3300036712 | Unclassified | 2214 |
| 109 | Ga0316584_0119896 | 3300036712 | Bacteria | 1966 |
| 110 | Ga0316584_0323948 | 3300036712 | Bacteria | 1111 |
| 111 | Ga0316584_0349838 | 3300036712 | Bacteria | 1061 |
| 112 | Ga0316584_0967445 | 3300036712 | Unclassified | 570 |
| 113 | Ga0373925_0753668 | 3300037068 | Bacteria | 803 |
| 114 | Ga0400484_07456 | 3300038725 | Bacteria | 4114 |
| 115 | Ga0400484_41963 | 3300038725 | Bacteria | 2863 |
| 116 | Ga0400490_09595 | 3300038726 | Bacteria | 3093 |
| 117 | Ga0400490_16239 | 3300038726 | Bacteria | 7603 |
| 118 | Ga0400490_27236 | 3300038726 | Unclassified | 2794 |
| 119 | Ga0400490_58888 | 3300038726 | Unclassified | 1572 |
| 120 | Ga0400490_59697 | 3300038726 | Bacteria | 94606 |
| 121 | Ga0400490_60249 | 3300038726 | Bacteria | 2677 |
| 122 | Ga0400491_17324 | 3300038727 | Bacteria | 6907 |
| 123 | Ga0400491_24390 | 3300038727 | Bacteria | 3681 |
| 124 | Ga0400491_27685 | 3300038727 | Unclassified | 2175 |
| 125 | Ga0400485_02133 | 3300038735 | Bacteria | 41499 |
| 126 | Ga0400485_02902 | 3300038735 | Bacteria | 1153 |
| 127 | Ga0400485_07938 | 3300038735 | Bacteria | 36614 |
| 128 | Ga0400485_11695 | 3300038735 | Bacteria | 22747 |
| 129 | Ga0400488_18474 | 3300038741 | Bacteria | 5854 |
| 130 | Ga0400488_51191 | 3300038741 | Bacteria | 2932 |
| 131 | Ga0400486_13865 | 3300038742 | Bacteria | 27263 |
| 132 | Ga0400486_15513 | 3300038742 | Bacteria | 89826 |
| 133 | Ga0400486_26197 | 3300038742 | Bacteria | 13836 |
| 134 | Ga0400483_012819 | 3300039062 | Bacteria | 9168 |
| 135 | Ga0400483_054596 | 3300039062 | Bacteria | 7598 |
| 136 | Ga0400483_124960 | 3300039062 | Bacteria | 154637 |
| 137 | Ga0400483_131326 | 3300039062 | Bacteria | 10491 |
| 138 | Ga0400483_154246 | 3300039062 | Bacteria | 234250 |
| 139 | Ga0400483_217086 | 3300039062 | Bacteria | 6813 |
| 140 | Ga0400483_242883 | 3300039062 | Bacteria | 17965 |
| 141 | Ga0400483_280559 | 3300039062 | Bacteria | 1108 |
| 142 | Ga0400489_02308 | 3300039093 | Unclassified | 1322 |
| 143 | Ga0400489_15728 | 3300039093 | Bacteria | 30190 |
| 144 | Ga0400489_26776 | 3300039093 | Bacteria | 41705 |
| 145 | Ga0400489_60478 | 3300039093 | Bacteria | 57178 |
| 146 | Ga0400489_67836 | 3300039093 | Bacteria | 9069 |
| 147 | Ga0400487_12983 | 3300039110 | Unclassified | 2787 |
| 148 | Ga0400487_17830 | 3300039110 | Bacteria | 3807 |
| 149 | Ga0400487_29842 | 3300039110 | Unclassified | 3205 |
| 150 | Ga0400487_42522 | 3300039110 | Unclassified | 2939 |
| 151 | Ga0400487_61336 | 3300039110 | Bacteria | 3915 |
| 152 | Ga0400487_63698 | 3300039110 | Bacteria | 21530 |
| 153 | Ga0439439_0226090 | 3300041406 | Bacteria | 549 |
| 154 | Ga0451853_0314711 | 3300041512 | Bacteria | 970 |
| 155 | Ga0451577_0401135 | 3300042876 | Bacteria | 1245 |
| 156 | Ga0453683_0345064 | 3300044673 | Bacteria | 956 |
| 157 | Ga0451576_0940094 | 3300045051 | Bacteria | 907 |
| 158 | Ga0495594_0322927 | 3300046499 | Bacteria | 879 |
| 159 | Ga0496101_0017236 | 3300048904 | Bacteria | 4896 |
| 160 | Ga0496104_0433667 | 3300048907 | Bacteria | 1226 |
| 161 | Ga0496106_0086917 | 3300048909 | Bacteria | 2409 |
| 162 | Ga0496108_0055983 | 3300048911 | Bacteria | 3312 |
| 163 | Ga0496109_0051168 | 3300048912 | Bacteria | 3762 |
| 164 | Ga0496110_0086414 | 3300048913 | Bacteria | 2800 |
| 165 | Ga0496114_0723800 | 3300048917 | Bacteria | 871 |
| 166 | Ga0501069_0250372 | 3300049585 | Bacteria | 1033 |
| 167 | Ga0501070_0427450 | 3300049586 | Bacteria | 1069 |
| 168 | Ga0501074_0460550 | 3300049590 | Bacteria | 901 |
| 169 | Ga0501080_0343275 | 3300049742 | Bacteria | 1349 |
| 170 | nmdc:mga09592_273888_c1 | 3300050508 | Bacteria | 1464 |
| 171 | nmdc:mga06r32_100547_c1 | 3300050510 | Bacteria | 2837 |
| 172 | nmdc:mga06r32_681938_c1 | 3300050510 | Bacteria | 994 |
| 173 | nmdc:mga0rr50_1272667_c1 | 3300050513 | Bacteria | 624 |
| 174 | Ga0075430_100575097 | |||
| 175 | Ga0070677_10016890 | |||
| 176 | Ga0070680_100118833 | |||
| 177 | Ga0068868_100032136 | |||
| 178 | Ga0070671_100002775 | |||
| 179 | Ga0070673_100061688 | |||
| 180 | Ga0070667_100654572 | |||
| 181 | Ga0070700_100694198 | |||
| 182 | Ga0070662_100147601 | |||
| 183 | Ga0068867_100311867 | |||
| 184 | Ga0070699_101171909 | |||
| 185 | Ga0070684_100238317 | |||
| 186 | Ga0070695_100360161 | |||
| 187 | Ga0070696_101406251 | |||
| 188 | Ga0070693_100353634 | |||
| 189 | Ga0070664_100059822 | |||
| 190 | Ga0068852_100003864 | |||
| 191 | Ga0068866_10380079 | |||
| 192 | Ga0068863_100162442 | |||
| 193 | Ga0097621_100203332 | |||
| 194 | Ga0068871_100001670 | |||
| 195 | Ga0075428_100374192 | |||
| 196 | Ga0075430_100255624 | |||
| 197 | Ga0075431_100375233 | |||
| 198 | Ga0075429_100291291 | |||
| 199 | Ga0111539_11670941 | |||
| 200 | Ga0114129_10926682 | |||
| 201 | Ga0105243_10214206 | |||
| 202 | Ga0157374_10020750 | |||
| 203 | Ga0157378_10072756 | |||
| 204 | Ga0163162_10032786 | |||
| 205 | Ga0157375_10007422 | |||
| 206 | Ga0163163_11484817 | |||
| 207 | Ga0157380_12439595 | |||
| 208 | Ga0157376_10002235 | |||
| 209 | Ga0157376_10344782 | |||
| 210 | Ga0163161_10055854 | |||
| 211 | Ga0207697_10075585 | |||
| 212 | Ga0207642_10311120 | |||
| 213 | Ga0207645_10219678 | |||
| 214 | Ga0207705_10275688 | |||
| 215 | Ga0207659_10093858 | |||
| 216 | Ga0207644_10029802 | |||
| 217 | Ga0207706_10424952 | |||
| 218 | Ga0207669_10078955 | |||
| 219 | Ga0207691_10000740 | |||
| 220 | Ga0207679_10056632 | |||
| 221 | Ga0207651_10080344 | |||
| 222 | Ga0207677_10010478 | |||
| 223 | Ga0207641_10047650 | |||
| 224 | Ga0207648_10040224 | |||
| 225 | Ga0207676_10252145 | |||
| 226 | Ga0207683_10000179 | |||
| 227 | Ga0207698_10355509 | |||
| 228 | Ga0209969_1000173 | |||
| 229 | Ga0209981_1047402 | |||
| 230 | Ga0209995_1000344 | |||
| 231 | Ga0209970_1076136 | |||
| 232 | Ga0209974_10003581 | |||
| 233 | Ga0265325_10002008 | |||
| 234 | Ga0307408_100079004 | |||
| 235 | Ga0316575_10000102 | |||
| 236 | Ga0316575_10033665 | |||
| 237 | Ga0316575_10067792 | |||
| 238 | Ga0316575_10137487 | |||
| 239 | Ga0316579_10012286 | |||
| 240 | Ga0316579_10326653 | |||
| 241 | Ga0316576_10000294 | |||
| 242 | Ga0316576_10000687 | |||
| 243 | Ga0316576_10010183 | |||
| 244 | Ga0316576_10010673 | |||
| 245 | Ga0316576_10061048 | |||
| 246 | Ga0316578_10024795 | |||
| 247 | Ga0316578_10074301 | |||
| 248 | Ga0316578_10120898 | |||
| 249 | Ga0316578_10163958 | |||
| 250 | Ga0316578_10384139 | |||
| 251 | Ga0316577_10097003 | |||
| 252 | Ga0316577_10390033 | |||
| 253 | Ga0307413_10156083 | |||
| 254 | Ga0307406_10239650 | |||
| 255 | Ga0307407_10611634 | |||
| 256 | Ga0307409_101867434 | |||
| 257 | Ga0307416_101269035 | |||
| 258 | Ga0307414_10039739 | |||
| 259 | Ga0307411_10808148 | |||
| 260 | Ga0307415_100307411 | |||
| 261 | Ga0316583_10000187 | |||
| 262 | Ga0316583_10080702 | |||
| 263 | Ga0316583_10088271 | |||
| 264 | Ga0316585_10227632 | |||
| 265 | Ga0316580_10001117 | |||
| 266 | Ga0316580_10017513 | |||
| 267 | Ga0316596_1021097 | |||
| 268 | Ga0316574_0010156 | |||
| 269 | Ga0316574_0024955 | |||
| 270 | Ga0316574_0034677 | |||
| 271 | Ga0316574_0111331 | |||
| 272 | Ga0316574_0124889 | |||
| 273 | Ga0316574_0226633 | |||
| 274 | Ga0316582_0000215 | |||
| 275 | Ga0316582_0022737 | |||
| 276 | Ga0316582_0073994 | |||
| 277 | Ga0316582_0122640 | |||
| 278 | Ga0316582_0645283 | |||
| 279 | Ga0316584_0009000 | |||
| 280 | Ga0316584_0063707 | |||
| 281 | Ga0316584_0096417 | |||
| 282 | Ga0316584_0119896 | |||
| 283 | Ga0316584_0323948 | |||
| 284 | Ga0316584_0349838 | |||
| 285 | Ga0316584_0967445 | |||
| 286 | Ga0373925_0753668 | |||
| 287 | Ga0400484_07456 | |||
| 288 | Ga0400484_41963 | |||
| 289 | Ga0400490_09595 | |||
| 290 | Ga0400490_16239 | |||
| 291 | Ga0400490_27236 | |||
| 292 | Ga0400490_58888 | |||
| 293 | Ga0400490_59697 | |||
| 294 | Ga0400490_60249 | |||
| 295 | Ga0400491_17324 | |||
| 296 | Ga0400491_24390 | |||
| 297 | Ga0400491_27685 | |||
| 298 | Ga0400485_02133 | |||
| 299 | Ga0400485_02902 | |||
| 300 | Ga0400485_07938 | |||
| 301 | Ga0400485_11695 | |||
| 302 | Ga0400488_18474 | |||
| 303 | Ga0400488_51191 | |||
| 304 | Ga0400486_13865 | |||
| 305 | Ga0400486_15513 | |||
| 306 | Ga0400486_26197 | |||
| 307 | Ga0400483_012819 | |||
| 308 | Ga0400483_054596 | |||
| 309 | Ga0400483_124960 | |||
| 310 | Ga0400483_131326 | |||
| 311 | Ga0400483_154246 | |||
| 312 | Ga0400483_217086 | |||
| 313 | Ga0400483_242883 | |||
| 314 | Ga0400483_280559 | |||
| 315 | Ga0400489_02308 | |||
| 316 | Ga0400489_15728 | |||
| 317 | Ga0400489_26776 | |||
| 318 | Ga0400489_60478 | |||
| 319 | Ga0400489_67836 | |||
| 320 | Ga0400487_12983 | |||
| 321 | Ga0400487_17830 | |||
| 322 | Ga0400487_29842 | |||
| 323 | Ga0400487_42522 | |||
| 324 | Ga0400487_61336 | |||
| 325 | Ga0400487_63698 | |||
| 326 | Ga0439439_0226090 | |||
| 327 | Ga0451853_0314711 | |||
| 328 | Ga0451577_0401135 | |||
| 329 | Ga0453683_0345064 | |||
| 330 | Ga0451576_0940094 | |||
| 331 | Ga0495594_0322927 | |||
| 332 | Ga0496101_0017236 | |||
| 333 | Ga0496104_0433667 | |||
| 334 | Ga0496106_0086917 | |||
| 335 | Ga0496108_0055983 | |||
| 336 | Ga0496109_0051168 | |||
| 337 | Ga0496110_0086414 | |||
| 338 | Ga0496114_0723800 | |||
| 339 | Ga0501069_0250372 | |||
| 340 | Ga0501070_0427450 | |||
| 341 | Ga0501074_0460550 | |||
| 342 | Ga0501080_0343275 | |||
| 343 | nmdc:mga09592_273888_c1 | |||
| 344 | nmdc:mga06r32_100547_c1 | |||
| 345 | nmdc:mga06r32_681938_c1 | |||
| 346 | nmdc:mga0rr50_1272667_c1 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6qkv-assembly1.cif.gz_B | structure of yibk from p. aeruginosa | 0.9557 | 16 | 159 |
| 6qh8-assembly2.cif.gz_D | structure of knotted yibk from p. aeruginosa | 0.9393 | 15 | 159 |
| 4kgn-assembly1.cif.gz_A | crystal structure of a trna (cytidine(34)-2'-o)-methyltransferase bound to s-adenosyl homocysteine | 0.9362 | 18 | 163 |
| 3e5y-assembly1.cif.gz_B | crystal structure of trmh family rna methyltransferase from burkholderia pseudomallei | 0.9347 | 18 | 158 |
| 1j85-assembly1.cif.gz_A | structure of yibk from haemophilus influenzae (hi0766), a truncated sequence homolog of trna (guanosine-2'-o-) methyltransferase (spou) | 0.9342 | 18 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4pzkB00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9157 | 19 | 159 | 3.40.1280.10 |
| 4kgnG00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9124 | 18 | 163 | 3.40.1280.10 |
| 3l8uA00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9042 | 17 | 159 | 3.40.1280.10 |
| 5co4A00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9039 | 15 | 158 | 3.40.1280.10 |
| 4kgnG00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.8947 | 18 | 163 | 3.40.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R9JZM6-F1-model_v4 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) | 0.9489 | 20 | 157 |
GO:0002130
GO:0003723 GO:0005737 GO:0141098 GO:0141102 |
| AF-A0A1F3ZHH7-F1-model_v4 | tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) | 0.9457 | 18 | 159 |
GO:0002130
GO:0003723 GO:0005737 GO:0141098 GO:0141102 |
| AF-A0A0H4JAI1-F1-model_v4 | tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) | 0.9453 | 18 | 158 |
GO:0002131
GO:0002132 GO:0003723 GO:0005737 GO:0141098 GO:0141102 |
| AF-A0A7Y2TPK4-F1-model_v4 | tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) | 0.9407 | 18 | 159 |
GO:0002130
GO:0003723 GO:0005737 GO:0008175 GO:0008757 |
| AF-A0A5C8ZAT5-F1-model_v4 | tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) | 0.9394 | 18 | 158 |
GO:0002131
GO:0002132 GO:0003723 GO:0005737 GO:0141098 GO:0141102 |