F262425

General Info

Members Datasets Scaffolds Average Seq Length
173 109 346 160

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100575097|Ga0075430_1005750972
Length 180
Sequence MFELVLYEPEIPPNTGNVLRLAANAGALLHLVRPLGFALRDRQLARAGLDYGDFAAVTIHDDWAACRTYFEKRTLFAVTTRGAMRYDLPRYAAGDVFVFGPETRGLPDSVLDSFAAERRIRIPMLPGNRSMNLSNAVAVVLYEGWRQNGFSVPPSAPDEGVRPLQPAPDVRQQARDKPRG

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
61 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
62 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
63 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
64 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
74 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
75 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
76 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
78 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
79 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
82 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
83 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
84 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
85 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
86 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
87 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
88 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
89 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
90 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
91 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
109 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.05
Rhizosphere 72.83
Stem 0
Stem Tuber 0
Unclassified 8.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100575097 3300006846 Bacteria 929
2 Ga0070677_10016890 3300005333 Bacteria 2605
3 Ga0070680_100118833 3300005336 Bacteria 2205
4 Ga0068868_100032136 3300005338 Bacteria 4036
5 Ga0070671_100002775 3300005355 Bacteria 13603
6 Ga0070673_100061688 3300005364 Bacteria 2975
7 Ga0070667_100654572 3300005367 Bacteria 970
8 Ga0070700_100694198 3300005441 Bacteria 808
9 Ga0070662_100147601 3300005457 Bacteria 1828
10 Ga0068867_100311867 3300005459 Bacteria 1300
11 Ga0070699_101171909 3300005518 Bacteria 705
12 Ga0070684_100238317 3300005535 Bacteria 1662
13 Ga0070695_100360161 3300005545 Bacteria 1092
14 Ga0070696_101406251 3300005546 Bacteria 595
15 Ga0070693_100353634 3300005547 Bacteria 1006
16 Ga0070664_100059822 3300005564 Bacteria 3242
17 Ga0068852_100003864 3300005616 Bacteria 10522
18 Ga0068866_10380079 3300005718 Bacteria 905
19 Ga0068863_100162442 3300005841 Bacteria 2140
20 Ga0097621_100203332 3300006237 Bacteria 1720
21 Ga0068871_100001670 3300006358 Bacteria 14917
22 Ga0075428_100374192 3300006844 Bacteria 1527
23 Ga0075430_100255624 3300006846 Bacteria 1451
24 Ga0075431_100375233 3300006847 Bacteria 1427
25 Ga0075429_100291291 3300006880 Bacteria 1429
26 Ga0111539_11670941 3300009094 Bacteria 738
27 Ga0114129_10926682 3300009147 Bacteria 1102
28 Ga0105243_10214206 3300009148 Bacteria 1698
29 Ga0157374_10020750 3300013296 Bacteria 5833
30 Ga0157378_10072756 3300013297 Bacteria 3089
31 Ga0163162_10032786 3300013306 Bacteria 5159
32 Ga0157375_10007422 3300013308 Bacteria 9597
33 Ga0163163_11484817 3300014325 Bacteria 739
34 Ga0157380_12439595 3300014326 Bacteria 588
35 Ga0157376_10002235 3300014969 Bacteria 13043
36 Ga0157376_10344782 3300014969 Bacteria 1424
37 Ga0163161_10055854 3300017792 Bacteria 2867
38 Ga0207697_10075585 3300025315 Bacteria 1415
39 Ga0207642_10311120 3300025899 Bacteria 917
40 Ga0207645_10219678 3300025907 Bacteria 1252
41 Ga0207705_10275688 3300025909 Bacteria 1287
42 Ga0207659_10093858 3300025926 Bacteria 2247
43 Ga0207644_10029802 3300025931 Bacteria 3788
44 Ga0207706_10424952 3300025933 Bacteria 1151
45 Ga0207669_10078955 3300025937 Bacteria 2099
46 Ga0207691_10000740 3300025940 Bacteria 32242
47 Ga0207679_10056632 3300025945 Bacteria 2895
48 Ga0207651_10080344 3300025960 Bacteria 2346
49 Ga0207677_10010478 3300026023 Bacteria 5246
50 Ga0207641_10047650 3300026088 Bacteria 3615
51 Ga0207648_10040224 3300026089 Bacteria 4109
52 Ga0207676_10252145 3300026095 Bacteria 1589
53 Ga0207683_10000179 3300026121 Bacteria 54292
54 Ga0207698_10355509 3300026142 Bacteria 1385
55 Ga0209969_1000173 3300027360 Bacteria 8619
56 Ga0209981_1047402 3300027378 Bacteria 648
57 Ga0209995_1000344 3300027471 Bacteria 7249
58 Ga0209970_1076136 3300027614 Bacteria 627
59 Ga0209974_10003581 3300027876 Bacteria 5584
60 Ga0265325_10002008 3300031241 Bacteria 13973
61 Ga0307408_100079004 3300031548 Bacteria 2454
62 Ga0316575_10000102 3300031665 Bacteria 21168
63 Ga0316575_10033665 3300031665 Bacteria 2011
64 Ga0316575_10067792 3300031665 Bacteria 1431
65 Ga0316575_10137487 3300031665 Bacteria 1004
66 Ga0316579_10012286 3300031691 Bacteria 3660
67 Ga0316579_10326653 3300031691 Bacteria 742
68 Ga0316576_10000294 3300031727 Bacteria 22007
69 Ga0316576_10000687 3300031727 Bacteria 16577
70 Ga0316576_10010183 3300031727 Bacteria 6099
71 Ga0316576_10010673 3300031727 Bacteria 5982
72 Ga0316576_10061048 3300031727 Bacteria 2762
73 Ga0316578_10024795 3300031728 Bacteria 3367
74 Ga0316578_10074301 3300031728 Bacteria 2015
75 Ga0316578_10120898 3300031728 Bacteria 1574
76 Ga0316578_10163958 3300031728 Unclassified 1339
77 Ga0316578_10384139 3300031728 Bacteria 833
78 Ga0316577_10097003 3300031733 Bacteria 1651
79 Ga0316577_10390033 3300031733 Unclassified 791
80 Ga0307413_10156083 3300031824 Bacteria 1597
81 Ga0307406_10239650 3300031901 Bacteria 1360
82 Ga0307407_10611634 3300031903 Bacteria 812
83 Ga0307409_101867434 3300031995 Unclassified 630
84 Ga0307416_101269035 3300032002 Bacteria 842
85 Ga0307414_10039739 3300032004 Bacteria 3172
86 Ga0307411_10808148 3300032005 Bacteria 826
87 Ga0307415_100307411 3300032126 Bacteria 1316
88 Ga0316583_10000187 3300032133 Bacteria 16005
89 Ga0316583_10080702 3300032133 Bacteria 1137
90 Ga0316583_10088271 3300032133 Bacteria 1082
91 Ga0316585_10227632 3300032137 Unclassified 617
92 Ga0316580_10001117 3300032139 Bacteria 6785
93 Ga0316580_10017513 3300032139 Bacteria 2204
94 Ga0316596_1021097 3300033541 Bacteria 1659
95 Ga0316574_0010156 3300035398 Bacteria 5306
96 Ga0316574_0024955 3300035398 Bacteria 3583
97 Ga0316574_0034677 3300035398 Unclassified 3078
98 Ga0316574_0111331 3300035398 Bacteria 1755
99 Ga0316574_0124889 3300035398 Bacteria 1653
100 Ga0316574_0226633 3300035398 Unclassified 1196
101 Ga0316582_0000215 3300036647 Bacteria 18762
102 Ga0316582_0022737 3300036647 Bacteria 3727
103 Ga0316582_0073994 3300036647 Bacteria 2211
104 Ga0316582_0122640 3300036647 Bacteria 1740
105 Ga0316582_0645283 3300036647 Bacteria 728
106 Ga0316584_0009000 3300036712 Bacteria 6906
107 Ga0316584_0063707 3300036712 Bacteria 2760
108 Ga0316584_0096417 3300036712 Unclassified 2214
109 Ga0316584_0119896 3300036712 Bacteria 1966
110 Ga0316584_0323948 3300036712 Bacteria 1111
111 Ga0316584_0349838 3300036712 Bacteria 1061
112 Ga0316584_0967445 3300036712 Unclassified 570
113 Ga0373925_0753668 3300037068 Bacteria 803
114 Ga0400484_07456 3300038725 Bacteria 4114
115 Ga0400484_41963 3300038725 Bacteria 2863
116 Ga0400490_09595 3300038726 Bacteria 3093
117 Ga0400490_16239 3300038726 Bacteria 7603
118 Ga0400490_27236 3300038726 Unclassified 2794
119 Ga0400490_58888 3300038726 Unclassified 1572
120 Ga0400490_59697 3300038726 Bacteria 94606
121 Ga0400490_60249 3300038726 Bacteria 2677
122 Ga0400491_17324 3300038727 Bacteria 6907
123 Ga0400491_24390 3300038727 Bacteria 3681
124 Ga0400491_27685 3300038727 Unclassified 2175
125 Ga0400485_02133 3300038735 Bacteria 41499
126 Ga0400485_02902 3300038735 Bacteria 1153
127 Ga0400485_07938 3300038735 Bacteria 36614
128 Ga0400485_11695 3300038735 Bacteria 22747
129 Ga0400488_18474 3300038741 Bacteria 5854
130 Ga0400488_51191 3300038741 Bacteria 2932
131 Ga0400486_13865 3300038742 Bacteria 27263
132 Ga0400486_15513 3300038742 Bacteria 89826
133 Ga0400486_26197 3300038742 Bacteria 13836
134 Ga0400483_012819 3300039062 Bacteria 9168
135 Ga0400483_054596 3300039062 Bacteria 7598
136 Ga0400483_124960 3300039062 Bacteria 154637
137 Ga0400483_131326 3300039062 Bacteria 10491
138 Ga0400483_154246 3300039062 Bacteria 234250
139 Ga0400483_217086 3300039062 Bacteria 6813
140 Ga0400483_242883 3300039062 Bacteria 17965
141 Ga0400483_280559 3300039062 Bacteria 1108
142 Ga0400489_02308 3300039093 Unclassified 1322
143 Ga0400489_15728 3300039093 Bacteria 30190
144 Ga0400489_26776 3300039093 Bacteria 41705
145 Ga0400489_60478 3300039093 Bacteria 57178
146 Ga0400489_67836 3300039093 Bacteria 9069
147 Ga0400487_12983 3300039110 Unclassified 2787
148 Ga0400487_17830 3300039110 Bacteria 3807
149 Ga0400487_29842 3300039110 Unclassified 3205
150 Ga0400487_42522 3300039110 Unclassified 2939
151 Ga0400487_61336 3300039110 Bacteria 3915
152 Ga0400487_63698 3300039110 Bacteria 21530
153 Ga0439439_0226090 3300041406 Bacteria 549
154 Ga0451853_0314711 3300041512 Bacteria 970
155 Ga0451577_0401135 3300042876 Bacteria 1245
156 Ga0453683_0345064 3300044673 Bacteria 956
157 Ga0451576_0940094 3300045051 Bacteria 907
158 Ga0495594_0322927 3300046499 Bacteria 879
159 Ga0496101_0017236 3300048904 Bacteria 4896
160 Ga0496104_0433667 3300048907 Bacteria 1226
161 Ga0496106_0086917 3300048909 Bacteria 2409
162 Ga0496108_0055983 3300048911 Bacteria 3312
163 Ga0496109_0051168 3300048912 Bacteria 3762
164 Ga0496110_0086414 3300048913 Bacteria 2800
165 Ga0496114_0723800 3300048917 Bacteria 871
166 Ga0501069_0250372 3300049585 Bacteria 1033
167 Ga0501070_0427450 3300049586 Bacteria 1069
168 Ga0501074_0460550 3300049590 Bacteria 901
169 Ga0501080_0343275 3300049742 Bacteria 1349
170 nmdc:mga09592_273888_c1 3300050508 Bacteria 1464
171 nmdc:mga06r32_100547_c1 3300050510 Bacteria 2837
172 nmdc:mga06r32_681938_c1 3300050510 Bacteria 994
173 nmdc:mga0rr50_1272667_c1 3300050513 Bacteria 624
174 Ga0075430_100575097
175 Ga0070677_10016890
176 Ga0070680_100118833
177 Ga0068868_100032136
178 Ga0070671_100002775
179 Ga0070673_100061688
180 Ga0070667_100654572
181 Ga0070700_100694198
182 Ga0070662_100147601
183 Ga0068867_100311867
184 Ga0070699_101171909
185 Ga0070684_100238317
186 Ga0070695_100360161
187 Ga0070696_101406251
188 Ga0070693_100353634
189 Ga0070664_100059822
190 Ga0068852_100003864
191 Ga0068866_10380079
192 Ga0068863_100162442
193 Ga0097621_100203332
194 Ga0068871_100001670
195 Ga0075428_100374192
196 Ga0075430_100255624
197 Ga0075431_100375233
198 Ga0075429_100291291
199 Ga0111539_11670941
200 Ga0114129_10926682
201 Ga0105243_10214206
202 Ga0157374_10020750
203 Ga0157378_10072756
204 Ga0163162_10032786
205 Ga0157375_10007422
206 Ga0163163_11484817
207 Ga0157380_12439595
208 Ga0157376_10002235
209 Ga0157376_10344782
210 Ga0163161_10055854
211 Ga0207697_10075585
212 Ga0207642_10311120
213 Ga0207645_10219678
214 Ga0207705_10275688
215 Ga0207659_10093858
216 Ga0207644_10029802
217 Ga0207706_10424952
218 Ga0207669_10078955
219 Ga0207691_10000740
220 Ga0207679_10056632
221 Ga0207651_10080344
222 Ga0207677_10010478
223 Ga0207641_10047650
224 Ga0207648_10040224
225 Ga0207676_10252145
226 Ga0207683_10000179
227 Ga0207698_10355509
228 Ga0209969_1000173
229 Ga0209981_1047402
230 Ga0209995_1000344
231 Ga0209970_1076136
232 Ga0209974_10003581
233 Ga0265325_10002008
234 Ga0307408_100079004
235 Ga0316575_10000102
236 Ga0316575_10033665
237 Ga0316575_10067792
238 Ga0316575_10137487
239 Ga0316579_10012286
240 Ga0316579_10326653
241 Ga0316576_10000294
242 Ga0316576_10000687
243 Ga0316576_10010183
244 Ga0316576_10010673
245 Ga0316576_10061048
246 Ga0316578_10024795
247 Ga0316578_10074301
248 Ga0316578_10120898
249 Ga0316578_10163958
250 Ga0316578_10384139
251 Ga0316577_10097003
252 Ga0316577_10390033
253 Ga0307413_10156083
254 Ga0307406_10239650
255 Ga0307407_10611634
256 Ga0307409_101867434
257 Ga0307416_101269035
258 Ga0307414_10039739
259 Ga0307411_10808148
260 Ga0307415_100307411
261 Ga0316583_10000187
262 Ga0316583_10080702
263 Ga0316583_10088271
264 Ga0316585_10227632
265 Ga0316580_10001117
266 Ga0316580_10017513
267 Ga0316596_1021097
268 Ga0316574_0010156
269 Ga0316574_0024955
270 Ga0316574_0034677
271 Ga0316574_0111331
272 Ga0316574_0124889
273 Ga0316574_0226633
274 Ga0316582_0000215
275 Ga0316582_0022737
276 Ga0316582_0073994
277 Ga0316582_0122640
278 Ga0316582_0645283
279 Ga0316584_0009000
280 Ga0316584_0063707
281 Ga0316584_0096417
282 Ga0316584_0119896
283 Ga0316584_0323948
284 Ga0316584_0349838
285 Ga0316584_0967445
286 Ga0373925_0753668
287 Ga0400484_07456
288 Ga0400484_41963
289 Ga0400490_09595
290 Ga0400490_16239
291 Ga0400490_27236
292 Ga0400490_58888
293 Ga0400490_59697
294 Ga0400490_60249
295 Ga0400491_17324
296 Ga0400491_24390
297 Ga0400491_27685
298 Ga0400485_02133
299 Ga0400485_02902
300 Ga0400485_07938
301 Ga0400485_11695
302 Ga0400488_18474
303 Ga0400488_51191
304 Ga0400486_13865
305 Ga0400486_15513
306 Ga0400486_26197
307 Ga0400483_012819
308 Ga0400483_054596
309 Ga0400483_124960
310 Ga0400483_131326
311 Ga0400483_154246
312 Ga0400483_217086
313 Ga0400483_242883
314 Ga0400483_280559
315 Ga0400489_02308
316 Ga0400489_15728
317 Ga0400489_26776
318 Ga0400489_60478
319 Ga0400489_67836
320 Ga0400487_12983
321 Ga0400487_17830
322 Ga0400487_29842
323 Ga0400487_42522
324 Ga0400487_61336
325 Ga0400487_63698
326 Ga0439439_0226090
327 Ga0451853_0314711
328 Ga0451577_0401135
329 Ga0453683_0345064
330 Ga0451576_0940094
331 Ga0495594_0322927
332 Ga0496101_0017236
333 Ga0496104_0433667
334 Ga0496106_0086917
335 Ga0496108_0055983
336 Ga0496109_0051168
337 Ga0496110_0086414
338 Ga0496114_0723800
339 Ga0501069_0250372
340 Ga0501070_0427450
341 Ga0501074_0460550
342 Ga0501080_0343275
343 nmdc:mga09592_273888_c1
344 nmdc:mga06r32_100547_c1
345 nmdc:mga06r32_681938_c1
346 nmdc:mga0rr50_1272667_c1

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

1

142

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qkv-assembly1.cif.gz_B structure of yibk from p. aeruginosa 0.9557 16 159
6qh8-assembly2.cif.gz_D structure of knotted yibk from p. aeruginosa 0.9393 15 159
4kgn-assembly1.cif.gz_A crystal structure of a trna (cytidine(34)-2'-o)-methyltransferase bound to s-adenosyl homocysteine 0.9362 18 163
3e5y-assembly1.cif.gz_B crystal structure of trmh family rna methyltransferase from burkholderia pseudomallei 0.9347 18 158
1j85-assembly1.cif.gz_A structure of yibk from haemophilus influenzae (hi0766), a truncated sequence homolog of trna (guanosine-2'-o-) methyltransferase (spou) 0.9342 18 158
ID Description Score Start End Superfamily
4pzkB00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9157 19 159 3.40.1280.10
4kgnG00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9124 18 163 3.40.1280.10
3l8uA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9042 17 159 3.40.1280.10
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9039 15 158 3.40.1280.10
4kgnG00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8947 18 163 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A4R9JZM6-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9489 20 157 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A1F3ZHH7-F1-model_v4 tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) 0.9457 18 159 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A0H4JAI1-F1-model_v4 tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) 0.9453 18 158 GO:0002131
GO:0002132
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A7Y2TPK4-F1-model_v4 tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) 0.9407 18 159 GO:0002130
GO:0003723
GO:0005737
GO:0008175
GO:0008757
AF-A0A5C8ZAT5-F1-model_v4 tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) 0.9394 18 158 GO:0002131
GO:0002132
GO:0003723
GO:0005737
GO:0141098
GO:0141102

Map