F261403

General Info

Members Datasets Scaffolds Average Seq Length
172 115 158 185

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0020709|Ga0496100_0020709_2130_2750
Length 206
Sequence MPEAQASSSTSPQPTYAATPGLVPTPGQTVGPFYHYALPFEGGEHLVPAGTPGSVRLHGTVTDGDGAPVPDALIEIWQADAEGRIVREGGSLRRDPGVFTGFGRTQTWRDGGYSFTTLEPGPTSEGAAPFIAVTVFARGLLNRLFTRVYLPEPAAALESDSLLASLDPADRDTLVASREPDGSLRFDIRLQGDGETVFLRYPRHSV

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2582580736 Prauserella sp. Am3 Isolate Unclassified
3 2687453737 Frankia sp. BMG5.36 Isolate Nodule
4 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
5 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
6 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
7 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
8 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
9 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
10 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
11 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
12 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
13 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
14 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
34 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
47 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
48 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
49 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
63 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
64 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
65 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
68 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
69 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
70 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
74 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
75 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
76 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
77 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
78 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
79 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
80 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
91 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
92 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
95 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
96 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
97 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
98 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
105 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
106 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
110 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
111 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
112 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
115 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.28
Metatranscriptomes 0.58
Isolates 8.14

Biome Distribution

Category Percentage (%)
Aerial Root 1.16
Bulb 0
Endosphere 0
Nodule 0.58
Rhizoplane 25.58
Rhizosphere 63.37
Stem 0
Stem Tuber 0
Unclassified 9.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100115928 3300005329 Bacteria 2529
2 Ga0070683_100187282 3300005329 Bacteria 1965
3 Ga0070683_100330136 3300005329 Bacteria 1452
4 Ga0070682_100170832 3300005337 Bacteria 1511
5 Ga0070684_100088554 3300005535 Bacteria 2750
6 Ga0070684_100109727 3300005535 Bacteria 2473
7 Ga0068853_100808085 3300005539 Bacteria 898
8 Ga0068855_100122274 3300005563 Bacteria 2979
9 Ga0068857_100045332 3300005577 Bacteria 3901
10 Ga0068856_100258121 3300005614 Bacteria 1758
11 Ga0068856_100614498 3300005614 Bacteria 1108
12 Ga0068856_101331659 3300005614 Bacteria 733
13 Ga0081455_10101148 3300005937 Bacteria 2314
14 Ga0097621_101087346 3300006237 Bacteria 750
15 Ga0068871_101030764 3300006358 Bacteria 767
16 Ga0105243_10758232 3300009148 Bacteria 952
17 Ga0105237_10001164 3300009545 Bacteria 35186
18 Ga0105239_10011511 3300010375 Bacteria 9868
19 Ga0157341_1008987 3300012494 Bacteria 825
20 Ga0157371_10458459 3300013102 Bacteria 938
21 Ga0157369_11032694 3300013105 Bacteria 841
22 Ga0157374_10947315 3300013296 Bacteria 879
23 Ga0157372_10152296 3300013307 Bacteria 2670
24 Ga0157372_10766941 3300013307 Bacteria 1121
25 Ga0157377_10360224 3300014745 Bacteria 979
26 Ga0206356_10640117 3300020070 Bacteria 895
27 Ga0207671_10003116 3300025914 Bacteria 16854
28 Ga0207687_10106135 3300025927 Bacteria 2076
29 Ga0207690_10416110 3300025932 Bacteria 1074
30 Ga0207709_10527583 3300025935 Bacteria 925
31 Ga0207704_10890946 3300025938 Bacteria 748
32 Ga0207661_10062559 3300025944 Bacteria 3012
33 Ga0207679_10700907 3300025945 Bacteria 919
34 Ga0207667_10217004 3300025949 Bacteria 1960
35 Ga0207678_11345407 3300026067 Bacteria 632
36 Ga0207702_10502874 3300026078 Bacteria 1182
37 Ga0207702_10818873 3300026078 Bacteria 921
38 Ga0207698_11202534 3300026142 Bacteria 772
39 Ga0307405_10112267 3300031731 Bacteria 1849
40 Ga0307405_10583252 3300031731 Bacteria 910
41 Ga0307413_10119983 3300031824 Bacteria 1779
42 Ga0307413_11151081 3300031824 Bacteria 672
43 Ga0307410_10052870 3300031852 Bacteria 2746
44 Ga0307410_10566794 3300031852 Bacteria 943
45 Ga0326468_10001072 3300031889 Bacteria 2556
46 Ga0307406_10826933 3300031901 Bacteria 783
47 Ga0307407_10007321 3300031903 Bacteria 4990
48 Ga0307407_10248740 3300031903 Bacteria 1217
49 Ga0307407_10605735 3300031903 Bacteria 816
50 Ga0307412_10241778 3300031911 Bacteria 1397
51 Ga0307409_100035493 3300031995 Bacteria 3655
52 Ga0307409_100074406 3300031995 Bacteria 2714
53 Ga0307416_100160585 3300032002 Bacteria 2077
54 Ga0307416_100404893 3300032002 Bacteria 1403
55 Ga0307416_101789951 3300032002 Bacteria 718
56 Ga0307414_10504266 3300032004 Bacteria 1071
57 Ga0307414_10576881 3300032004 Bacteria 1006
58 Ga0307411_10066578 3300032005 Bacteria 2421
59 Ga0307411_10283988 3300032005 Bacteria 1319
60 Ga0307411_10722338 3300032005 Bacteria 870
61 Ga0307415_100098875 3300032126 Bacteria 2134
62 Ga0307415_100277971 3300032126 Bacteria 1375
63 Ga0373925_0319633 3300037068 Bacteria 1256
64 Ga0395900_0434658 3300037418 Bacteria 1271
65 Ga0395898_0128746 3300037466 Bacteria 2425
66 Ga0395898_0782282 3300037466 Bacteria 895
67 Ga0395898_1028994 3300037466 Bacteria 759
68 Ga0395901_0066926 3300038443 Bacteria 3741
69 Ga0395901_0205977 3300038443 Bacteria 2061
70 Ga0395901_0412095 3300038443 Bacteria 1387
71 Ga0439465_0168205 3300041413 Bacteria 789
72 Ga0451853_2377865 3300041512 Bacteria 5550
73 Ga0439463_097053 3300042016 Bacteria 759
74 Ga0466965_0004758 3300044683 Bacteria 6050
75 Ga0466966_0153791 3300044684 Bacteria 1402
76 Ga0466966_0318502 3300044684 Bacteria 935
77 Ga0466964_0113717 3300044706 Bacteria 1211
78 Ga0466970_0227532 3300044765 Bacteria 1042
79 Ga0466957_0228154 3300044842 Bacteria 1232
80 Ga0466960_0000590 3300044901 Bacteria 12546
81 Ga0466960_0643798 3300044901 Bacteria 632
82 Ga0466958_0370633 3300045836 Bacteria 923
83 Ga0466967_0309655 3300045976 Bacteria 1521
84 Ga0495641_0069892 3300046461 Bacteria 1578
85 Ga0495641_0202303 3300046461 Bacteria 890
86 Ga0495653_0490971 3300046463 Bacteria 767
87 Ga0495639_0053769 3300046475 Bacteria 1835
88 Ga0495640_0771840 3300046533 Unclassified 574
89 Ga0495676_0075362 3300047321 Bacteria 2581
90 Ga0495680_0345660 3300047322 Bacteria 1037
91 Ga0496100_0002270 3300048903 Bacteria 9712
92 Ga0496100_0020709 3300048903 Bacteria 3948
93 Ga0496100_0178298 3300048903 Bacteria 1535
94 Ga0496101_0000008 3300048904 Bacteria 309720
95 Ga0496101_0091713 3300048904 Bacteria 2261
96 Ga0496101_0096267 3300048904 Bacteria 2209
97 Ga0496101_0154412 3300048904 Bacteria 1757
98 Ga0496102_0000005 3300048905 Bacteria 481937
99 Ga0496102_0018126 3300048905 Bacteria 6178
100 Ga0496102_0155646 3300048905 Bacteria 2148
101 Ga0496102_0440605 3300048905 Bacteria 1222
102 Ga0496103_0000002 3300048906 Bacteria 605387
103 Ga0496103_0044079 3300048906 Bacteria 2748
104 Ga0496103_0101046 3300048906 Bacteria 1825
105 Ga0496103_0140295 3300048906 Bacteria 1545
106 Ga0496104_0045315 3300048907 Bacteria 4135
107 Ga0496104_0138146 3300048907 Bacteria 2342
108 Ga0496104_0239752 3300048907 Bacteria 1726
109 Ga0496105_0045173 3300048908 Bacteria 3634
110 Ga0496106_0008446 3300048909 Bacteria 7620
111 Ga0496107_0047643 3300048910 Bacteria 3086
112 Ga0496107_0243442 3300048910 Bacteria 1338
113 Ga0496108_0085895 3300048911 Bacteria 2671
114 Ga0496108_0400982 3300048911 Bacteria 1198
115 Ga0496109_0009358 3300048912 Bacteria 8346
116 Ga0496109_0014080 3300048912 Bacteria 6953
117 Ga0496109_0045300 3300048912 Bacteria 3991
118 Ga0496109_0135744 3300048912 Bacteria 2298
119 Ga0496109_0524947 3300048912 Bacteria 1117
120 Ga0496110_0011142 3300048913 Bacteria 7347
121 Ga0496110_0076733 3300048913 Bacteria 2971
122 Ga0496110_0116714 3300048913 Bacteria 2403
123 Ga0496111_0046307 3300048914 Bacteria 3131
124 Ga0496113_0182492 3300048916 Bacteria 1664
125 Ga0496113_0225244 3300048916 Bacteria 1495
126 Ga0496113_0275391 3300048916 Bacteria 1345
127 Ga0496113_0277926 3300048916 Bacteria 1339
128 Ga0496114_0018265 3300048917 Bacteria 5668
129 Ga0496114_0058796 3300048917 Bacteria 3210
130 Ga0496114_0071686 3300048917 Bacteria 2912
131 Ga0496114_0189197 3300048917 Bacteria 1800
132 Ga0496114_0490914 3300048917 Bacteria 1086
133 Ga0496115_0043422 3300048918 Bacteria 3585
134 Ga0496115_0151365 3300048918 Bacteria 1916
135 Ga0496116_0000034 3300048919 Bacteria 409567
136 Ga0496117_0000003 3300048920 Bacteria 1881097
137 Ga0496118_0000001 3300048921 Bacteria 1881100
138 Ga0496119_0000368 3300048922 Bacteria 63141
139 Ga0496120_0000474 3300048923 Bacteria 63013
140 Ga0496121_0000120 3300048924 Bacteria 174571
141 Ga0496126_0000417 3300048929 Bacteria 86182
142 Ga0501036_0153879 3300049572 Bacteria 1940
143 Ga0501038_0859083 3300049574 Bacteria 672
144 Ga0501042_0176534 3300049578 Bacteria 1541
145 Ga0501067_0003365 3300049583 Bacteria 8792
146 Ga0501067_0095902 3300049583 Bacteria 1647
147 Ga0501069_0179625 3300049585 Bacteria 1223
148 Ga0501069_0352237 3300049585 Bacteria 868
149 Ga0501070_0565372 3300049586 Bacteria 909
150 Ga0501074_0195686 3300049590 Bacteria 1441
151 Ga0501075_0442466 3300049591 Bacteria 991
152 Ga0501077_0128145 3300049593 Bacteria 1609
153 Ga0501238_050248 3300049671 Bacteria 624
154 Ga0501243_027242 3300049675 Bacteria 964
155 Ga0501271_043834 3300049768 Bacteria 590
156 Ga0501045_0006075 3300049824 Bacteria 8365
157 Ga0501082_0742803 3300060353 Bacteria 859
158 Ga0530510_0376855 3300061734 Bacteria 1068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049671 Ga0501238_050248 Ga0501238_050248_34_546 167
2 3300049586 Ga0501070_0565372 Ga0501070_0565372_336_842 168
3 3300012494 Ga0157341_1008987 Ga0157341_10089872 171
4 3300013102 Ga0157371_10458459 Ga0157371_104584592 171
5 3300014745 Ga0157377_10360224 Ga0157377_103602242 171
6 3300048905 Ga0496102_0155646 Ga0496102_0155646_802_1317 171
7 3300048906 Ga0496103_0101046 Ga0496103_0101046_404_919 171
8 3300048907 Ga0496104_0138146 Ga0496104_0138146_1468_1983 171
9 3300048910 Ga0496107_0243442 Ga0496107_0243442_220_735 171
10 3300048912 Ga0496109_0135744 Ga0496109_0135744_1316_1831 171
11 3300048913 Ga0496110_0076733 Ga0496110_0076733_1399_1914 171
12 3300048914 Ga0496111_0046307 Ga0496111_0046307_1942_2457 171
13 3300048916 Ga0496113_0275391 Ga0496113_0275391_481_996 171
14 3300048917 Ga0496114_0490914 Ga0496114_0490914_376_891 171
15 3300049583 Ga0501067_0095902 Ga0501067_0095902_386_901 171
16 3300049585 Ga0501069_0179625 Ga0501069_0179625_433_948 171
17 3300048911 Ga0496108_0085895 Ga0496108_0085895_1274_1795 173
18 3300048913 Ga0496110_0011142 Ga0496110_0011142_4726_5247 173
19 iso_pu_bacteria 2811994874 2812332081 175
20 3300048917 Ga0496114_0071686 Ga0496114_0071686_776_1324 176
21 iso_pu_bacteria 2728369276 2729907464 176
22 3300044684 Ga0466966_0318502 Ga0466966_0318502_316_858 177
23 3300005937 Ga0081455_10101148 Ga0081455_101011483 178
24 3300026142 Ga0207698_11202534 Ga0207698_112025342 178
25 iso_pu_bacteria 2582580736 2583151362 178
26 iso_pu_bacteria 2808606439 2809198667 178
27 iso_pu_bacteria 2811994878 2812352761 178
28 3300031731 Ga0307405_10583252 Ga0307405_105832522 179
29 3300031852 Ga0307410_10052870 Ga0307410_100528702 179
30 3300031903 Ga0307407_10007321 Ga0307407_100073215 179
31 3300031911 Ga0307412_10241778 Ga0307412_102417782 179
32 3300031995 Ga0307409_100074406 Ga0307409_1000744065 179
33 3300032004 Ga0307414_10504266 Ga0307414_105042662 179
34 3300032005 Ga0307411_10066578 Ga0307411_100665784 179
35 3300032126 Ga0307415_100098875 Ga0307415_1000988752 179
36 3300041512 Ga0451853_2377865 Ga0451853_2377865_1694_2263 179
37 3300049675 Ga0501243_027242 Ga0501243_027242_99_638 179
38 3300049768 Ga0501271_043834 Ga0501271_043834_28_567 179
39 iso_pu_bacteria 2523231044 2523384512 179
40 iso_pu_bacteria 2687453737 2689959198 179
41 iso_pu_bacteria 2773857762 2774397017 179
42 iso_pu_bacteria 2891968417 2891969699 179
43 3300005614 Ga0068856_100614498 Ga0068856_1006144982 180
44 3300013105 Ga0157369_11032694 Ga0157369_110326942 180
45 3300013296 Ga0157374_10947315 Ga0157374_109473152 180
46 3300013307 Ga0157372_10766941 Ga0157372_107669412 180
47 3300031731 Ga0307405_10112267 Ga0307405_101122672 180
48 3300031824 Ga0307413_10119983 Ga0307413_101199832 180
49 3300031889 Ga0326468_10001072 Ga0326468_100010722 180
50 3300031901 Ga0307406_10826933 Ga0307406_108269331 180
51 3300031903 Ga0307407_10248740 Ga0307407_102487402 180
52 3300032005 Ga0307411_10283988 Ga0307411_102839881 180
53 3300032126 Ga0307415_100277971 Ga0307415_1002779712 180
54 3300037068 Ga0373925_0319633 Ga0373925_0319633_564_1106 180
55 3300038443 Ga0395901_0205977 Ga0395901_0205977_1488_2042 180
56 3300038443 Ga0395901_0412095 Ga0395901_0412095_229_777 180
57 3300042016 Ga0439463_097053 Ga0439463_097053_97_642 180
58 3300044842 Ga0466957_0228154 Ga0466957_0228154_459_1004 180
59 3300045836 Ga0466958_0370633 Ga0466958_0370633_151_696 180
60 3300046461 Ga0495641_0069892 Ga0495641_0069892_136_678 180
61 3300046461 Ga0495641_0202303 Ga0495641_0202303_265_807 180
62 3300046475 Ga0495639_0053769 Ga0495639_0053769_961_1503 180
63 3300046533 Ga0495640_0771840 Ga0495640_0771840_15_557 180
64 3300047321 Ga0495676_0075362 Ga0495676_0075362_1292_1834 180
65 3300048912 Ga0496109_0014080 Ga0496109_0014080_1580_2122 180
66 3300048916 Ga0496113_0225244 Ga0496113_0225244_497_1039 180
67 3300048916 Ga0496113_0277926 Ga0496113_0277926_122_664 180
68 3300048917 Ga0496114_0189197 Ga0496114_0189197_168_710 180
69 iso_pu_bacteria 2984576629 2984578817 180
70 iso_pu_bacteria 2990256926 2990257931 180
71 3300005329 Ga0070683_100187282 Ga0070683_1001872822 181
72 3300005337 Ga0070682_100170832 Ga0070682_1001708321 181
73 3300005535 Ga0070684_100088554 Ga0070684_1000885542 181
74 3300005614 Ga0068856_100258121 Ga0068856_1002581212 181
75 3300025927 Ga0207687_10106135 Ga0207687_101061353 181
76 3300025938 Ga0207704_10890946 Ga0207704_108909462 181
77 3300025945 Ga0207679_10700907 Ga0207679_107009072 181
78 3300026067 Ga0207678_11345407 Ga0207678_113454071 181
79 3300026078 Ga0207702_10502874 Ga0207702_105028742 181
80 3300044765 Ga0466970_0227532 Ga0466970_0227532_221_769 181
81 3300044901 Ga0466960_0643798 Ga0466960_0643798_47_595 181
82 3300045976 Ga0466967_0309655 Ga0466967_0309655_249_797 181
83 3300048907 Ga0496104_0239752 Ga0496104_0239752_1104_1703 181
84 3300049572 Ga0501036_0153879 Ga0501036_0153879_128_682 181
85 3300049574 Ga0501038_0859083 Ga0501038_0859083_29_583 181
86 3300049578 Ga0501042_0176534 Ga0501042_0176534_237_791 181
87 3300049583 Ga0501067_0003365 Ga0501067_0003365_1178_1723 181
88 3300049590 Ga0501074_0195686 Ga0501074_0195686_564_1118 181
89 3300049591 Ga0501075_0442466 Ga0501075_0442466_94_648 181
90 3300049824 Ga0501045_0006075 Ga0501045_0006075_4294_4848 181
91 3300061734 Ga0530510_0376855 Ga0530510_0376855_305_850 181
92 3300020070 Ga0206356_10640117 Ga0206356_106401171 182
93 3300041413 Ga0439465_0168205 Ga0439465_0168205_32_583 182
94 3300044684 Ga0466966_0153791 Ga0466966_0153791_214_810 182
95 3300005614 Ga0068856_101331659 Ga0068856_1013316592 183
96 3300026078 Ga0207702_10818873 Ga0207702_108188732 183
97 3300037466 Ga0395898_0782282 Ga0395898_0782282_309_869 183
98 3300044683 Ga0466965_0004758 Ga0466965_0004758_733_1290 183
99 3300044901 Ga0466960_0000590 Ga0466960_0000590_8787_9344 183
100 3300048903 Ga0496100_0178298 Ga0496100_0178298_334_897 183
101 3300048904 Ga0496101_0091713 Ga0496101_0091713_1617_2180 183
102 3300048904 Ga0496101_0096267 Ga0496101_0096267_1610_2173 183
103 3300048905 Ga0496102_0018126 Ga0496102_0018126_2136_2699 183
104 3300048905 Ga0496102_0440605 Ga0496102_0440605_136_699 183
105 3300048906 Ga0496103_0044079 Ga0496103_0044079_2047_2610 183
106 3300048906 Ga0496103_0140295 Ga0496103_0140295_181_744 183
107 3300048907 Ga0496104_0045315 Ga0496104_0045315_242_805 183
108 3300048908 Ga0496105_0045173 Ga0496105_0045173_734_1297 183
109 3300048910 Ga0496107_0047643 Ga0496107_0047643_1601_2164 183
110 3300048911 Ga0496108_0400982 Ga0496108_0400982_117_680 183
111 3300048912 Ga0496109_0009358 Ga0496109_0009358_3928_4491 183
112 3300048912 Ga0496109_0524947 Ga0496109_0524947_462_1025 183
113 3300048916 Ga0496113_0182492 Ga0496113_0182492_1050_1613 183
114 3300048917 Ga0496114_0018265 Ga0496114_0018265_4592_5155 183
115 3300048917 Ga0496114_0058796 Ga0496114_0058796_1382_1945 183
116 3300048918 Ga0496115_0043422 Ga0496115_0043422_925_1488 183
117 3300048918 Ga0496115_0151365 Ga0496115_0151365_392_955 183
118 3300005539 Ga0068853_100808085 Ga0068853_1008080852 184
119 3300005563 Ga0068855_100122274 Ga0068855_1001222743 184
120 3300009148 Ga0105243_10758232 Ga0105243_107582322 184
121 3300009545 Ga0105237_10001164 Ga0105237_1000116429 184
122 3300010375 Ga0105239_10011511 Ga0105239_100115112 184
123 3300025914 Ga0207671_10003116 Ga0207671_1000311610 184
124 3300025935 Ga0207709_10527583 Ga0207709_105275832 184
125 3300025949 Ga0207667_10217004 Ga0207667_102170042 184
126 3300048903 Ga0496100_0002270 Ga0496100_0002270_7159_7728 184
127 3300048904 Ga0496101_0000008 Ga0496101_0000008_191622_192191 184
128 3300048905 Ga0496102_0000005 Ga0496102_0000005_343077_343646 184
129 3300048906 Ga0496103_0000002 Ga0496103_0000002_138322_138891 184
130 3300048909 Ga0496106_0008446 Ga0496106_0008446_3755_4324 184
131 3300048919 Ga0496116_0000034 Ga0496116_0000034_270943_271512 184
132 3300048920 Ga0496117_0000003 Ga0496117_0000003_730458_731027 184
133 3300048921 Ga0496118_0000001 Ga0496118_0000001_730461_731030 184
134 3300048922 Ga0496119_0000368 Ga0496119_0000368_49708_50277 184
135 3300048923 Ga0496120_0000474 Ga0496120_0000474_49708_50277 184
136 3300048924 Ga0496121_0000120 Ga0496121_0000120_66713_67282 184
137 3300048929 Ga0496126_0000417 Ga0496126_0000417_54510_55079 184
138 3300031824 Ga0307413_11151081 Ga0307413_111510811 185
139 3300031852 Ga0307410_10566794 Ga0307410_105667942 185
140 3300031903 Ga0307407_10605735 Ga0307407_106057352 185
141 3300032002 Ga0307416_100404893 Ga0307416_1004048932 185
142 3300032002 Ga0307416_101789951 Ga0307416_1017899511 185
143 3300032005 Ga0307411_10722338 Ga0307411_107223382 185
144 3300048912 Ga0496109_0045300 Ga0496109_0045300_1738_2298 186
145 3300049593 Ga0501077_0128145 Ga0501077_0128145_494_1069 187
146 3300060353 Ga0501082_0742803 Ga0501082_0742803_261_842 188
147 3300046463 Ga0495653_0490971 Ga0495653_0490971_84_668 189
148 3300047322 Ga0495680_0345660 Ga0495680_0345660_253_837 189
149 iso_pu_bacteria 2808606365 2808874735 189
150 iso_pu_bacteria 2811994882 2812373537 191
151 iso_pu_bacteria 2818991469 2819728509 191
152 3300005329 Ga0070683_100330136 Ga0070683_1003301362 193
153 3300005535 Ga0070684_100109727 Ga0070684_1001097273 193
154 3300005577 Ga0068857_100045332 Ga0068857_1000453323 193
155 3300025944 Ga0207661_10062559 Ga0207661_100625592 193
156 3300031995 Ga0307409_100035493 Ga0307409_1000354934 193
157 3300032004 Ga0307414_10576881 Ga0307414_105768812 193
158 3300037418 Ga0395900_0434658 Ga0395900_0434658_471_1067 193
159 3300037466 Ga0395898_0128746 Ga0395898_0128746_1266_1862 193
160 3300037466 Ga0395898_1028994 Ga0395898_1028994_45_641 193
161 3300038443 Ga0395901_0066926 Ga0395901_0066926_78_674 193
162 3300048903 Ga0496100_0020709 Ga0496100_0020709_2130_2750 193
163 3300048904 Ga0496101_0154412 Ga0496101_0154412_437_1057 193
164 3300006237 Ga0097621_101087346 Ga0097621_1010873461 196
165 3300006358 Ga0068871_101030764 Ga0068871_1010307642 196
166 3300049585 Ga0501069_0352237 Ga0501069_0352237_254_844 196
167 3300044706 Ga0466964_0113717 Ga0466964_0113717_555_1166 198
168 3300005329 Ga0070683_100115928 Ga0070683_1001159283 199
169 3300013307 Ga0157372_10152296 Ga0157372_101522963 199
170 3300025932 Ga0207690_10416110 Ga0207690_104161102 199
171 3300032002 Ga0307416_100160585 Ga0307416_1001605853 199
172 3300048913 Ga0496110_0116714 Ga0496110_0116714_1376_1981 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00775

Dioxygenase_C

Dioxygenase

30

129

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bux-assembly1.cif.gz_A crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h 0.8546 28 196
3lkt-assembly1.cif.gz_A tyrosine 447 of protocatechuate 3,4-dioxygenase controls efficient progress through catalysis 0.8503 26 196
2bum-assembly1.cif.gz_A crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 0.8217 24 196
1eo9-assembly1.cif.gz_A crystal structure of acinetobacter sp. adp1 protocatechuate 3,4-dioxygenase at ph < 7.0 0.8201 25 196
3e8v-assembly1.cif.gz_A crystal structure of a possible transglutaminase-family protein proteolytic fragment from bacteroides fragilis 0.7403 48 186
ID Description Score Start End Superfamily
1ykkA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8538 26 196 2.60.130.10
af_P42787_1224_1309_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7676 50 145 2.60.40.1120
3e8vA00 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7403 48 186 2.60.40.1120
af_P42787_763_851_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7391 49 189 2.60.40.1120
af_I1LMT9_39_137_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7378 57 106 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A3D4FRG6-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit alpha 0.9645 98 196 GO:0005506
GO:0009056
GO:0018578
AF-A0A3D4FRG6-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit alpha 0.9551 98 196 GO:0005506
GO:0009056
GO:0018578
AF-A0A352Y4M8-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit alpha 0.9365 108 196 GO:0005506
GO:0009056
GO:0018578
AF-A0A520HDS6-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit alpha 0.9301 110 196 GO:0005506
GO:0016702
AF-A0A0Q4H2L1-F1-model_v4 Intradiol ring-cleavage dioxygenases domain-containing protein 0.9206 30 199 GO:0008199
GO:0009056
GO:0018578

Feature Viewer

pLDDT pTM Quality
83.56 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map