F261164

General Info

Members Datasets Scaffolds Average Seq Length
172 83 166 383

Family's Representative Sequence

Representative Sequence 3300042001|Ga0439441_002343|Ga0439441_002343_458_1681
Length 407
Sequence MHQWSSGHGADAVASVRLDRFRLLDVRRLPSPCFVVDEVAIEENLRLLLRVQQDSGAKILLALKAFSMWSLAPLVARYLAGTCASGVHEARLGREEFGGEVHVFCAAFSEPDLKEVLGLADHVVFNSPSQWQRFRPLARAALAARPSLRFGLRVNPEHSEGQVPMYDPCAPGSRLGAPRSAIAAADLEGLTGLHFHTLCEQDLPPLVRTLAAFEEKFGDLLVGMQWVNFGGGHHITRPGYQVEELVRVLRNFAARHRVQVYLEPGEAIGYHAGVMVAEVLDIVHNGIPIAILDTSATCHMPDVLEMPYRPSIIGASEPGAQALAYPHTYRLGGQSCLAGDVIGDYSFAKPLAIGQRLVFEDMAYYSMVKTTTFNGVRLPSIALWNSASGAIRVVREFGYEDFKGRLS

Samples

Sample ID Description Type Environment
1 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
2 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
3 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
4 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
5 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
6 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
27 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
28 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
29 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
30 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
31 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
32 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
33 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
34 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
35 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
36 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
38 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
39 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
40 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
41 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
42 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
43 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
44 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
45 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
46 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
47 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
48 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
49 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
50 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
51 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
52 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
53 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
54 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
55 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
56 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
57 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
58 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
59 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
60 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
61 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
66 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
67 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
68 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
69 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
70 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
71 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
72 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
74 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
75 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
76 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
77 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
78 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
79 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
80 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
81 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
82 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
83 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.93
Metatranscriptomes 0.58
Isolates 3.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 0
Rhizosphere 81.4
Stem 0
Stem Tuber 0
Unclassified 17.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10031238 3300003323 Bacteria 14566
2 Ga0070707_100168377 3300005468 Bacteria 2135
3 Ga0070698_100202672 3300005471 Bacteria 1919
4 Ga0070704_100006207 3300005549 Bacteria 7023
5 Ga0070704_100072501 3300005549 Bacteria 2505
6 Ga0068859_100113135 3300005617 Bacteria 2778
7 Ga0068861_100192034 3300005719 Bacteria 1708
8 Ga0075428_100046980 3300006844 Bacteria 4742
9 Ga0075430_100096701 3300006846 Bacteria 2468
10 Ga0075431_100002323 3300006847 Bacteria 18270
11 Ga0075431_100009573 3300006847 Bacteria 9732
12 Ga0075431_100048790 3300006847 Bacteria 4367
13 Ga0075431_100054142 3300006847 Bacteria 4137
14 Ga0075431_100290291 3300006847 Bacteria 1655
15 Ga0075429_100000007 3300006880 Bacteria 90776
16 Ga0075429_100025936 3300006880 Bacteria 5088
17 Ga0097620_100113138 3300006931 Bacteria 2778
18 Ga0075435_100128277 3300007076 Bacteria 2121
19 Ga0111539_10001937 3300009094 Bacteria 27602
20 Ga0111539_10262441 3300009094 Bacteria 2010
21 Ga0111539_10580226 3300009094 Bacteria 1306
22 Ga0105245_10041878 3300009098 Bacteria 4084
23 Ga0114129_10120451 3300009147 Bacteria 3613
24 Ga0114129_10220605 3300009147 Bacteria 2558
25 Ga0105242_10019677 3300009176 Bacteria 5290
26 Ga0105249_10258207 3300009553 Bacteria 1730
27 Ga0207687_10050459 3300025927 Bacteria 2896
28 Ga0207686_10021607 3300025934 Bacteria 3696
29 Ga0207428_10093678 3300027907 Bacteria 2329
30 Ga0265327_10043394 3300031251 Bacteria 2406
31 Ga0265316_10193230 3300031344 Bacteria 1511
32 Ga0307408_100001639 3300031548 Bacteria 16508
33 Ga0307408_100008121 3300031548 Bacteria 6937
34 Ga0316579_10001535 3300031691 Bacteria 8418
35 Ga0316579_10022515 3300031691 Bacteria 2818
36 Ga0316576_10017286 3300031727 Bacteria 4895
37 Ga0316578_10033085 3300031728 Bacteria 2959
38 Ga0316578_10045156 3300031728 Bacteria 2564
39 Ga0307406_10001124 3300031901 Bacteria 14950
40 Ga0307416_100068765 3300032002 Bacteria 2928
41 Ga0307415_100091065 3300032126 Bacteria 2208
42 Ga0316593_10009593 3300032168 Bacteria 2741
43 Ga0373928_0001695 3300035084 Bacteria 4274
44 Ga0316574_0014530 3300035398 Bacteria 4552
45 Ga0316574_0016391 3300035398 Bacteria 4318
46 Ga0316574_0019796 3300035398 Bacteria 3976
47 Ga0316574_0264072 3300035398 Bacteria 1099
48 Ga0373935_0091578 3300035692 Bacteria 1991
49 Ga0373927_0018678 3300035695 Bacteria 4551
50 Ga0373937_0260372 3300036401 Bacteria 1636
51 Ga0400483_075161 3300039062 Bacteria 103046
52 Ga0400483_090298 3300039062 Bacteria 2388
53 Ga0400483_126593 3300039062 Bacteria 4301
54 Ga0400483_193156 3300039062 Bacteria 15624
55 Ga0439441_002343 3300042001 Bacteria 2658
56 Ga0451577_0000578 3300042876 Bacteria 59283
57 Ga0451577_0001000 3300042876 Bacteria 41091
58 Ga0451577_0004194 3300042876 Bacteria 15374
59 Ga0451577_0009362 3300042876 Bacteria 9441
60 Ga0451577_0024439 3300042876 Bacteria 5497
61 Ga0451577_0035545 3300042876 Bacteria 4488
62 Ga0451577_0072372 3300042876 Bacteria 3075
63 Ga0451577_0124894 3300042876 Bacteria 2306
64 Ga0451577_0131869 3300042876 Bacteria 2242
65 Ga0451577_0148005 3300042876 Bacteria 2112
66 Ga0451577_0154424 3300042876 Bacteria 2065
67 Ga0453683_0000014 3300044673 Bacteria 364381
68 Ga0453683_0000018 3300044673 Bacteria 309212
69 Ga0453683_0000034 3300044673 Bacteria 235218
70 Ga0453683_0000144 3300044673 Bacteria 104524
71 Ga0453683_0001056 3300044673 Bacteria 25615
72 Ga0453683_0001888 3300044673 Bacteria 17166
73 Ga0453683_0004115 3300044673 Bacteria 10451
74 Ga0453683_0019346 3300044673 Bacteria 4363
75 Ga0453683_0133929 3300044673 Bacteria 1562
76 Ga0453684_0000380 3300044712 Bacteria 182003
77 Ga0453684_0000629 3300044712 Bacteria 128399
78 Ga0453684_0000819 3300044712 Bacteria 105316
79 Ga0453684_0000854 3300044712 Bacteria 102660
80 Ga0453684_0001355 3300044712 Bacteria 71485
81 Ga0453684_0001809 3300044712 Bacteria 56649
82 Ga0453684_0002495 3300044712 Bacteria 44446
83 Ga0453684_0013657 3300044712 Bacteria 13157
84 Ga0453684_0015906 3300044712 Bacteria 11831
85 Ga0453684_0016103 3300044712 Bacteria 11731
86 Ga0453684_0019538 3300044712 Bacteria 10302
87 Ga0453684_0027176 3300044712 Bacteria 8219
88 Ga0453684_0042803 3300044712 Bacteria 6098
89 Ga0453684_0046122 3300044712 Bacteria 5802
90 Ga0453684_0050238 3300044712 Bacteria 5489
91 Ga0453684_0078512 3300044712 Bacteria 4131
92 Ga0453684_0114948 3300044712 Bacteria 3261
93 Ga0453684_0116171 3300044712 Bacteria 3242
94 Ga0453684_0150477 3300044712 Bacteria 2766
95 Ga0453684_0160925 3300044712 Bacteria 2655
96 Ga0453684_0211568 3300044712 Bacteria 2253
97 Ga0453684_0222960 3300044712 Bacteria 2182
98 Ga0453684_0313642 3300044712 Bacteria 1778
99 Ga0451576_0000031 3300045051 Bacteria 399742
100 Ga0451576_0000824 3300045051 Bacteria 60438
101 Ga0451576_0005158 3300045051 Bacteria 16537
102 Ga0451576_0007646 3300045051 Bacteria 12849
103 Ga0451576_0012925 3300045051 Bacteria 9355
104 Ga0451576_0015144 3300045051 Bacteria 8557
105 Ga0451576_0088463 3300045051 Bacteria 3222
106 Ga0451576_0119995 3300045051 Bacteria 2738
107 Ga0451576_0137002 3300045051 Bacteria 2553
108 Ga0451576_0343246 3300045051 Bacteria 1563
109 Ga0451576_0443777 3300045051 Bacteria 1362
110 Ga0451576_0633909 3300045051 Bacteria 1123
111 Ga0495594_0067819 3300046499 Bacteria 1981
112 Ga0495654_0036039 3300046530 Bacteria 2488
113 Ga0496116_0008185 3300048919 Bacteria 9123
114 Ga0496116_0009847 3300048919 Bacteria 8091
115 Ga0496117_0001225 3300048920 Bacteria 38442
116 Ga0496118_0023774 3300048921 Bacteria 5310
117 Ga0496119_0000231 3300048922 Bacteria 78482
118 Ga0496120_0000574 3300048923 Bacteria 56160
119 Ga0496120_0000677 3300048923 Bacteria 50036
120 Ga0496120_0018794 3300048923 Bacteria 4440
121 Ga0496120_0022520 3300048923 Bacteria 3961
122 Ga0496120_0040537 3300048923 Bacteria 2736
123 Ga0496120_0058452 3300048923 Bacteria 2166
124 Ga0496121_0049613 3300048924 Bacteria 3557
125 Ga0496122_0000314 3300048925 Bacteria 106928
126 Ga0496122_0000323 3300048925 Bacteria 104259
127 Ga0496122_0003641 3300048925 Bacteria 20035
128 Ga0496123_0002177 3300048926 Bacteria 24990
129 Ga0496123_0049795 3300048926 Bacteria 2805
130 Ga0496124_0016118 3300048927 Bacteria 7129
131 Ga0496124_0179649 3300048927 Bacteria 1630
132 Ga0496125_0000556 3300048928 Bacteria 64234
133 Ga0496126_0000060 3300048929 Bacteria 264944
134 Ga0496126_0000316 3300048929 Bacteria 102929
135 Ga0496126_0002389 3300048929 Bacteria 25532
136 Ga0501033_0059751 3300049570 Bacteria 2815
137 Ga0501039_0097799 3300049575 Bacteria 2289
138 Ga0501041_0031109 3300049577 Bacteria 3222
139 Ga0501041_0098252 3300049577 Bacteria 1811
140 Ga0501042_0001369 3300049578 Bacteria 14310
141 Ga0501071_0009013 3300049587 Bacteria 6624
142 Ga0501072_0011152 3300049588 Bacteria 6860
143 Ga0501075_0016430 3300049591 Bacteria 5332
144 Ga0501076_0072269 3300049592 Bacteria 2760
145 Ga0501077_0010968 3300049593 Bacteria 5649
146 Ga0501077_0015940 3300049593 Bacteria 4735
147 Ga0501079_0031285 3300049741 Bacteria 4090
148 Ga0501079_0234125 3300049741 Bacteria 1435
149 Ga0501080_0125492 3300049742 Bacteria 2377
150 Ga0501044_0158573 3300049823 Bacteria 2241
151 Ga0501045_0021305 3300049824 Bacteria 4636
152 nmdc:mga05p37_145_c1 3300050507 Bacteria 66709
153 nmdc:mga05p37_182002_c1 3300050507 Bacteria 2556
154 nmdc:mga09592_17991_c1 3300050508 Bacteria 5791
155 nmdc:mga09592_510_c1 3300050508 Bacteria 29388
156 nmdc:mga0qj67_124004_c1 3300050509 Bacteria 2090
157 nmdc:mga06r32_14209_c1 3300050510 Bacteria 7222
158 nmdc:mga06r32_61347_c1 3300050510 Bacteria 3619
159 nmdc:mga06r32_86465_c1 3300050510 Bacteria 3058
160 nmdc:mga06r32_924_c1 3300050510 Bacteria 26100
161 nmdc:mga08y16_312373_c1 3300050511 Bacteria 1619
162 Ga0500556_0000264 3300053104 Bacteria 41588
163 Ga0500562_034298 3300053108 Bacteria 1342
164 Ga0501084_0040489 3300054114 Bacteria 3898
165 Ga0501082_0007810 3300060353 Bacteria 9233
166 Ga0530510_0002264 3300061734 Bacteria 13196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0264072 Ga0316574_0264072_53_1054 333
2 3300042876 Ga0451577_0154424 Ga0451577_0154424_1050_2051 333
3 3300039062 Ga0400483_090298 Ga0400483_090298_1330_2355 339
4 3300045051 Ga0451576_0633909 Ga0451576_0633909_86_1108 340
5 3300032168 Ga0316593_10009593 Ga0316593_100095932 363
6 3300036401 Ga0373937_0260372 Ga0373937_0260372_15_1115 366
7 3300049823 Ga0501044_0158573 Ga0501044_0158573_1071_2186 369
8 iso_pu_bacteria 2857609550 2857611559 369
9 iso_pu_bacteria 2956897341 2956901017 370
10 iso_pu_bacteria 3001272096 3001275489 370
11 iso_pu_bacteria 3006988479 3006990382 370
12 3300006844 Ga0075428_100046980 Ga0075428_1000469808 372
13 3300006847 Ga0075431_100048790 Ga0075431_1000487903 372
14 3300009147 Ga0114129_10120451 Ga0114129_101204512 372
15 3300044673 Ga0453683_0019346 Ga0453683_0019346_824_1954 372
16 3300046530 Ga0495654_0036039 Ga0495654_0036039_976_2106 372
17 3300048919 Ga0496116_0008185 Ga0496116_0008185_3629_4750 372
18 3300048919 Ga0496116_0009847 Ga0496116_0009847_2597_3718 372
19 3300048920 Ga0496117_0001225 Ga0496117_0001225_20797_21918 372
20 3300048921 Ga0496118_0023774 Ga0496118_0023774_2748_3869 372
21 3300048922 Ga0496119_0000231 Ga0496119_0000231_54160_55281 372
22 3300048923 Ga0496120_0000574 Ga0496120_0000574_26453_27574 372
23 3300048923 Ga0496120_0000677 Ga0496120_0000677_35272_36393 372
24 3300048923 Ga0496120_0018794 Ga0496120_0018794_120_1241 372
25 3300048923 Ga0496120_0022520 Ga0496120_0022520_1015_2136 372
26 3300048923 Ga0496120_0058452 Ga0496120_0058452_1016_2137 372
27 3300048925 Ga0496122_0003641 Ga0496122_0003641_106_1227 372
28 3300048926 Ga0496123_0002177 Ga0496123_0002177_5061_6182 372
29 3300048927 Ga0496124_0179649 Ga0496124_0179649_420_1541 372
30 3300048928 Ga0496125_0000556 Ga0496125_0000556_40820_41941 372
31 3300048929 Ga0496126_0002389 Ga0496126_0002389_4694_5815 372
32 3300050510 nmdc:mga06r32_61347_c1 nmdc:mga06r32_61347_c1_2024_3160 372
33 3300006846 Ga0075430_100096701 Ga0075430_1000967011 373
34 3300006847 Ga0075431_100002323 Ga0075431_10000232314 373
35 3300006847 Ga0075431_100290291 Ga0075431_1002902911 373
36 3300006880 Ga0075429_100025936 Ga0075429_1000259364 373
37 3300009094 Ga0111539_10001937 Ga0111539_1000193718 373
38 3300027907 Ga0207428_10093678 Ga0207428_100936782 373
39 3300032002 Ga0307416_100068765 Ga0307416_1000687652 373
40 3300032126 Ga0307415_100091065 Ga0307415_1000910653 373
41 3300048924 Ga0496121_0049613 Ga0496121_0049613_2410_3534 373
42 3300048927 Ga0496124_0016118 Ga0496124_0016118_44_1183 373
43 3300050507 nmdc:mga05p37_182002_c1 nmdc:mga05p37_182002_c1_1191_2330 373
44 3300050508 nmdc:mga09592_17991_c1 nmdc:mga09592_17991_c1_3423_4562 373
45 3300050509 nmdc:mga0qj67_124004_c1 nmdc:mga0qj67_124004_c1_747_1886 373
46 3300050510 nmdc:mga06r32_14209_c1 nmdc:mga06r32_14209_c1_4413_5552 373
47 3300050511 nmdc:mga08y16_312373_c1 nmdc:mga08y16_312373_c1_310_1449 373
48 3300053104 Ga0500556_0000264 Ga0500556_0000264_22730_23869 373
49 3300053108 Ga0500562_034298 Ga0500562_034298_29_1168 373
50 3300044712 Ga0453684_0042803 Ga0453684_0042803_186_1316 374
51 3300045051 Ga0451576_0443777 Ga0451576_0443777_139_1269 374
52 3300042876 Ga0451577_0072372 Ga0451577_0072372_456_1604 378
53 3300042876 Ga0451577_0124894 Ga0451577_0124894_426_1574 378
54 3300042876 Ga0451577_0131869 Ga0451577_0131869_504_1652 378
55 3300044712 Ga0453684_0001809 Ga0453684_0001809_36499_37647 378
56 3300044712 Ga0453684_0050238 Ga0453684_0050238_1124_2272 378
57 3300044712 Ga0453684_0078512 Ga0453684_0078512_2137_3285 378
58 3300044712 Ga0453684_0116171 Ga0453684_0116171_1187_2335 378
59 3300045051 Ga0451576_0005158 Ga0451576_0005158_4610_5758 378
60 3300045051 Ga0451576_0343246 Ga0451576_0343246_81_1229 378
61 3300048923 Ga0496120_0040537 Ga0496120_0040537_1261_2400 378
62 3300048925 Ga0496122_0000314 Ga0496122_0000314_7707_8846 378
63 3300048929 Ga0496126_0000060 Ga0496126_0000060_7759_8898 378
64 3300031251 Ga0265327_10043394 Ga0265327_100433942 380
65 3300031344 Ga0265316_10193230 Ga0265316_101932301 380
66 3300035084 Ga0373928_0001695 Ga0373928_0001695_1580_2734 380
67 3300035398 Ga0316574_0019796 Ga0316574_0019796_1910_3064 380
68 3300035692 Ga0373935_0091578 Ga0373935_0091578_807_1961 380
69 3300035695 Ga0373927_0018678 Ga0373927_0018678_977_2131 380
70 3300042876 Ga0451577_0000578 Ga0451577_0000578_6699_7853 380
71 3300042876 Ga0451577_0001000 Ga0451577_0001000_35373_36527 380
72 3300042876 Ga0451577_0009362 Ga0451577_0009362_6158_7312 380
73 3300042876 Ga0451577_0024439 Ga0451577_0024439_838_1992 380
74 3300042876 Ga0451577_0035545 Ga0451577_0035545_2519_3679 380
75 3300042876 Ga0451577_0148005 Ga0451577_0148005_756_1910 380
76 3300044673 Ga0453683_0000014 Ga0453683_0000014_59120_60274 380
77 3300044673 Ga0453683_0000018 Ga0453683_0000018_279908_281062 380
78 3300044673 Ga0453683_0000034 Ga0453683_0000034_65932_67086 380
79 3300044673 Ga0453683_0000144 Ga0453683_0000144_69424_70578 380
80 3300044673 Ga0453683_0001056 Ga0453683_0001056_5692_6846 380
81 3300044673 Ga0453683_0001888 Ga0453683_0001888_3666_4820 380
82 3300044673 Ga0453683_0004115 Ga0453683_0004115_860_2014 380
83 3300044673 Ga0453683_0133929 Ga0453683_0133929_98_1252 380
84 3300044712 Ga0453684_0000380 Ga0453684_0000380_41525_42679 380
85 3300044712 Ga0453684_0000819 Ga0453684_0000819_61014_62168 380
86 3300044712 Ga0453684_0000854 Ga0453684_0000854_51929_53083 380
87 3300044712 Ga0453684_0002495 Ga0453684_0002495_36617_37771 380
88 3300044712 Ga0453684_0013657 Ga0453684_0013657_7280_8434 380
89 3300044712 Ga0453684_0015906 Ga0453684_0015906_3195_4349 380
90 3300044712 Ga0453684_0016103 Ga0453684_0016103_8997_10151 380
91 3300044712 Ga0453684_0019538 Ga0453684_0019538_797_1951 380
92 3300044712 Ga0453684_0027176 Ga0453684_0027176_88_1242 380
93 3300044712 Ga0453684_0046122 Ga0453684_0046122_359_1513 380
94 3300044712 Ga0453684_0114948 Ga0453684_0114948_2073_3227 380
95 3300044712 Ga0453684_0150477 Ga0453684_0150477_671_1825 380
96 3300044712 Ga0453684_0160925 Ga0453684_0160925_267_1421 380
97 3300044712 Ga0453684_0211568 Ga0453684_0211568_1019_2173 380
98 3300044712 Ga0453684_0222960 Ga0453684_0222960_314_1468 380
99 3300044712 Ga0453684_0313642 Ga0453684_0313642_70_1224 380
100 3300045051 Ga0451576_0000031 Ga0451576_0000031_71793_72947 380
101 3300045051 Ga0451576_0007646 Ga0451576_0007646_5488_6642 380
102 3300045051 Ga0451576_0012925 Ga0451576_0012925_2842_3996 380
103 3300045051 Ga0451576_0015144 Ga0451576_0015144_6311_7471 380
104 3300045051 Ga0451576_0088463 Ga0451576_0088463_617_1771 380
105 3300045051 Ga0451576_0137002 Ga0451576_0137002_633_1787 380
106 3300042876 Ga0451577_0004194 Ga0451577_0004194_9360_10526 381
107 3300039062 Ga0400483_126593 Ga0400483_126593_119_1294 382
108 iso_pu_bacteria 3001267043 3001270140 382
109 3300009147 Ga0114129_10220605 Ga0114129_102206052 383
110 3300005468 Ga0070707_100168377 Ga0070707_1001683772 385
111 3300005471 Ga0070698_100202672 Ga0070698_1002026722 385
112 3300005549 Ga0070704_100006207 Ga0070704_1000062077 385
113 3300005617 Ga0068859_100113135 Ga0068859_1001131354 385
114 3300005719 Ga0068861_100192034 Ga0068861_1001920341 385
115 3300006847 Ga0075431_100009573 Ga0075431_1000095733 385
116 3300006847 Ga0075431_100054142 Ga0075431_1000541423 385
117 3300006880 Ga0075429_100000007 Ga0075429_10000000731 385
118 3300006931 Ga0097620_100113138 Ga0097620_1001131384 385
119 3300007076 Ga0075435_100128277 Ga0075435_1001282772 385
120 3300009094 Ga0111539_10262441 Ga0111539_102624412 385
121 3300009094 Ga0111539_10580226 Ga0111539_105802262 385
122 3300009098 Ga0105245_10041878 Ga0105245_100418782 385
123 3300009176 Ga0105242_10019677 Ga0105242_100196774 385
124 3300025927 Ga0207687_10050459 Ga0207687_100504592 385
125 3300025934 Ga0207686_10021607 Ga0207686_100216074 385
126 3300050507 nmdc:mga05p37_145_c1 nmdc:mga05p37_145_c1_4352_5521 385
127 3300050508 nmdc:mga09592_510_c1 nmdc:mga09592_510_c1_23980_25149 385
128 3300050510 nmdc:mga06r32_86465_c1 nmdc:mga06r32_86465_c1_116_1285 385
129 3300050510 nmdc:mga06r32_924_c1 nmdc:mga06r32_924_c1_2283_3452 385
130 3300044712 Ga0453684_0000629 Ga0453684_0000629_73732_74913 386
131 3300044712 Ga0453684_0001355 Ga0453684_0001355_27220_28380 386
132 3300045051 Ga0451576_0000824 Ga0451576_0000824_48547_49755 386
133 3300049570 Ga0501033_0059751 Ga0501033_0059751_419_1588 387
134 3300049575 Ga0501039_0097799 Ga0501039_0097799_208_1377 387
135 3300049577 Ga0501041_0031109 Ga0501041_0031109_1120_2289 387
136 3300049577 Ga0501041_0098252 Ga0501041_0098252_257_1420 387
137 3300049578 Ga0501042_0001369 Ga0501042_0001369_11547_12716 387
138 3300049587 Ga0501071_0009013 Ga0501071_0009013_3681_4850 387
139 3300049588 Ga0501072_0011152 Ga0501072_0011152_964_2133 387
140 3300049591 Ga0501075_0016430 Ga0501075_0016430_237_1406 387
141 3300049592 Ga0501076_0072269 Ga0501076_0072269_660_1829 387
142 3300049593 Ga0501077_0010968 Ga0501077_0010968_3947_5116 387
143 3300049593 Ga0501077_0015940 Ga0501077_0015940_2387_3550 387
144 3300049741 Ga0501079_0031285 Ga0501079_0031285_377_1546 387
145 3300049741 Ga0501079_0234125 Ga0501079_0234125_34_1197 387
146 3300049742 Ga0501080_0125492 Ga0501080_0125492_507_1676 387
147 3300049824 Ga0501045_0021305 Ga0501045_0021305_2582_3751 387
148 3300054114 Ga0501084_0040489 Ga0501084_0040489_1252_2421 387
149 3300060353 Ga0501082_0007810 Ga0501082_0007810_7990_9159 387
150 3300061734 Ga0530510_0002264 Ga0530510_0002264_8395_9564 387
151 3300009553 Ga0105249_10258207 Ga0105249_102582072 388
152 3300031691 Ga0316579_10022515 Ga0316579_100225152 388
153 3300039062 Ga0400483_193156 Ga0400483_193156_9599_10765 388
154 3300048925 Ga0496122_0000323 Ga0496122_0000323_97730_98908 388
155 3300048926 Ga0496123_0049795 Ga0496123_0049795_181_1359 388
156 3300048929 Ga0496126_0000316 Ga0496126_0000316_96568_97746 388
157 3300005549 Ga0070704_100072501 Ga0070704_1000725012 389
158 3300031691 Ga0316579_10001535 Ga0316579_100015355 389
159 3300031727 Ga0316576_10017286 Ga0316576_100172863 389
160 3300031728 Ga0316578_10033085 Ga0316578_100330852 389
161 3300031728 Ga0316578_10045156 Ga0316578_100451562 389
162 3300035398 Ga0316574_0014530 Ga0316574_0014530_2833_4011 389
163 3300035398 Ga0316574_0016391 Ga0316574_0016391_129_1319 389
164 3300042001 Ga0439441_002343 Ga0439441_002343_458_1681 389
165 3300045051 Ga0451576_0119995 Ga0451576_0119995_985_2175 389
166 3300046499 Ga0495594_0067819 Ga0495594_0067819_606_1796 389
167 iso_pu_bacteria 2738541276 2738715098 391
168 3300039062 Ga0400483_075161 Ga0400483_075161_30252_31442 394
169 3300003323 rootH1_10031238 rootH1_100312387 395
170 3300031548 Ga0307408_100001639 Ga0307408_10000163910 395
171 3300031548 Ga0307408_100008121 Ga0307408_1000081214 395
172 3300031901 Ga0307406_10001124 Ga0307406_1000112410 395

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00278

Orn_DAP_Arg_deC

Pyridoxal-dependent decarboxylase, C-terminal sheet domain

33

363

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mt1-assembly1.cif.gz_A crystal structure of putative carboxynorspermidine decarboxylase protein from sinorhizobium meliloti 0.9583 15 395
3mt1-assembly1.cif.gz_B crystal structure of putative carboxynorspermidine decarboxylase protein from sinorhizobium meliloti 0.9574 15 395
3mt1-assembly1.cif.gz_A crystal structure of putative carboxynorspermidine decarboxylase protein from sinorhizobium meliloti 0.9556 15 395
3mt1-assembly1.cif.gz_B crystal structure of putative carboxynorspermidine decarboxylase protein from sinorhizobium meliloti 0.9521 15 395
3n29-assembly1.cif.gz_B crystal structure of carboxynorspermidine decarboxylase complexed with norspermidine from campylobacter jejuni 0.9368 15 393
ID Description Score Start End Superfamily
3n29B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9665 25 260 3.20.20.10
3n29B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9491 25 260 3.20.20.10
3n29B01 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;Lyase, Ornithine Decarboxylase; Chain A, domain 1 0.9417 264 393 2.40.37.10
3mt1A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9347 25 260 3.20.20.10
3mt1B01 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;Lyase, Ornithine Decarboxylase; Chain A, domain 1 0.9314 264 395 2.40.37.10
ID Description Score Start End GO Terms
AF-A0A1B6NU86-F1-model_v4 Carboxynorspermidine decarboxylase 0.9935 48 119
AF-A0A522VN23-F1-model_v4 Carboxynorspermidine decarboxylase 0.9871 179 395 GO:0008836
GO:0009089
AF-A0A660MCU1-F1-model_v4 Carboxynorspermidine/carboxyspermidine decarboxylase (EC 4.1.1.96) 0.9869 7 299 GO:0008295
GO:0008836
GO:0009089
GO:0045312
AF-A0A5Q2QA11-F1-model_v4 Carboxynorspermidine/carboxyspermidine decarboxylase (CANS DC/CAS DC) (CANSDC/CASDC) (EC 4.1.1.96) 0.9856 7 394 GO:0005737
GO:0008295
GO:0008836
GO:0009089
GO:0045312
AF-A0A496K0B6-F1-model_v4 deleted 0.9856 253 354

Feature Viewer

pLDDT pTM Quality
92.02 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map