F261037

General Info

Members Datasets Scaffolds Average Seq Length
172 149 344 196

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100284316|Ga0307415_1002843162
Length 234
Sequence MNFAALAVLATTVLQAAGDPNVVYTAPPLSGEAIVRGYILPTLVGYLLGAIPFGLLLTRYAGLGDIRSVGSGNIGATNVLRTGHKGLAAATLVLDALKGTLAVVVGYYLGSLAGLATDASLMAGLAAFLGHIFPMWLNFKGGKGVATYIGVILGLYWPAALLFCAVWIAVAYLTRYSSLSALAASAVTPVALAAMNEVPAASLAVVMTGLLLWKHTANVKRLLKGEEPRIGAKA

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
50 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
55 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
56 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
57 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
58 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
75 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
78 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
79 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
83 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
84 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
98 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
99 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
100 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
101 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
102 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
125 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
128 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
131 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
132 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
135 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
136 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
137 2643221568 Rhizobium sp. Root564 Isolate Unclassified
138 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
139 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
140 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
141 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
142 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
143 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
144 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
145 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
146 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
147 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
148 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
149 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.28
Metatranscriptomes 0.58
Isolates 8.14

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 7.56
Nodule 2.33
Rhizoplane 7.56
Rhizosphere 71.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100284316 3300032126 Bacteria 1362
2 JGI24744J21845_10009482 3300002077 Bacteria 1996
3 Ga0065707_10136716 3300005295 Bacteria 1830
4 Ga0070666_10474362 3300005335 Bacteria 905
5 Ga0070669_100054908 3300005353 Bacteria 2918
6 Ga0070714_100259808 3300005435 Bacteria 1608
7 Ga0068853_100523945 3300005539 Bacteria 1121
8 Ga0070686_100190032 3300005544 Bacteria 1465
9 Ga0068855_100191319 3300005563 Bacteria 2308
10 Ga0068854_100034854 3300005578 Bacteria 3519
11 Ga0068856_100996931 3300005614 Bacteria 856
12 Ga0068859_100994455 3300005617 Bacteria 921
13 Ga0068861_100121254 3300005719 Bacteria 2110
14 Ga0068870_10176367 3300005840 Bacteria 1279
15 Ga0068858_100256067 3300005842 Bacteria 1663
16 Ga0068860_100277815 3300005843 Bacteria 1636
17 Ga0081539_10071428 3300005985 Bacteria 1859
18 Ga0070717_10578463 3300006028 Bacteria 1018
19 Ga0075365_10002917 3300006038 Bacteria 8634
20 Ga0075365_10094579 3300006038 Bacteria 2040
21 Ga0070716_100303847 3300006173 Bacteria 1111
22 Ga0075369_10244826 3300006186 Bacteria 832
23 Ga0097621_100844702 3300006237 Bacteria 850
24 Ga0075434_100043182 3300006871 Bacteria 4470
25 Ga0097620_100994581 3300006931 Bacteria 921
26 Ga0099824_1007084 3300006942 Bacteria 15049
27 Ga0105240_10667519 3300009093 Bacteria 1138
28 Ga0111539_10064660 3300009094 Bacteria 4326
29 Ga0105249_10003167 3300009553 Bacteria 14233
30 Ga0105239_10816543 3300010375 Bacteria 1069
31 Ga0105246_10417329 3300011119 Bacteria 1119
32 Ga0157371_10024763 3300013102 Bacteria 4379
33 Ga0157369_10107150 3300013105 Bacteria 2973
34 Ga0157369_10484932 3300013105 Bacteria 1279
35 Ga0157369_10595855 3300013105 Bacteria 1141
36 Ga0157374_10273725 3300013296 Bacteria 1665
37 Ga0157375_10080115 3300013308 Bacteria 3303
38 Ga0163163_10286825 3300014325 Bacteria 1698
39 Ga0157379_10647916 3300014968 Bacteria 989
40 Ga0163161_10032003 3300017792 Bacteria 3752
41 Ga0206353_10803458 3300020082 Bacteria 664
42 Ga0213875_10000025 3300021388 Bacteria 197787
43 Ga0207688_10103366 3300025901 Bacteria 1648
44 Ga0207647_10060109 3300025904 Bacteria 2324
45 Ga0207643_10190538 3300025908 Bacteria 1245
46 Ga0207687_10487414 3300025927 Bacteria 1027
47 Ga0207664_10290005 3300025929 Bacteria 1438
48 Ga0207712_10538131 3300025961 Bacteria 1003
49 Ga0207668_10110141 3300025972 Bacteria 2064
50 Ga0207640_10170028 3300025981 Bacteria 1623
51 Ga0207675_100297800 3300026118 Bacteria 1570
52 Ga0265325_10003453 3300031241 Bacteria 10312
53 Ga0265342_10225904 3300031712 Bacteria 1007
54 Ga0307413_10163406 3300031824 Bacteria 1567
55 Ga0307406_10062241 3300031901 Bacteria 2414
56 Ga0307416_100303728 3300032002 Bacteria 1588
57 Ga0307416_101800334 3300032002 Bacteria 716
58 Ga0307414_10326763 3300032004 Bacteria 1308
59 Ga0307415_100201907 3300032126 Bacteria 1578
60 Ga0373936_0478353 3300035113 Bacteria 578
61 Ga0373956_0036862 3300035119 Bacteria 2160
62 Ga0373931_0111947 3300035691 Bacteria 1550
63 Ga0373927_0098811 3300035695 Bacteria 1898
64 Ga0373933_0204160 3300035724 Bacteria 1265
65 Ga0373937_0006024 3300036401 Bacteria 10440
66 Ga0373937_0052063 3300036401 Bacteria 3753
67 Ga0373937_0290738 3300036401 Bacteria 1544
68 Ga0316582_0109320 3300036647 Bacteria 1839
69 Ga0316584_0422436 3300036712 Bacteria 947
70 Ga0373925_0946732 3300037068 Bacteria 710
71 Ga0395899_0026284 3300037312 Bacteria 4392
72 Ga0395900_0035106 3300037418 Bacteria 5165
73 Ga0395898_0032020 3300037466 Bacteria 5248
74 Ga0395898_0545176 3300037466 Bacteria 1102
75 Ga0436364_0206987 3300037853 Bacteria 14423
76 Ga0395901_0302786 3300038443 Bacteria 1657
77 Ga0436365_1649809 3300039437 Bacteria 966
78 Ga0436360_1024118 3300039438 Bacteria 849
79 Ga0436363_1208578 3300039450 Bacteria 7437
80 Ga0466958_0343861 3300045836 Bacteria 960
81 Ga0495592_0241170 3300046454 Bacteria 1199
82 Ga0495607_0027425 3300046501 Bacteria 3522
83 Ga0495618_0301219 3300046514 Bacteria 996
84 Ga0495630_0141017 3300046517 Bacteria 1833
85 Ga0495643_0150658 3300046522 Bacteria 1152
86 Ga0495667_0047206 3300046559 Bacteria 2846
87 Ga0495656_0276934 3300046615 Bacteria 854
88 Ga0495625_0406962 3300046660 Bacteria 849
89 Ga0495635_0036566 3300046663 Bacteria 3403
90 Ga0495658_0154764 3300046683 Bacteria 1410
91 Ga0495600_0064740 3300046809 Bacteria 2390
92 Ga0495674_0029596 3300047319 Bacteria 4986
93 Ga0495680_0026045 3300047322 Bacteria 4830
94 Ga0495684_0358756 3300047471 Bacteria 1033
95 Ga0496101_0142503 3300048904 Bacteria 1828
96 Ga0496104_0001125 3300048907 Bacteria 22885
97 Ga0496104_0075132 3300048907 Bacteria 3218
98 Ga0496105_0013404 3300048908 Bacteria 6506
99 Ga0496105_0382334 3300048908 Bacteria 1120
100 Ga0496107_0001990 3300048910 Bacteria 13010
101 Ga0496107_0152055 3300048910 Bacteria 1712
102 Ga0496108_0003920 3300048911 Bacteria 11953
103 Ga0496109_0001944 3300048912 Bacteria 17168
104 Ga0496110_0002635 3300048913 Bacteria 13516
105 Ga0496111_0013895 3300048914 Bacteria 5491
106 Ga0496112_0156529 3300048915 Bacteria 2245
107 Ga0496114_0004759 3300048917 Bacteria 10570
108 Ga0496116_0000043 3300048919 Bacteria 328085
109 Ga0496117_0049990 3300048920 Bacteria 2968
110 Ga0496118_0036747 3300048921 Bacteria 3954
111 Ga0496121_0002535 3300048924 Bacteria 27690
112 Ga0496122_0137748 3300048925 Bacteria 1534
113 Ga0496123_0025473 3300048926 Bacteria 4459
114 Ga0496124_0477233 3300048927 Bacteria 843
115 Ga0496126_0000369 3300048929 Bacteria 92814
116 Ga0501032_0024752 3300049569 Bacteria 4142
117 Ga0501034_0026169 3300049571 Bacteria 5940
118 Ga0501034_0169757 3300049571 Bacteria 2149
119 Ga0501034_0463042 3300049571 Bacteria 1184
120 Ga0501036_0000164 3300049572 Bacteria 43588
121 Ga0501037_0006302 3300049573 Bacteria 8676
122 Ga0501043_0001053 3300049579 Bacteria 24217
123 Ga0501043_0044618 3300049579 Bacteria 3486
124 Ga0501047_0000218 3300049581 Bacteria 68952
125 Ga0501047_0352263 3300049581 Bacteria 1309
126 Ga0501048_0000762 3300049582 Bacteria 23616
127 Ga0501069_0002918 3300049585 Bacteria 8774
128 Ga0501070_0004965 3300049586 Bacteria 11351
129 Ga0501070_0041817 3300049586 Bacteria 3816
130 Ga0501073_0014229 3300049589 Bacteria 5778
131 Ga0501077_0395311 3300049593 Bacteria 883
132 Ga0501080_0000489 3300049742 Bacteria 30879
133 Ga0501080_0230087 3300049742 Bacteria 1695
134 Ga0501080_0282197 3300049742 Bacteria 1510
135 Ga0501083_0002238 3300049744 Bacteria 13225
136 Ga0501035_0001645 3300049822 Bacteria 22584
137 Ga0501044_0000931 3300049823 Bacteria 35180
138 Ga0501044_0377162 3300049823 Bacteria 1334
139 Ga0501044_0396821 3300049823 Bacteria 1293
140 Ga0501044_0465853 3300049823 Bacteria 1168
141 nmdc:mga0yw44_55172_c1 3300050492 Bacteria 2417
142 nmdc:mga0k408_322854_c1 3300050493 Bacteria 921
143 nmdc:mga08y16_55442_c1 3300050511 Bacteria 4142
144 nmdc:mga0n895_39133_c1 3300050512 Bacteria 4598
145 nmdc:mga0a205_629132_c1 3300050515 Bacteria 925
146 nmdc:mga0sz30_198565_c1 3300050516 Bacteria 890
147 Ga0495601_0001731 3300053077 Bacteria 12068
148 Ga0495612_0166001 3300053078 Bacteria 965
149 Ga0495595_0003454 3300053084 Bacteria 6269
150 Ga0495619_0000043 3300053085 Bacteria 109865
151 Ga0495619_0099561 3300053085 Bacteria 1977
152 Ga0500641_0005538 3300053096 Bacteria 4472
153 Ga0500595_002668 3300053119 Bacteria 8676
154 Ga0500642_0027795 3300053130 Bacteria 2325
155 Ga0500616_0007435 3300053153 Bacteria 6960
156 Ga0500616_0068515 3300053153 Bacteria 1817
157 Ga0500636_0000019 3300053177 Bacteria 105042
158 Ga0500609_001526 3300053731 Bacteria 3381
159 2513859634 2513237137 Bacteria 9558895
160 2643855721 2643221568 Bacteria 5187270
161 2819683896 2818991461 Bacteria 7026071
162 2854921948 2854916844 Bacteria 5725939
163 2883577134 2883577096 Bacteria 4709178
164 2889794107 2889790730 Bacteria 5689708
165 2889915863 2889914905 Bacteria 5702301
166 2903755725 2903748898 Bacteria 9972761
167 2919167515 2919166419 Bacteria 4952238
168 2932796337 2932794094 Bacteria 7915132
169 2978973961 2978969890 Bacteria 5400756
170 2984589290 2984587000 Bacteria 5263363
171 8054462197 8054460903 Bacteria 4872905
172 8056879504 8056875544 Bacteria 4355797
173 Ga0307415_100284316
174 JGI24744J21845_10009482
175 Ga0065707_10136716
176 Ga0070666_10474362
177 Ga0070669_100054908
178 Ga0070714_100259808
179 Ga0068853_100523945
180 Ga0070686_100190032
181 Ga0068855_100191319
182 Ga0068854_100034854
183 Ga0068856_100996931
184 Ga0068859_100994455
185 Ga0068861_100121254
186 Ga0068870_10176367
187 Ga0068858_100256067
188 Ga0068860_100277815
189 Ga0081539_10071428
190 Ga0070717_10578463
191 Ga0075365_10002917
192 Ga0075365_10094579
193 Ga0070716_100303847
194 Ga0075369_10244826
195 Ga0097621_100844702
196 Ga0075434_100043182
197 Ga0097620_100994581
198 Ga0099824_1007084
199 Ga0105240_10667519
200 Ga0111539_10064660
201 Ga0105249_10003167
202 Ga0105239_10816543
203 Ga0105246_10417329
204 Ga0157371_10024763
205 Ga0157369_10107150
206 Ga0157369_10484932
207 Ga0157369_10595855
208 Ga0157374_10273725
209 Ga0157375_10080115
210 Ga0163163_10286825
211 Ga0157379_10647916
212 Ga0163161_10032003
213 Ga0206353_10803458
214 Ga0213875_10000025
215 Ga0207688_10103366
216 Ga0207647_10060109
217 Ga0207643_10190538
218 Ga0207687_10487414
219 Ga0207664_10290005
220 Ga0207712_10538131
221 Ga0207668_10110141
222 Ga0207640_10170028
223 Ga0207675_100297800
224 Ga0265325_10003453
225 Ga0265342_10225904
226 Ga0307413_10163406
227 Ga0307406_10062241
228 Ga0307416_100303728
229 Ga0307416_101800334
230 Ga0307414_10326763
231 Ga0307415_100201907
232 Ga0373936_0478353
233 Ga0373956_0036862
234 Ga0373931_0111947
235 Ga0373927_0098811
236 Ga0373933_0204160
237 Ga0373937_0006024
238 Ga0373937_0052063
239 Ga0373937_0290738
240 Ga0316582_0109320
241 Ga0316584_0422436
242 Ga0373925_0946732
243 Ga0395899_0026284
244 Ga0395900_0035106
245 Ga0395898_0032020
246 Ga0395898_0545176
247 Ga0436364_0206987
248 Ga0395901_0302786
249 Ga0436365_1649809
250 Ga0436360_1024118
251 Ga0436363_1208578
252 Ga0466958_0343861
253 Ga0495592_0241170
254 Ga0495607_0027425
255 Ga0495618_0301219
256 Ga0495630_0141017
257 Ga0495643_0150658
258 Ga0495667_0047206
259 Ga0495656_0276934
260 Ga0495625_0406962
261 Ga0495635_0036566
262 Ga0495658_0154764
263 Ga0495600_0064740
264 Ga0495674_0029596
265 Ga0495680_0026045
266 Ga0495684_0358756
267 Ga0496101_0142503
268 Ga0496104_0001125
269 Ga0496104_0075132
270 Ga0496105_0013404
271 Ga0496105_0382334
272 Ga0496107_0001990
273 Ga0496107_0152055
274 Ga0496108_0003920
275 Ga0496109_0001944
276 Ga0496110_0002635
277 Ga0496111_0013895
278 Ga0496112_0156529
279 Ga0496114_0004759
280 Ga0496116_0000043
281 Ga0496117_0049990
282 Ga0496118_0036747
283 Ga0496121_0002535
284 Ga0496122_0137748
285 Ga0496123_0025473
286 Ga0496124_0477233
287 Ga0496126_0000369
288 Ga0501032_0024752
289 Ga0501034_0026169
290 Ga0501034_0169757
291 Ga0501034_0463042
292 Ga0501036_0000164
293 Ga0501037_0006302
294 Ga0501043_0001053
295 Ga0501043_0044618
296 Ga0501047_0000218
297 Ga0501047_0352263
298 Ga0501048_0000762
299 Ga0501069_0002918
300 Ga0501070_0004965
301 Ga0501070_0041817
302 Ga0501073_0014229
303 Ga0501077_0395311
304 Ga0501080_0000489
305 Ga0501080_0230087
306 Ga0501080_0282197
307 Ga0501083_0002238
308 Ga0501035_0001645
309 Ga0501044_0000931
310 Ga0501044_0377162
311 Ga0501044_0396821
312 Ga0501044_0465853
313 nmdc:mga0yw44_55172_c1
314 nmdc:mga0k408_322854_c1
315 nmdc:mga08y16_55442_c1
316 nmdc:mga0n895_39133_c1
317 nmdc:mga0a205_629132_c1
318 nmdc:mga0sz30_198565_c1
319 Ga0495601_0001731
320 Ga0495612_0166001
321 Ga0495595_0003454
322 Ga0495619_0000043
323 Ga0495619_0099561
324 Ga0500641_0005538
325 Ga0500595_002668
326 Ga0500642_0027795
327 Ga0500616_0007435
328 Ga0500616_0068515
329 Ga0500636_0000019
330 Ga0500609_001526
331 2513859634
332 2643855721
333 2819683896
334 2854921948
335 2883577134
336 2889794107
337 2889915863
338 2903755725
339 2919167515
340 2932796337
341 2978973961
342 2984589290
343 8054462197
344 8056879504

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02660

G3P_acyltransf

Glycerol-3-phosphate acyltransferase

44

222

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.908 6 192
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.9044 6 193
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.8656 6 193
7cgp-assembly1.cif.gz_A cryo-em structure of the human mitochondrial translocase tim22 complex at 3.7 angstrom. 0.4262 45 174
8e0o-assembly1.cif.gz_A heterotrimeric variant of tctrp9, hetbgl03-15-18 0.3631 44 180
ID Description Score Start End Superfamily
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8997 13 184 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8848 13 184 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8709 13 184 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8446 13 184 1.10.1760.20
af_K7MNI0_8_395_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3931 55 170 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A528WDA5-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9756 80 196 GO:0005886
GO:0008654
GO:0043772
AF-A0A520XIX3-F1-model_v4 deleted 0.9718 84 196
AF-A0A4U8Z696-F1-model_v4 Uncharacterized protein 0.9684 84 196 GO:0005886
GO:0008654
GO:0043772
AF-A0A439KNV7-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9677 46 196 GO:0005886
GO:0008654
GO:0043772
AF-T0CRV7-F1-model_v4 deleted 0.9654 82 196

Map