F260791
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 172 | 145 | 344 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300015262|Ga0182007_10009724|Ga0182007_100097244 |
| Length | 147 |
| Sequence | MEAIQGVAMSLLKPHRPPYRWSAAAWIAAIVIAPAAGAATPAELLAGYVGEAGGAPSPERGQSLFNSRHGRDWSCASCHGAVPTGPGRHAATGKPIAALAPAFNPERFTDAAKADKWFRRNCNDVVGRECTAAEKADVLSWLIKLKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 28 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 29 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 30 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 32 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 34 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 47 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 49 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 51 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 74 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 75 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 76 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 77 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 78 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 79 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 80 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 81 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 82 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 83 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 84 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 85 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 86 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 87 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 88 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 89 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 90 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 91 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 92 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 93 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 94 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 95 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 96 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 97 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 98 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 99 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 100 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 101 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 102 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 103 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 104 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 117 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 118 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 121 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 124 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 126 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 127 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 132 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 133 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 136 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 137 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 139 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 140 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 141 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 142 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 143 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 144 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 145 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.93 |
| Metatranscriptomes | 0 |
| Isolates | 4.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.05 |
| Nodule | 2.33 |
| Rhizoplane | 1.16 |
| Rhizosphere | 75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182007_10009724 | 3300015262 | Bacteria | 3852 |
| 2 | rootH1_10011828 | 3300003316 | Bacteria | 3402 |
| 3 | rootH1_10017273 | 3300003316 | Bacteria | 17955 |
| 4 | rootL2_10003944 | 3300003322 | Bacteria | 33689 |
| 5 | rootH1_10090889 | 3300003323 | Bacteria | 3622 |
| 6 | Ga0055532_1000174 | 3300003758 | Bacteria | 54785 |
| 7 | Ga0055527_1000036 | 3300003760 | Bacteria | 133374 |
| 8 | Ga0055535_1000051 | 3300003761 | Bacteria | 133374 |
| 9 | Ga0055542_1007498 | 3300003762 | Bacteria | 2211 |
| 10 | Ga0055529_1001817 | 3300003763 | Bacteria | 5116 |
| 11 | Ga0070676_10856510 | 3300005328 | Unclassified | 674 |
| 12 | Ga0070666_10185879 | 3300005335 | Bacteria | 1459 |
| 13 | Ga0070666_10486916 | 3300005335 | Bacteria | 893 |
| 14 | Ga0070680_100018830 | 3300005336 | Bacteria | 5462 |
| 15 | Ga0068868_100041192 | 3300005338 | Bacteria | 3598 |
| 16 | Ga0068868_100770178 | 3300005338 | Bacteria | 866 |
| 17 | Ga0070689_101585023 | 3300005340 | Bacteria | 594 |
| 18 | Ga0070668_100747881 | 3300005347 | Unclassified | 865 |
| 19 | Ga0070675_100889842 | 3300005354 | Bacteria | 816 |
| 20 | Ga0070673_100284050 | 3300005364 | Unclassified | 1452 |
| 21 | Ga0070667_100122438 | 3300005367 | Bacteria | 2264 |
| 22 | Ga0070667_101058588 | 3300005367 | Unclassified | 758 |
| 23 | Ga0070681_10092301 | 3300005458 | Bacteria | 2977 |
| 24 | Ga0068867_100000059 | 3300005459 | Bacteria | 68279 |
| 25 | Ga0070679_100015908 | 3300005530 | Bacteria | 7241 |
| 26 | Ga0070672_100225408 | 3300005543 | Bacteria | 1573 |
| 27 | Ga0068857_100017555 | 3300005577 | Bacteria | 6274 |
| 28 | Ga0068852_100729426 | 3300005616 | Bacteria | 1002 |
| 29 | Ga0068859_100419692 | 3300005617 | Bacteria | 1434 |
| 30 | Ga0068859_101277041 | 3300005617 | Bacteria | 809 |
| 31 | Ga0068863_100872986 | 3300005841 | Bacteria | 899 |
| 32 | Ga0068860_100634959 | 3300005843 | Bacteria | 1075 |
| 33 | Ga0075362_10681483 | 3300006177 | Unclassified | 535 |
| 34 | Ga0075366_10114493 | 3300006195 | Unclassified | 1624 |
| 35 | Ga0097621_100246909 | 3300006237 | Bacteria | 1562 |
| 36 | Ga0075429_100063031 | 3300006880 | Bacteria | 3230 |
| 37 | Ga0097620_100419765 | 3300006931 | Bacteria | 1434 |
| 38 | Ga0097620_101276960 | 3300006931 | Bacteria | 809 |
| 39 | Ga0079104_1015596 | 3300006946 | Bacteria | 2247 |
| 40 | Ga0099826_10143600 | 3300006948 | Bacteria | 1375 |
| 41 | Ga0105240_10004286 | 3300009093 | Bacteria | 21797 |
| 42 | Ga0105243_10001093 | 3300009148 | Bacteria | 24741 |
| 43 | Ga0105248_10865428 | 3300009177 | Unclassified | 1020 |
| 44 | Ga0105248_12000080 | 3300009177 | Bacteria | 658 |
| 45 | Ga0105237_10097736 | 3300009545 | Bacteria | 2927 |
| 46 | Ga0105237_10339724 | 3300009545 | Bacteria | 1506 |
| 47 | Ga0105238_10103006 | 3300009551 | Bacteria | 2836 |
| 48 | Ga0163162_10738205 | 3300013306 | Bacteria | 1104 |
| 49 | Ga0163162_11463967 | 3300013306 | Bacteria | 778 |
| 50 | Ga0157377_10000029 | 3300014745 | Bacteria | 134270 |
| 51 | Ga0163161_10347666 | 3300017792 | Bacteria | 1178 |
| 52 | Ga0209672_100026 | 3300025228 | Bacteria | 348998 |
| 53 | Ga0209672_100666 | 3300025228 | Bacteria | 17403 |
| 54 | Ga0209147_100033 | 3300025229 | Bacteria | 348998 |
| 55 | Ga0209258_100051 | 3300025242 | Bacteria | 348998 |
| 56 | Ga0209026_1001694 | 3300025250 | Bacteria | 9231 |
| 57 | Ga0209148_1000313 | 3300025254 | Bacteria | 68764 |
| 58 | Ga0209759_1002977 | 3300025256 | Bacteria | 7035 |
| 59 | Ga0209455_1000154 | 3300025272 | Bacteria | 124382 |
| 60 | Ga0209564_1003521 | 3300025295 | Bacteria | 10576 |
| 61 | Ga0209257_1022856 | 3300025304 | Bacteria | 2217 |
| 62 | Ga0207680_10469822 | 3300025903 | Bacteria | 894 |
| 63 | Ga0207680_10973720 | 3300025903 | Unclassified | 608 |
| 64 | Ga0207695_10012446 | 3300025913 | Bacteria | 10215 |
| 65 | Ga0207660_10154342 | 3300025917 | Bacteria | 1766 |
| 66 | Ga0207652_10054120 | 3300025921 | Bacteria | 3449 |
| 67 | Ga0207694_10521511 | 3300025924 | Bacteria | 996 |
| 68 | Ga0207659_10766339 | 3300025926 | Bacteria | 828 |
| 69 | Ga0207687_10634832 | 3300025927 | Bacteria | 902 |
| 70 | Ga0207644_10740495 | 3300025931 | Unclassified | 821 |
| 71 | Ga0207644_11443840 | 3300025931 | Bacteria | 578 |
| 72 | Ga0207690_10898724 | 3300025932 | Bacteria | 734 |
| 73 | Ga0207709_10000961 | 3300025935 | Bacteria | 21574 |
| 74 | Ga0207704_10170237 | 3300025938 | Bacteria | 1561 |
| 75 | Ga0207691_10311493 | 3300025940 | Bacteria | 1351 |
| 76 | Ga0207691_11250653 | 3300025940 | Bacteria | 614 |
| 77 | Ga0207712_10097043 | 3300025961 | Bacteria | 2183 |
| 78 | Ga0207658_10143916 | 3300025986 | Bacteria | 1933 |
| 79 | Ga0207658_10498471 | 3300025986 | Bacteria | 1084 |
| 80 | Ga0207677_10016192 | 3300026023 | Bacteria | 4408 |
| 81 | Ga0207677_10250594 | 3300026023 | Bacteria | 1438 |
| 82 | Ga0207677_11370299 | 3300026023 | Unclassified | 651 |
| 83 | Ga0207641_11389277 | 3300026088 | Bacteria | 703 |
| 84 | Ga0207648_10000080 | 3300026089 | Bacteria | 92020 |
| 85 | Ga0207676_11517471 | 3300026095 | Bacteria | 667 |
| 86 | Ga0207674_10085977 | 3300026116 | Bacteria | 3139 |
| 87 | Ga0207698_10641007 | 3300026142 | Bacteria | 1051 |
| 88 | Ga0268264_10322339 | 3300028381 | Bacteria | 1461 |
| 89 | Ga0307512_10010229 | 3300030522 | Bacteria | 8964 |
| 90 | Ga0265327_10426573 | 3300031251 | Bacteria | 574 |
| 91 | Ga0307509_10004415 | 3300031507 | Bacteria | 20332 |
| 92 | Ga0307509_10056446 | 3300031507 | Bacteria | 4168 |
| 93 | Ga0307509_10429575 | 3300031507 | Unclassified | 1020 |
| 94 | Ga0307508_10013797 | 3300031616 | Bacteria | 7375 |
| 95 | Ga0307514_10001176 | 3300031649 | Bacteria | 35339 |
| 96 | Ga0307516_10191329 | 3300031730 | Bacteria | 1772 |
| 97 | Ga0307406_10847288 | 3300031901 | Bacteria | 775 |
| 98 | Ga0307510_10005188 | 3300033180 | Bacteria | 15484 |
| 99 | Ga0373959_0014700 | 3300034820 | Bacteria | 1428 |
| 100 | Ga0373923_0536426 | 3300035111 | Bacteria | 573 |
| 101 | Ga0373933_0366009 | 3300035724 | Bacteria | 938 |
| 102 | Ga0373937_0007274 | 3300036401 | Bacteria | 9582 |
| 103 | Ga0395899_0002107 | 3300037312 | Bacteria | 16343 |
| 104 | Ga0395900_0010225 | 3300037418 | Bacteria | 9596 |
| 105 | Ga0395898_0462400 | 3300037466 | Bacteria | 1208 |
| 106 | Ga0395905_0047126 | 3300037471 | Bacteria | 4041 |
| 107 | Ga0395901_0218195 | 3300038443 | Unclassified | 1994 |
| 108 | Ga0451853_0218836 | 3300041512 | Bacteria | 3010 |
| 109 | Ga0451577_0004445 | 3300042876 | Bacteria | 14806 |
| 110 | Ga0451577_0287677 | 3300042876 | Bacteria | 1489 |
| 111 | Ga0466969_0000377 | 3300044656 | Bacteria | 24478 |
| 112 | Ga0466969_0070621 | 3300044656 | Bacteria | 1679 |
| 113 | Ga0453683_0004503 | 3300044673 | Bacteria | 9872 |
| 114 | Ga0466966_0420269 | 3300044684 | Bacteria | 803 |
| 115 | Ga0466961_0033048 | 3300044693 | Bacteria | 3324 |
| 116 | Ga0466963_0070528 | 3300044694 | Bacteria | 2350 |
| 117 | Ga0453684_0371560 | 3300044712 | Bacteria | 1607 |
| 118 | Ga0453684_1177366 | 3300044712 | Bacteria | 806 |
| 119 | Ga0466971_0173755 | 3300044719 | Bacteria | 1011 |
| 120 | Ga0466970_0116837 | 3300044765 | Unclassified | 1459 |
| 121 | Ga0466959_0002110 | 3300045049 | Bacteria | 12573 |
| 122 | Ga0466959_0084736 | 3300045049 | Bacteria | 2281 |
| 123 | Ga0451576_0005996 | 3300045051 | Bacteria | 15027 |
| 124 | Ga0466958_0095868 | 3300045836 | Bacteria | 1839 |
| 125 | Ga0466967_0155649 | 3300045976 | Bacteria | 2140 |
| 126 | Ga0495592_0000164 | 3300046454 | Bacteria | 59118 |
| 127 | Ga0495651_0260728 | 3300046462 | Bacteria | 1179 |
| 128 | Ga0495651_0354281 | 3300046462 | Bacteria | 969 |
| 129 | Ga0495580_0010436 | 3300046472 | Bacteria | 7240 |
| 130 | Ga0495608_0083388 | 3300046511 | Bacteria | 2075 |
| 131 | Ga0495628_0038103 | 3300046516 | Bacteria | 3850 |
| 132 | Ga0495648_0001933 | 3300046524 | Bacteria | 19748 |
| 133 | Ga0495648_0175983 | 3300046524 | Bacteria | 1092 |
| 134 | Ga0495652_0076744 | 3300046529 | Bacteria | 2771 |
| 135 | Ga0495586_0067133 | 3300046535 | Unclassified | 1956 |
| 136 | Ga0495621_0167256 | 3300046539 | Bacteria | 872 |
| 137 | Ga0495588_0294217 | 3300046674 | Bacteria | 855 |
| 138 | Ga0495613_0384631 | 3300046689 | Unclassified | 959 |
| 139 | Ga0495672_0056477 | 3300047320 | Bacteria | 2284 |
| 140 | Ga0496104_0161534 | 3300048907 | Bacteria | 2149 |
| 141 | Ga0496105_0685678 | 3300048908 | Bacteria | 788 |
| 142 | Ga0501047_0111403 | 3300049581 | Bacteria | 2619 |
| 143 | Ga0501047_0216927 | 3300049581 | Bacteria | 1770 |
| 144 | Ga0501067_0049335 | 3300049583 | Bacteria | 2333 |
| 145 | Ga0501069_0015107 | 3300049585 | Bacteria | 4136 |
| 146 | Ga0501070_0006296 | 3300049586 | Bacteria | 10103 |
| 147 | Ga0501072_0100509 | 3300049588 | Bacteria | 2299 |
| 148 | Ga0501073_0006701 | 3300049589 | Bacteria | 8576 |
| 149 | Ga0501074_0000151 | 3300049590 | Bacteria | 36154 |
| 150 | Ga0501198_000054 | 3300049649 | Bacteria | 33571 |
| 151 | Ga0501222_000093 | 3300049662 | Bacteria | 23934 |
| 152 | Ga0501079_0001032 | 3300049741 | Bacteria | 19308 |
| 153 | Ga0501079_0837195 | 3300049741 | Bacteria | 724 |
| 154 | Ga0501080_0031918 | 3300049742 | Bacteria | 4908 |
| 155 | Ga0501080_0137612 | 3300049742 | Bacteria | 2259 |
| 156 | Ga0501083_0021182 | 3300049744 | Bacteria | 4518 |
| 157 | Ga0501035_0030392 | 3300049822 | Bacteria | 4925 |
| 158 | nmdc:mga03683_633479_c1 | 3300050489 | Unclassified | 525 |
| 159 | nmdc:mga0k408_121773_c1 | 3300050493 | Unclassified | 1545 |
| 160 | nmdc:mga09592_69935_c1 | 3300050508 | Bacteria | 2978 |
| 161 | nmdc:mga0qj67_5206_c1 | 3300050509 | Bacteria | 9496 |
| 162 | Ga0500619_053216 | 3300053154 | Bacteria | 1315 |
| 163 | Ga0500636_0272340 | 3300053177 | Bacteria | 850 |
| 164 | Ga0501082_0068691 | 3300060353 | Bacteria | 3051 |
| 165 | Ga0466962_0049689 | 3300061719 | Bacteria | 2004 |
| 166 | 2514047628 | 2513237166 | Bacteria | 10373764 |
| 167 | 2587756412 | 2585428062 | Bacteria | 6842168 |
| 168 | 2597030230 | 2596583598 | Bacteria | 5251611 |
| 169 | 2643864894 | 2643221570 | Bacteria | 5103772 |
| 170 | 2902685322 | 2902682994 | Bacteria | 8951596 |
| 171 | 2923511862 | 2923510766 | Bacteria | 5926163 |
| 172 | 642598007 | 642555112 | Bacteria | 8676562 |
| 173 | Ga0182007_10009724 | |||
| 174 | rootH1_10011828 | |||
| 175 | rootH1_10017273 | |||
| 176 | rootL2_10003944 | |||
| 177 | rootH1_10090889 | |||
| 178 | Ga0055532_1000174 | |||
| 179 | Ga0055527_1000036 | |||
| 180 | Ga0055535_1000051 | |||
| 181 | Ga0055542_1007498 | |||
| 182 | Ga0055529_1001817 | |||
| 183 | Ga0070676_10856510 | |||
| 184 | Ga0070666_10185879 | |||
| 185 | Ga0070666_10486916 | |||
| 186 | Ga0070680_100018830 | |||
| 187 | Ga0068868_100041192 | |||
| 188 | Ga0068868_100770178 | |||
| 189 | Ga0070689_101585023 | |||
| 190 | Ga0070668_100747881 | |||
| 191 | Ga0070675_100889842 | |||
| 192 | Ga0070673_100284050 | |||
| 193 | Ga0070667_100122438 | |||
| 194 | Ga0070667_101058588 | |||
| 195 | Ga0070681_10092301 | |||
| 196 | Ga0068867_100000059 | |||
| 197 | Ga0070679_100015908 | |||
| 198 | Ga0070672_100225408 | |||
| 199 | Ga0068857_100017555 | |||
| 200 | Ga0068852_100729426 | |||
| 201 | Ga0068859_100419692 | |||
| 202 | Ga0068859_101277041 | |||
| 203 | Ga0068863_100872986 | |||
| 204 | Ga0068860_100634959 | |||
| 205 | Ga0075362_10681483 | |||
| 206 | Ga0075366_10114493 | |||
| 207 | Ga0097621_100246909 | |||
| 208 | Ga0075429_100063031 | |||
| 209 | Ga0097620_100419765 | |||
| 210 | Ga0097620_101276960 | |||
| 211 | Ga0079104_1015596 | |||
| 212 | Ga0099826_10143600 | |||
| 213 | Ga0105240_10004286 | |||
| 214 | Ga0105243_10001093 | |||
| 215 | Ga0105248_10865428 | |||
| 216 | Ga0105248_12000080 | |||
| 217 | Ga0105237_10097736 | |||
| 218 | Ga0105237_10339724 | |||
| 219 | Ga0105238_10103006 | |||
| 220 | Ga0163162_10738205 | |||
| 221 | Ga0163162_11463967 | |||
| 222 | Ga0157377_10000029 | |||
| 223 | Ga0163161_10347666 | |||
| 224 | Ga0209672_100026 | |||
| 225 | Ga0209672_100666 | |||
| 226 | Ga0209147_100033 | |||
| 227 | Ga0209258_100051 | |||
| 228 | Ga0209026_1001694 | |||
| 229 | Ga0209148_1000313 | |||
| 230 | Ga0209759_1002977 | |||
| 231 | Ga0209455_1000154 | |||
| 232 | Ga0209564_1003521 | |||
| 233 | Ga0209257_1022856 | |||
| 234 | Ga0207680_10469822 | |||
| 235 | Ga0207680_10973720 | |||
| 236 | Ga0207695_10012446 | |||
| 237 | Ga0207660_10154342 | |||
| 238 | Ga0207652_10054120 | |||
| 239 | Ga0207694_10521511 | |||
| 240 | Ga0207659_10766339 | |||
| 241 | Ga0207687_10634832 | |||
| 242 | Ga0207644_10740495 | |||
| 243 | Ga0207644_11443840 | |||
| 244 | Ga0207690_10898724 | |||
| 245 | Ga0207709_10000961 | |||
| 246 | Ga0207704_10170237 | |||
| 247 | Ga0207691_10311493 | |||
| 248 | Ga0207691_11250653 | |||
| 249 | Ga0207712_10097043 | |||
| 250 | Ga0207658_10143916 | |||
| 251 | Ga0207658_10498471 | |||
| 252 | Ga0207677_10016192 | |||
| 253 | Ga0207677_10250594 | |||
| 254 | Ga0207677_11370299 | |||
| 255 | Ga0207641_11389277 | |||
| 256 | Ga0207648_10000080 | |||
| 257 | Ga0207676_11517471 | |||
| 258 | Ga0207674_10085977 | |||
| 259 | Ga0207698_10641007 | |||
| 260 | Ga0268264_10322339 | |||
| 261 | Ga0307512_10010229 | |||
| 262 | Ga0265327_10426573 | |||
| 263 | Ga0307509_10004415 | |||
| 264 | Ga0307509_10056446 | |||
| 265 | Ga0307509_10429575 | |||
| 266 | Ga0307508_10013797 | |||
| 267 | Ga0307514_10001176 | |||
| 268 | Ga0307516_10191329 | |||
| 269 | Ga0307406_10847288 | |||
| 270 | Ga0307510_10005188 | |||
| 271 | Ga0373959_0014700 | |||
| 272 | Ga0373923_0536426 | |||
| 273 | Ga0373933_0366009 | |||
| 274 | Ga0373937_0007274 | |||
| 275 | Ga0395899_0002107 | |||
| 276 | Ga0395900_0010225 | |||
| 277 | Ga0395898_0462400 | |||
| 278 | Ga0395905_0047126 | |||
| 279 | Ga0395901_0218195 | |||
| 280 | Ga0451853_0218836 | |||
| 281 | Ga0451577_0004445 | |||
| 282 | Ga0451577_0287677 | |||
| 283 | Ga0466969_0000377 | |||
| 284 | Ga0466969_0070621 | |||
| 285 | Ga0453683_0004503 | |||
| 286 | Ga0466966_0420269 | |||
| 287 | Ga0466961_0033048 | |||
| 288 | Ga0466963_0070528 | |||
| 289 | Ga0453684_0371560 | |||
| 290 | Ga0453684_1177366 | |||
| 291 | Ga0466971_0173755 | |||
| 292 | Ga0466970_0116837 | |||
| 293 | Ga0466959_0002110 | |||
| 294 | Ga0466959_0084736 | |||
| 295 | Ga0451576_0005996 | |||
| 296 | Ga0466958_0095868 | |||
| 297 | Ga0466967_0155649 | |||
| 298 | Ga0495592_0000164 | |||
| 299 | Ga0495651_0260728 | |||
| 300 | Ga0495651_0354281 | |||
| 301 | Ga0495580_0010436 | |||
| 302 | Ga0495608_0083388 | |||
| 303 | Ga0495628_0038103 | |||
| 304 | Ga0495648_0001933 | |||
| 305 | Ga0495648_0175983 | |||
| 306 | Ga0495652_0076744 | |||
| 307 | Ga0495586_0067133 | |||
| 308 | Ga0495621_0167256 | |||
| 309 | Ga0495588_0294217 | |||
| 310 | Ga0495613_0384631 | |||
| 311 | Ga0495672_0056477 | |||
| 312 | Ga0496104_0161534 | |||
| 313 | Ga0496105_0685678 | |||
| 314 | Ga0501047_0111403 | |||
| 315 | Ga0501047_0216927 | |||
| 316 | Ga0501067_0049335 | |||
| 317 | Ga0501069_0015107 | |||
| 318 | Ga0501070_0006296 | |||
| 319 | Ga0501072_0100509 | |||
| 320 | Ga0501073_0006701 | |||
| 321 | Ga0501074_0000151 | |||
| 322 | Ga0501198_000054 | |||
| 323 | Ga0501222_000093 | |||
| 324 | Ga0501079_0001032 | |||
| 325 | Ga0501079_0837195 | |||
| 326 | Ga0501080_0031918 | |||
| 327 | Ga0501080_0137612 | |||
| 328 | Ga0501083_0021182 | |||
| 329 | Ga0501035_0030392 | |||
| 330 | nmdc:mga03683_633479_c1 | |||
| 331 | nmdc:mga0k408_121773_c1 | |||
| 332 | nmdc:mga09592_69935_c1 | |||
| 333 | nmdc:mga0qj67_5206_c1 | |||
| 334 | Ga0500619_053216 | |||
| 335 | Ga0500636_0272340 | |||
| 336 | Ga0501082_0068691 | |||
| 337 | Ga0466962_0049689 | |||
| 338 | 2514047628 | |||
| 339 | 2587756412 | |||
| 340 | 2597030230 | |||
| 341 | 2643864894 | |||
| 342 | 2902685322 | |||
| 343 | 2923511862 | |||
| 344 | 642598007 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dw0-assembly1.cif.gz_A | structure of oxidized shp, an oxygen binding cytochrome c | 0.914 | 20 | 127 |
| 1gu2-assembly2.cif.gz_B | crystal structure of oxidized cytochrome c'' from methylophilus methylotrophus | 0.876 | 24 | 130 |
| 1dw0-assembly1.cif.gz_A | structure of oxidized shp, an oxygen binding cytochrome c | 0.8752 | 20 | 127 |
| 1e8e-assembly1.cif.gz_A | solution structure of methylophilus methylotrophus cytochrome c''. insights into the structural basis of haem-ligand detachment | 0.8481 | 24 | 127 |
| 1gu2-assembly2.cif.gz_B | crystal structure of oxidized cytochrome c'' from methylophilus methylotrophus | 0.7619 | 24 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dw0A00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.914 | 20 | 127 | 1.10.760.10 |
| 1gu2B00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.876 | 24 | 130 | 1.10.760.10 |
| 1dw0A00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8752 | 20 | 127 | 1.10.760.10 |
| 1gu2B00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7619 | 24 | 130 | 1.10.760.10 |
| 1h99A01 | Mainly Alpha;Orthogonal Bundle;PTS-regulatory domain, PRD;PRD domain | 0.6555 | 97 | 128 | 1.10.1790.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A254T6F2-F1-model_v4 | Cytochrome C | 0.987 | 20 | 129 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A258R8F9-F1-model_v4 | Cytochrome C | 0.9775 | 19 | 130 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A1Y1QAY0-F1-model_v4 | Cytochrome c domain-containing protein | 0.9757 | 21 | 129 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A257LJ22-F1-model_v4 | Cytochrome C | 0.974 | 44 | 130 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A8A8MHP2-F1-model_v4 | deleted | 0.974 | 66 | 130 |
|