F260791

General Info

Members Datasets Scaffolds Average Seq Length
172 145 344 136

Family's Representative Sequence

Representative Sequence 3300015262|Ga0182007_10009724|Ga0182007_100097244
Length 147
Sequence MEAIQGVAMSLLKPHRPPYRWSAAAWIAAIVIAPAAGAATPAELLAGYVGEAGGAPSPERGQSLFNSRHGRDWSCASCHGAVPTGPGRHAATGKPIAALAPAFNPERFTDAAKADKWFRRNCNDVVGRECTAAEKADVLSWLIKLKP

Samples

Sample ID Description Type Environment
1 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
34 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
47 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
78 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
81 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
82 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
113 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
126 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
136 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
139 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
140 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
141 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
142 2643221570 Acidovorax sp. Root568 Isolate Unclassified
143 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
144 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
145 642555112 Paraburkholderia phymatum STM815 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.93
Metatranscriptomes 0
Isolates 4.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.05
Nodule 2.33
Rhizoplane 1.16
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 9.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182007_10009724 3300015262 Bacteria 3852
2 rootH1_10011828 3300003316 Bacteria 3402
3 rootH1_10017273 3300003316 Bacteria 17955
4 rootL2_10003944 3300003322 Bacteria 33689
5 rootH1_10090889 3300003323 Bacteria 3622
6 Ga0055532_1000174 3300003758 Bacteria 54785
7 Ga0055527_1000036 3300003760 Bacteria 133374
8 Ga0055535_1000051 3300003761 Bacteria 133374
9 Ga0055542_1007498 3300003762 Bacteria 2211
10 Ga0055529_1001817 3300003763 Bacteria 5116
11 Ga0070676_10856510 3300005328 Unclassified 674
12 Ga0070666_10185879 3300005335 Bacteria 1459
13 Ga0070666_10486916 3300005335 Bacteria 893
14 Ga0070680_100018830 3300005336 Bacteria 5462
15 Ga0068868_100041192 3300005338 Bacteria 3598
16 Ga0068868_100770178 3300005338 Bacteria 866
17 Ga0070689_101585023 3300005340 Bacteria 594
18 Ga0070668_100747881 3300005347 Unclassified 865
19 Ga0070675_100889842 3300005354 Bacteria 816
20 Ga0070673_100284050 3300005364 Unclassified 1452
21 Ga0070667_100122438 3300005367 Bacteria 2264
22 Ga0070667_101058588 3300005367 Unclassified 758
23 Ga0070681_10092301 3300005458 Bacteria 2977
24 Ga0068867_100000059 3300005459 Bacteria 68279
25 Ga0070679_100015908 3300005530 Bacteria 7241
26 Ga0070672_100225408 3300005543 Bacteria 1573
27 Ga0068857_100017555 3300005577 Bacteria 6274
28 Ga0068852_100729426 3300005616 Bacteria 1002
29 Ga0068859_100419692 3300005617 Bacteria 1434
30 Ga0068859_101277041 3300005617 Bacteria 809
31 Ga0068863_100872986 3300005841 Bacteria 899
32 Ga0068860_100634959 3300005843 Bacteria 1075
33 Ga0075362_10681483 3300006177 Unclassified 535
34 Ga0075366_10114493 3300006195 Unclassified 1624
35 Ga0097621_100246909 3300006237 Bacteria 1562
36 Ga0075429_100063031 3300006880 Bacteria 3230
37 Ga0097620_100419765 3300006931 Bacteria 1434
38 Ga0097620_101276960 3300006931 Bacteria 809
39 Ga0079104_1015596 3300006946 Bacteria 2247
40 Ga0099826_10143600 3300006948 Bacteria 1375
41 Ga0105240_10004286 3300009093 Bacteria 21797
42 Ga0105243_10001093 3300009148 Bacteria 24741
43 Ga0105248_10865428 3300009177 Unclassified 1020
44 Ga0105248_12000080 3300009177 Bacteria 658
45 Ga0105237_10097736 3300009545 Bacteria 2927
46 Ga0105237_10339724 3300009545 Bacteria 1506
47 Ga0105238_10103006 3300009551 Bacteria 2836
48 Ga0163162_10738205 3300013306 Bacteria 1104
49 Ga0163162_11463967 3300013306 Bacteria 778
50 Ga0157377_10000029 3300014745 Bacteria 134270
51 Ga0163161_10347666 3300017792 Bacteria 1178
52 Ga0209672_100026 3300025228 Bacteria 348998
53 Ga0209672_100666 3300025228 Bacteria 17403
54 Ga0209147_100033 3300025229 Bacteria 348998
55 Ga0209258_100051 3300025242 Bacteria 348998
56 Ga0209026_1001694 3300025250 Bacteria 9231
57 Ga0209148_1000313 3300025254 Bacteria 68764
58 Ga0209759_1002977 3300025256 Bacteria 7035
59 Ga0209455_1000154 3300025272 Bacteria 124382
60 Ga0209564_1003521 3300025295 Bacteria 10576
61 Ga0209257_1022856 3300025304 Bacteria 2217
62 Ga0207680_10469822 3300025903 Bacteria 894
63 Ga0207680_10973720 3300025903 Unclassified 608
64 Ga0207695_10012446 3300025913 Bacteria 10215
65 Ga0207660_10154342 3300025917 Bacteria 1766
66 Ga0207652_10054120 3300025921 Bacteria 3449
67 Ga0207694_10521511 3300025924 Bacteria 996
68 Ga0207659_10766339 3300025926 Bacteria 828
69 Ga0207687_10634832 3300025927 Bacteria 902
70 Ga0207644_10740495 3300025931 Unclassified 821
71 Ga0207644_11443840 3300025931 Bacteria 578
72 Ga0207690_10898724 3300025932 Bacteria 734
73 Ga0207709_10000961 3300025935 Bacteria 21574
74 Ga0207704_10170237 3300025938 Bacteria 1561
75 Ga0207691_10311493 3300025940 Bacteria 1351
76 Ga0207691_11250653 3300025940 Bacteria 614
77 Ga0207712_10097043 3300025961 Bacteria 2183
78 Ga0207658_10143916 3300025986 Bacteria 1933
79 Ga0207658_10498471 3300025986 Bacteria 1084
80 Ga0207677_10016192 3300026023 Bacteria 4408
81 Ga0207677_10250594 3300026023 Bacteria 1438
82 Ga0207677_11370299 3300026023 Unclassified 651
83 Ga0207641_11389277 3300026088 Bacteria 703
84 Ga0207648_10000080 3300026089 Bacteria 92020
85 Ga0207676_11517471 3300026095 Bacteria 667
86 Ga0207674_10085977 3300026116 Bacteria 3139
87 Ga0207698_10641007 3300026142 Bacteria 1051
88 Ga0268264_10322339 3300028381 Bacteria 1461
89 Ga0307512_10010229 3300030522 Bacteria 8964
90 Ga0265327_10426573 3300031251 Bacteria 574
91 Ga0307509_10004415 3300031507 Bacteria 20332
92 Ga0307509_10056446 3300031507 Bacteria 4168
93 Ga0307509_10429575 3300031507 Unclassified 1020
94 Ga0307508_10013797 3300031616 Bacteria 7375
95 Ga0307514_10001176 3300031649 Bacteria 35339
96 Ga0307516_10191329 3300031730 Bacteria 1772
97 Ga0307406_10847288 3300031901 Bacteria 775
98 Ga0307510_10005188 3300033180 Bacteria 15484
99 Ga0373959_0014700 3300034820 Bacteria 1428
100 Ga0373923_0536426 3300035111 Bacteria 573
101 Ga0373933_0366009 3300035724 Bacteria 938
102 Ga0373937_0007274 3300036401 Bacteria 9582
103 Ga0395899_0002107 3300037312 Bacteria 16343
104 Ga0395900_0010225 3300037418 Bacteria 9596
105 Ga0395898_0462400 3300037466 Bacteria 1208
106 Ga0395905_0047126 3300037471 Bacteria 4041
107 Ga0395901_0218195 3300038443 Unclassified 1994
108 Ga0451853_0218836 3300041512 Bacteria 3010
109 Ga0451577_0004445 3300042876 Bacteria 14806
110 Ga0451577_0287677 3300042876 Bacteria 1489
111 Ga0466969_0000377 3300044656 Bacteria 24478
112 Ga0466969_0070621 3300044656 Bacteria 1679
113 Ga0453683_0004503 3300044673 Bacteria 9872
114 Ga0466966_0420269 3300044684 Bacteria 803
115 Ga0466961_0033048 3300044693 Bacteria 3324
116 Ga0466963_0070528 3300044694 Bacteria 2350
117 Ga0453684_0371560 3300044712 Bacteria 1607
118 Ga0453684_1177366 3300044712 Bacteria 806
119 Ga0466971_0173755 3300044719 Bacteria 1011
120 Ga0466970_0116837 3300044765 Unclassified 1459
121 Ga0466959_0002110 3300045049 Bacteria 12573
122 Ga0466959_0084736 3300045049 Bacteria 2281
123 Ga0451576_0005996 3300045051 Bacteria 15027
124 Ga0466958_0095868 3300045836 Bacteria 1839
125 Ga0466967_0155649 3300045976 Bacteria 2140
126 Ga0495592_0000164 3300046454 Bacteria 59118
127 Ga0495651_0260728 3300046462 Bacteria 1179
128 Ga0495651_0354281 3300046462 Bacteria 969
129 Ga0495580_0010436 3300046472 Bacteria 7240
130 Ga0495608_0083388 3300046511 Bacteria 2075
131 Ga0495628_0038103 3300046516 Bacteria 3850
132 Ga0495648_0001933 3300046524 Bacteria 19748
133 Ga0495648_0175983 3300046524 Bacteria 1092
134 Ga0495652_0076744 3300046529 Bacteria 2771
135 Ga0495586_0067133 3300046535 Unclassified 1956
136 Ga0495621_0167256 3300046539 Bacteria 872
137 Ga0495588_0294217 3300046674 Bacteria 855
138 Ga0495613_0384631 3300046689 Unclassified 959
139 Ga0495672_0056477 3300047320 Bacteria 2284
140 Ga0496104_0161534 3300048907 Bacteria 2149
141 Ga0496105_0685678 3300048908 Bacteria 788
142 Ga0501047_0111403 3300049581 Bacteria 2619
143 Ga0501047_0216927 3300049581 Bacteria 1770
144 Ga0501067_0049335 3300049583 Bacteria 2333
145 Ga0501069_0015107 3300049585 Bacteria 4136
146 Ga0501070_0006296 3300049586 Bacteria 10103
147 Ga0501072_0100509 3300049588 Bacteria 2299
148 Ga0501073_0006701 3300049589 Bacteria 8576
149 Ga0501074_0000151 3300049590 Bacteria 36154
150 Ga0501198_000054 3300049649 Bacteria 33571
151 Ga0501222_000093 3300049662 Bacteria 23934
152 Ga0501079_0001032 3300049741 Bacteria 19308
153 Ga0501079_0837195 3300049741 Bacteria 724
154 Ga0501080_0031918 3300049742 Bacteria 4908
155 Ga0501080_0137612 3300049742 Bacteria 2259
156 Ga0501083_0021182 3300049744 Bacteria 4518
157 Ga0501035_0030392 3300049822 Bacteria 4925
158 nmdc:mga03683_633479_c1 3300050489 Unclassified 525
159 nmdc:mga0k408_121773_c1 3300050493 Unclassified 1545
160 nmdc:mga09592_69935_c1 3300050508 Bacteria 2978
161 nmdc:mga0qj67_5206_c1 3300050509 Bacteria 9496
162 Ga0500619_053216 3300053154 Bacteria 1315
163 Ga0500636_0272340 3300053177 Bacteria 850
164 Ga0501082_0068691 3300060353 Bacteria 3051
165 Ga0466962_0049689 3300061719 Bacteria 2004
166 2514047628 2513237166 Bacteria 10373764
167 2587756412 2585428062 Bacteria 6842168
168 2597030230 2596583598 Bacteria 5251611
169 2643864894 2643221570 Bacteria 5103772
170 2902685322 2902682994 Bacteria 8951596
171 2923511862 2923510766 Bacteria 5926163
172 642598007 642555112 Bacteria 8676562
173 Ga0182007_10009724
174 rootH1_10011828
175 rootH1_10017273
176 rootL2_10003944
177 rootH1_10090889
178 Ga0055532_1000174
179 Ga0055527_1000036
180 Ga0055535_1000051
181 Ga0055542_1007498
182 Ga0055529_1001817
183 Ga0070676_10856510
184 Ga0070666_10185879
185 Ga0070666_10486916
186 Ga0070680_100018830
187 Ga0068868_100041192
188 Ga0068868_100770178
189 Ga0070689_101585023
190 Ga0070668_100747881
191 Ga0070675_100889842
192 Ga0070673_100284050
193 Ga0070667_100122438
194 Ga0070667_101058588
195 Ga0070681_10092301
196 Ga0068867_100000059
197 Ga0070679_100015908
198 Ga0070672_100225408
199 Ga0068857_100017555
200 Ga0068852_100729426
201 Ga0068859_100419692
202 Ga0068859_101277041
203 Ga0068863_100872986
204 Ga0068860_100634959
205 Ga0075362_10681483
206 Ga0075366_10114493
207 Ga0097621_100246909
208 Ga0075429_100063031
209 Ga0097620_100419765
210 Ga0097620_101276960
211 Ga0079104_1015596
212 Ga0099826_10143600
213 Ga0105240_10004286
214 Ga0105243_10001093
215 Ga0105248_10865428
216 Ga0105248_12000080
217 Ga0105237_10097736
218 Ga0105237_10339724
219 Ga0105238_10103006
220 Ga0163162_10738205
221 Ga0163162_11463967
222 Ga0157377_10000029
223 Ga0163161_10347666
224 Ga0209672_100026
225 Ga0209672_100666
226 Ga0209147_100033
227 Ga0209258_100051
228 Ga0209026_1001694
229 Ga0209148_1000313
230 Ga0209759_1002977
231 Ga0209455_1000154
232 Ga0209564_1003521
233 Ga0209257_1022856
234 Ga0207680_10469822
235 Ga0207680_10973720
236 Ga0207695_10012446
237 Ga0207660_10154342
238 Ga0207652_10054120
239 Ga0207694_10521511
240 Ga0207659_10766339
241 Ga0207687_10634832
242 Ga0207644_10740495
243 Ga0207644_11443840
244 Ga0207690_10898724
245 Ga0207709_10000961
246 Ga0207704_10170237
247 Ga0207691_10311493
248 Ga0207691_11250653
249 Ga0207712_10097043
250 Ga0207658_10143916
251 Ga0207658_10498471
252 Ga0207677_10016192
253 Ga0207677_10250594
254 Ga0207677_11370299
255 Ga0207641_11389277
256 Ga0207648_10000080
257 Ga0207676_11517471
258 Ga0207674_10085977
259 Ga0207698_10641007
260 Ga0268264_10322339
261 Ga0307512_10010229
262 Ga0265327_10426573
263 Ga0307509_10004415
264 Ga0307509_10056446
265 Ga0307509_10429575
266 Ga0307508_10013797
267 Ga0307514_10001176
268 Ga0307516_10191329
269 Ga0307406_10847288
270 Ga0307510_10005188
271 Ga0373959_0014700
272 Ga0373923_0536426
273 Ga0373933_0366009
274 Ga0373937_0007274
275 Ga0395899_0002107
276 Ga0395900_0010225
277 Ga0395898_0462400
278 Ga0395905_0047126
279 Ga0395901_0218195
280 Ga0451853_0218836
281 Ga0451577_0004445
282 Ga0451577_0287677
283 Ga0466969_0000377
284 Ga0466969_0070621
285 Ga0453683_0004503
286 Ga0466966_0420269
287 Ga0466961_0033048
288 Ga0466963_0070528
289 Ga0453684_0371560
290 Ga0453684_1177366
291 Ga0466971_0173755
292 Ga0466970_0116837
293 Ga0466959_0002110
294 Ga0466959_0084736
295 Ga0451576_0005996
296 Ga0466958_0095868
297 Ga0466967_0155649
298 Ga0495592_0000164
299 Ga0495651_0260728
300 Ga0495651_0354281
301 Ga0495580_0010436
302 Ga0495608_0083388
303 Ga0495628_0038103
304 Ga0495648_0001933
305 Ga0495648_0175983
306 Ga0495652_0076744
307 Ga0495586_0067133
308 Ga0495621_0167256
309 Ga0495588_0294217
310 Ga0495613_0384631
311 Ga0495672_0056477
312 Ga0496104_0161534
313 Ga0496105_0685678
314 Ga0501047_0111403
315 Ga0501047_0216927
316 Ga0501067_0049335
317 Ga0501069_0015107
318 Ga0501070_0006296
319 Ga0501072_0100509
320 Ga0501073_0006701
321 Ga0501074_0000151
322 Ga0501198_000054
323 Ga0501222_000093
324 Ga0501079_0001032
325 Ga0501079_0837195
326 Ga0501080_0031918
327 Ga0501080_0137612
328 Ga0501083_0021182
329 Ga0501035_0030392
330 nmdc:mga03683_633479_c1
331 nmdc:mga0k408_121773_c1
332 nmdc:mga09592_69935_c1
333 nmdc:mga0qj67_5206_c1
334 Ga0500619_053216
335 Ga0500636_0272340
336 Ga0501082_0068691
337 Ga0466962_0049689
338 2514047628
339 2587756412
340 2597030230
341 2643864894
342 2902685322
343 2923511862
344 642598007

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09086

DUF1924

Domain of unknown function (DUF1924)

51

142

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dw0-assembly1.cif.gz_A structure of oxidized shp, an oxygen binding cytochrome c 0.914 20 127
1gu2-assembly2.cif.gz_B crystal structure of oxidized cytochrome c'' from methylophilus methylotrophus 0.876 24 130
1dw0-assembly1.cif.gz_A structure of oxidized shp, an oxygen binding cytochrome c 0.8752 20 127
1e8e-assembly1.cif.gz_A solution structure of methylophilus methylotrophus cytochrome c''. insights into the structural basis of haem-ligand detachment 0.8481 24 127
1gu2-assembly2.cif.gz_B crystal structure of oxidized cytochrome c'' from methylophilus methylotrophus 0.7619 24 130
ID Description Score Start End Superfamily
1dw0A00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.914 20 127 1.10.760.10
1gu2B00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.876 24 130 1.10.760.10
1dw0A00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8752 20 127 1.10.760.10
1gu2B00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7619 24 130 1.10.760.10
1h99A01 Mainly Alpha;Orthogonal Bundle;PTS-regulatory domain, PRD;PRD domain 0.6555 97 128 1.10.1790.10
ID Description Score Start End GO Terms
AF-A0A254T6F2-F1-model_v4 Cytochrome C 0.987 20 129 GO:0009055
GO:0020037
GO:0046872
AF-A0A258R8F9-F1-model_v4 Cytochrome C 0.9775 19 130 GO:0009055
GO:0020037
GO:0046872
AF-A0A1Y1QAY0-F1-model_v4 Cytochrome c domain-containing protein 0.9757 21 129 GO:0009055
GO:0020037
GO:0046872
AF-A0A257LJ22-F1-model_v4 Cytochrome C 0.974 44 130 GO:0009055
GO:0020037
GO:0046872
AF-A0A8A8MHP2-F1-model_v4 deleted 0.974 66 130

Map