F259957

General Info

Members Datasets Scaffolds Average Seq Length
172 135 172 163

Family's Representative Sequence

Representative Sequence 3300004801|Ga0058860_12167689|Ga0058860_121676891
Length 181
Sequence MERAQKEQVVGSIKEKFDRMTSAVFLDFKGLSVATVSKLRDEFRKSGVEYKVVKNTLIKHAIKQHAWAKNLDKSLVGMTGVAFSYEDPSAAAKVVKAFRKDPAHEKLKVKAGLVDGTLVPGDKVETDLATMPGKNELRASLLATLQAPMQQFLQLLNAPAQNLVYFFKAKEEADAKKEGAA

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
62 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
69 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
78 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
79 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
80 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
81 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
90 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
91 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
92 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
111 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 61.63
Metatranscriptomes 38.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 1.16
Rhizosphere 91.28
Stem 0
Stem Tuber 0
Unclassified 6.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10140716 3300003322 Bacteria 1308
2 Ga0058859_10118766 3300004798 Bacteria 1183
3 Ga0058859_11719133 3300004798 Bacteria 1662
4 Ga0058859_11809678 3300004798 Bacteria 1300
5 Ga0058861_11955377 3300004800 Bacteria 1646
6 Ga0058860_12090967 3300004801 Bacteria 1903
7 Ga0058860_12167689 3300004801 Bacteria 930
8 Ga0058862_10273602 3300004803 Bacteria 1153
9 Ga0058862_12199630 3300004803 Bacteria 779
10 Ga0070683_101155832 3300005329 Bacteria 744
11 Ga0070690_100766121 3300005330 Bacteria 746
12 Ga0070680_101247865 3300005336 Bacteria 643
13 Ga0068868_100065914 3300005338 Bacteria 2878
14 Ga0070689_100039067 3300005340 Bacteria 3633
15 Ga0070673_100759657 3300005364 Unclassified 893
16 Ga0070688_100838588 3300005365 Bacteria 721
17 Ga0070688_101058432 3300005365 Bacteria 647
18 Ga0070678_100203913 3300005456 Bacteria 1634
19 Ga0068867_100124906 3300005459 Bacteria 1993
20 Ga0070685_10773045 3300005466 Bacteria 706
21 Ga0070707_100012678 3300005468 Bacteria 7873
22 Ga0070679_101539538 3300005530 Bacteria 612
23 Ga0070684_100340394 3300005535 Bacteria 1379
24 Ga0068853_100493556 3300005539 Bacteria 1155
25 Ga0068859_100401840 3300005617 Bacteria 1466
26 Ga0068863_101558514 3300005841 Bacteria 669
27 Ga0068860_100512516 3300005843 Bacteria 1199
28 Ga0068862_101252887 3300005844 Bacteria 742
29 Ga0097621_100100789 3300006237 Bacteria 2429
30 Ga0068871_100028407 3300006358 Bacteria 4384
31 Ga0075433_11278451 3300006852 Bacteria 636
32 Ga0068865_100058801 3300006881 Bacteria 2687
33 Ga0097620_100401784 3300006931 Bacteria 1466
34 Ga0075435_100148690 3300007076 Bacteria 1968
35 Ga0105240_10990871 3300009093 Bacteria 899
36 Ga0105240_11806040 3300009093 Bacteria 637
37 Ga0111539_10076046 3300009094 Bacteria 3954
38 Ga0111539_11189329 3300009094 Bacteria 885
39 Ga0105245_10492675 3300009098 Bacteria 1240
40 Ga0105247_10003690 3300009101 Bacteria 9936
41 Ga0105243_11831189 3300009148 Bacteria 638
42 Ga0105242_10097645 3300009176 Bacteria 2484
43 Ga0105238_11414140 3300009551 Bacteria 723
44 Ga0105238_11506875 3300009551 Unclassified 701
45 Ga0105246_10268373 3300011119 Bacteria 1363
46 Ga0157374_10091302 3300013296 Bacteria 2904
47 Ga0157374_11392446 3300013296 Bacteria 724
48 Ga0163163_10369228 3300014325 Bacteria 1492
49 Ga0163163_10730432 3300014325 Bacteria 1054
50 Ga0157380_11836260 3300014326 Bacteria 666
51 Ga0157376_10085537 3300014969 Bacteria 2717
52 Ga0213876_10025237 3300021384 Bacteria 3137
53 Ga0207710_10000970 3300025900 Bacteria 15084
54 Ga0207695_10453413 3300025913 Bacteria 1165
55 Ga0207646_10097917 3300025922 Bacteria 2628
56 Ga0207650_10480499 3300025925 Bacteria 1037
57 Ga0207686_10237389 3300025934 Bacteria 1325
58 Ga0207670_10005394 3300025936 Bacteria 7014
59 Ga0207704_10084243 3300025938 Bacteria 2066
60 Ga0207689_10728719 3300025942 Bacteria 836
61 Ga0207661_10230954 3300025944 Bacteria 1638
62 Ga0207661_10649245 3300025944 Bacteria 970
63 Ga0207677_10043856 3300026023 Bacteria 2976
64 Ga0207678_10678888 3300026067 Bacteria 906
65 Ga0207641_10295880 3300026088 Bacteria 1527
66 Ga0207648_10088131 3300026089 Bacteria 2710
67 Ga0207683_10401366 3300026121 Bacteria 1261
68 Ga0207428_10096037 3300027907 Bacteria 2295
69 Ga0268264_10294590 3300028381 Bacteria 1525
70 Ga0268264_11167969 3300028381 Bacteria 779
71 Ga0307514_10050235 3300031649 Bacteria 3239
72 Ga0265314_10029849 3300031711 Bacteria 4046
73 Ga0316576_10089459 3300031727 Bacteria 2293
74 Ga0316578_10276895 3300031728 Bacteria 1005
75 Ga0307413_10701362 3300031824 Bacteria 841
76 Ga0307410_10167213 3300031852 Bacteria 1653
77 Ga0307406_10015119 3300031901 Bacteria 4459
78 Ga0307407_10397138 3300031903 Bacteria 988
79 Ga0307415_100186242 3300032126 Bacteria 1634
80 Ga0307507_10109936 3300033179 Bacteria 2258
81 Ga0373939_0244448 3300035114 Bacteria 696
82 Ga0373931_0147691 3300035691 Bacteria 1368
83 Ga0373931_0189098 3300035691 Bacteria 1224
84 Ga0373935_0126145 3300035692 Bacteria 1715
85 Ga0373927_0028186 3300035695 Bacteria 3664
86 Ga0373937_0675787 3300036401 Bacteria 979
87 Ga0265778_001330 3300036457 Bacteria 2231
88 Ga0265778_022176 3300036457 Bacteria 790
89 Ga0395905_0013305 3300037471 Bacteria 7889
90 Ga0436365_0896462 3300039437 Bacteria 3816
91 Ga0436360_0078811 3300039438 Bacteria 768
92 Ga0436361_0085753 3300039447 Bacteria 744
93 Ga0439436_0098942 3300041404 Bacteria 813
94 Ga0439465_0031889 3300041413 Bacteria 1681
95 Ga0439465_0105596 3300041413 Bacteria 976
96 Ga0439434_0064358 3300042435 Bacteria 1150
97 Ga0451577_0484331 3300042876 Bacteria 1123
98 Ga0466965_0691711 3300044683 Bacteria 584
99 Ga0453684_0298665 3300044712 Bacteria 1831
100 Ga0451576_0037161 3300045051 Bacteria 5159
101 Ga0495584_0443190 3300046491 Bacteria 660
102 Ga0495645_0394894 3300046543 Bacteria 882
103 Ga0496104_0766720 3300048907 Bacteria 871
104 Ga0496106_0220720 3300048909 Bacteria 1512
105 Ga0496116_0037180 3300048919 Bacteria 3398
106 Ga0496119_0390031 3300048922 Bacteria 666
107 Ga0501310_015282 3300049130 Bacteria 909
108 Ga0501305_000074 3300049161 Bacteria 5694
109 Ga0501311_000437 3300049527 Bacteria 2874
110 Ga0501312_005801 3300049528 Bacteria 1517
111 Ga0501314_027224 3300049530 Bacteria 622
112 Ga0501320_001060 3300049536 Bacteria 1884
113 Ga0501320_044043 3300049536 Unclassified 592
114 Ga0501323_001695 3300049539 Bacteria 2019
115 Ga0501324_001840 3300049540 Bacteria 1473
116 Ga0501340_024217 3300049556 Bacteria 524
117 Ga0501047_0536652 3300049581 Bacteria 995
118 Ga0501071_0838109 3300049587 Bacteria 709
119 Ga0501074_0203154 3300049590 Bacteria 1412
120 Ga0501083_0500126 3300049744 Bacteria 791
121 nmdc:mga09592_188612_c1 3300050508 Bacteria 1784
122 nmdc:mga08y16_94085_c1 3300050511 Bacteria 3122
123 nmdc:mga0rr50_42251_c1 3300050513 Bacteria 3328
124 nmdc:mga0a205_493246_c1 3300050515 Bacteria 1082
125 Ga0495619_0864365 3300053085 Bacteria 610
126 Ga0500616_0009149 3300053153 Bacteria 6050
127 Ga0587084_008336 3300059477 Bacteria 1311
128 Ga0587084_010032 3300059477 Bacteria 1235
129 Ga0587084_013195 3300059477 Bacteria 1132
130 Ga0587084_028993 3300059477 Bacteria 879
131 Ga0587084_038461 3300059477 Bacteria 802
132 Ga0587093_003122 3300059478 Bacteria 1600
133 Ga0587093_010675 3300059478 Bacteria 1088
134 Ga0587070_007292 3300059491 Bacteria 1528
135 Ga0587070_011096 3300059491 Bacteria 1341
136 Ga0587070_041439 3300059491 Bacteria 883
137 Ga0587070_168709 3300059491 Bacteria 561
138 Ga0587077_040851 3300059493 Bacteria 930
139 Ga0587082_009571 3300059504 Bacteria 1377
140 Ga0587085_020209 3300059506 Bacteria 1005
141 Ga0587085_021106 3300059506 Bacteria 992
142 Ga0587085_032796 3300059506 Bacteria 864
143 Ga0587085_107680 3300059506 Bacteria 597
144 Ga0587086_040300 3300059507 Bacteria 721
145 Ga0587091_003722 3300059511 Bacteria 1944
146 Ga0587092_022610 3300059512 Bacteria 985
147 Ga0587094_009969 3300059513 Bacteria 1224
148 Ga0587101_013517 3300059623 Bacteria 1077
149 Ga0587109_002316 3300059624 Bacteria 2398
150 Ga0587109_015355 3300059624 Bacteria 1298
151 Ga0587117_025777 3300059627 Unclassified 854
152 Ga0587062_000258 3300059639 Bacteria 3320
153 Ga0587062_021645 3300059639 Bacteria 917
154 Ga0587062_022320 3300059639 Bacteria 908
155 Ga0587062_024593 3300059639 Bacteria 881
156 Ga0587068_097563 3300059641 Unclassified 613
157 Ga0587069_013677 3300059642 Bacteria 1120
158 Ga0587069_032335 3300059642 Bacteria 853
159 Ga0587072_028229 3300059643 Bacteria 1034
160 Ga0587072_070105 3300059643 Bacteria 739
161 Ga0587076_036160 3300059645 Bacteria 901
162 Ga0587076_080693 3300059645 Bacteria 693
163 Ga0587078_004664 3300059646 Bacteria 1438
164 Ga0587100_002807 3300059648 Bacteria 1153
165 Ga0587108_002632 3300059653 Bacteria 1218
166 Ga0587119_015823 3300059658 Bacteria 918
167 Ga0587124_001709 3300059660 Bacteria 1463
168 Ga0587071_012831 3300060344 Bacteria 1435
169 Ga0587111_0004420 3300060346 Bacteria 2090
170 Ga0587111_0006960 3300060346 Bacteria 1817
171 Ga0587111_0012362 3300060346 Bacteria 1507
172 Ga0587111_0061736 3300060346 Bacteria 854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053085 Ga0495619_0864365 Ga0495619_0864365_13_453 129
2 3300049527 Ga0501311_000437 Ga0501311_000437_1742_2266 139
3 3300049556 Ga0501340_024217 Ga0501340_024217_41_490 139
4 3300036457 Ga0265778_022176 Ga0265778_022176_16_492 141
5 3300059639 Ga0587062_024593 Ga0587062_024593_119_643 141
6 3300060346 Ga0587111_0006960 Ga0587111_0006960_451_975 141
7 3300005617 Ga0068859_100401840 Ga0068859_1004018402 147
8 3300006931 Ga0097620_100401784 Ga0097620_1004017842 147
9 3300033179 Ga0307507_10109936 Ga0307507_101099362 148
10 3300041404 Ga0439436_0098942 Ga0439436_0098942_145_675 151
11 3300044683 Ga0466965_0691711 Ga0466965_0691711_32_562 151
12 3300049536 Ga0501320_044043 Ga0501320_044043_38_574 151
13 3300059491 Ga0587070_168709 Ga0587070_168709_11_535 152
14 3300059493 Ga0587077_040851 Ga0587077_040851_226_750 152
15 3300059506 Ga0587085_021106 Ga0587085_021106_182_706 152
16 3300059513 Ga0587094_009969 Ga0587094_009969_303_827 152
17 3300005365 Ga0070688_100838588 Ga0070688_1008385881 153
18 3300039438 Ga0436360_0078811 Ga0436360_0078811_226_744 153
19 3300039447 Ga0436361_0085753 Ga0436361_0085753_96_614 153
20 3300059491 Ga0587070_007292 Ga0587070_007292_271_825 153
21 3300005330 Ga0070690_100766121 Ga0070690_1007661212 154
22 3300004803 Ga0058862_10273602 Ga0058862_102736022 155
23 3300005365 Ga0070688_101058432 Ga0070688_1010584321 155
24 3300007076 Ga0075435_100148690 Ga0075435_1001486902 155
25 3300009093 Ga0105240_10990871 Ga0105240_109908712 155
26 3300009094 Ga0111539_11189329 Ga0111539_111893291 155
27 3300009101 Ga0105247_10003690 Ga0105247_100036907 155
28 3300009551 Ga0105238_11506875 Ga0105238_115068752 155
29 3300025900 Ga0207710_10000970 Ga0207710_100009703 155
30 3300025913 Ga0207695_10453413 Ga0207695_104534132 155
31 3300025942 Ga0207689_10728719 Ga0207689_107287192 155
32 3300031728 Ga0316578_10276895 Ga0316578_102768952 155
33 3300046491 Ga0495584_0443190 Ga0495584_0443190_20_544 155
34 3300048919 Ga0496116_0037180 Ga0496116_0037180_992_1516 155
35 3300048922 Ga0496119_0390031 Ga0496119_0390031_63_587 155
36 3300049581 Ga0501047_0536652 Ga0501047_0536652_10_537 155
37 3300049587 Ga0501071_0838109 Ga0501071_0838109_16_534 155
38 3300049744 Ga0501083_0500126 Ga0501083_0500126_13_531 155
39 3300050513 nmdc:mga0rr50_42251_c1 nmdc:mga0rr50_42251_c1_2408_2932 155
40 3300053153 Ga0500616_0009149 Ga0500616_0009149_4426_4989 155
41 3300059506 Ga0587085_107680 Ga0587085_107680_49_573 155
42 3300059624 Ga0587109_015355 Ga0587109_015355_284_808 155
43 3300060346 Ga0587111_0004420 Ga0587111_0004420_1150_1674 155
44 3300004798 Ga0058859_11719133 Ga0058859_117191333 156
45 3300004798 Ga0058859_11809678 Ga0058859_118096782 156
46 3300004800 Ga0058861_11955377 Ga0058861_119553772 156
47 3300004801 Ga0058860_12090967 Ga0058860_120909673 156
48 3300004803 Ga0058862_12199630 Ga0058862_121996301 156
49 3300005340 Ga0070689_100039067 Ga0070689_1000390673 156
50 3300005539 Ga0068853_100493556 Ga0068853_1004935562 156
51 3300025936 Ga0207670_10005394 Ga0207670_100053944 156
52 3300031727 Ga0316576_10089459 Ga0316576_100894593 156
53 3300031852 Ga0307410_10167213 Ga0307410_101672133 156
54 3300031901 Ga0307406_10015119 Ga0307406_100151192 156
55 3300031903 Ga0307407_10397138 Ga0307407_103971382 156
56 3300041413 Ga0439465_0031889 Ga0439465_0031889_574_1110 156
57 3300042435 Ga0439434_0064358 Ga0439434_0064358_275_805 156
58 3300042876 Ga0451577_0484331 Ga0451577_0484331_65_610 156
59 3300044712 Ga0453684_0298665 Ga0453684_0298665_397_942 156
60 3300059642 Ga0587069_013677 Ga0587069_013677_503_1024 156
61 3300004798 Ga0058859_10118766 Ga0058859_101187662 157
62 3300005329 Ga0070683_101155832 Ga0070683_1011558321 157
63 3300005336 Ga0070680_101247865 Ga0070680_1012478651 157
64 3300005338 Ga0068868_100065914 Ga0068868_1000659143 157
65 3300005364 Ga0070673_100759657 Ga0070673_1007596571 157
66 3300005456 Ga0070678_100203913 Ga0070678_1002039131 157
67 3300005459 Ga0068867_100124906 Ga0068867_1001249063 157
68 3300005466 Ga0070685_10773045 Ga0070685_107730452 157
69 3300005535 Ga0070684_100340394 Ga0070684_1003403942 157
70 3300005841 Ga0068863_101558514 Ga0068863_1015585142 157
71 3300005843 Ga0068860_100512516 Ga0068860_1005125162 157
72 3300005844 Ga0068862_101252887 Ga0068862_1012528871 157
73 3300006237 Ga0097621_100100789 Ga0097621_1001007893 157
74 3300006358 Ga0068871_100028407 Ga0068871_1000284078 157
75 3300006881 Ga0068865_100058801 Ga0068865_1000588012 157
76 3300009094 Ga0111539_10076046 Ga0111539_100760464 157
77 3300009098 Ga0105245_10492675 Ga0105245_104926752 157
78 3300009176 Ga0105242_10097645 Ga0105242_100976452 157
79 3300011119 Ga0105246_10268373 Ga0105246_102683731 157
80 3300013296 Ga0157374_10091302 Ga0157374_100913023 157
81 3300014969 Ga0157376_10085537 Ga0157376_100855375 157
82 3300025934 Ga0207686_10237389 Ga0207686_102373893 157
83 3300025938 Ga0207704_10084243 Ga0207704_100842432 157
84 3300025944 Ga0207661_10230954 Ga0207661_102309543 157
85 3300026023 Ga0207677_10043856 Ga0207677_100438563 157
86 3300026089 Ga0207648_10088131 Ga0207648_100881312 157
87 3300026121 Ga0207683_10401366 Ga0207683_104013661 157
88 3300027907 Ga0207428_10096037 Ga0207428_100960373 157
89 3300028381 Ga0268264_10294590 Ga0268264_102945902 157
90 3300031711 Ga0265314_10029849 Ga0265314_100298494 157
91 3300035114 Ga0373939_0244448 Ga0373939_0244448_127_654 157
92 3300046543 Ga0495645_0394894 Ga0495645_0394894_20_547 157
93 3300048907 Ga0496104_0766720 Ga0496104_0766720_308_838 157
94 3300048909 Ga0496106_0220720 Ga0496106_0220720_870_1415 157
95 3300050508 nmdc:mga09592_188612_c1 nmdc:mga09592_188612_c1_141_668 157
96 3300050511 nmdc:mga08y16_94085_c1 nmdc:mga08y16_94085_c1_395_922 157
97 3300059477 Ga0587084_008336 Ga0587084_008336_281_805 157
98 3300059506 Ga0587085_020209 Ga0587085_020209_88_612 157
99 3300021384 Ga0213876_10025237 Ga0213876_100252374 158
100 3300036401 Ga0373937_0675787 Ga0373937_0675787_380_907 158
101 3300037471 Ga0395905_0013305 Ga0395905_0013305_2297_2851 158
102 3300039437 Ga0436365_0896462 Ga0436365_0896462_482_1015 158
103 3300041413 Ga0439465_0105596 Ga0439465_0105596_98_628 158
104 3300049590 Ga0501074_0203154 Ga0501074_0203154_500_1084 158
105 3300059477 Ga0587084_038461 Ga0587084_038461_97_624 158
106 3300059624 Ga0587109_002316 Ga0587109_002316_1080_1607 158
107 3300059645 Ga0587076_080693 Ga0587076_080693_101_637 158
108 3300005530 Ga0070679_101539538 Ga0070679_1015395381 159
109 3300006852 Ga0075433_11278451 Ga0075433_112784511 159
110 3300009148 Ga0105243_11831189 Ga0105243_118311891 159
111 3300013296 Ga0157374_11392446 Ga0157374_113924461 159
112 3300025925 Ga0207650_10480499 Ga0207650_104804992 159
113 3300025944 Ga0207661_10649245 Ga0207661_106492452 159
114 3300026088 Ga0207641_10295880 Ga0207641_102958801 159
115 3300032126 Ga0307415_100186242 Ga0307415_1001862422 159
116 3300005468 Ga0070707_100012678 Ga0070707_1000126782 160
117 3300014325 Ga0163163_10730432 Ga0163163_107304322 160
118 3300014326 Ga0157380_11836260 Ga0157380_118362601 160
119 3300025922 Ga0207646_10097917 Ga0207646_100979173 160
120 3300031649 Ga0307514_10050235 Ga0307514_100502353 160
121 3300035691 Ga0373931_0147691 Ga0373931_0147691_747_1295 160
122 3300035692 Ga0373935_0126145 Ga0373935_0126145_324_872 160
123 3300035695 Ga0373927_0028186 Ga0373927_0028186_751_1299 160
124 3300036457 Ga0265778_001330 Ga0265778_001330_71_610 160
125 3300059477 Ga0587084_013195 Ga0587084_013195_527_1066 160
126 3300009093 Ga0105240_11806040 Ga0105240_118060401 161
127 3300009551 Ga0105238_11414140 Ga0105238_114141401 161
128 3300014325 Ga0163163_10369228 Ga0163163_103692282 161
129 3300026067 Ga0207678_10678888 Ga0207678_106788882 161
130 3300028381 Ga0268264_11167969 Ga0268264_111679691 161
131 3300031824 Ga0307413_10701362 Ga0307413_107013621 161
132 3300045051 Ga0451576_0037161 Ga0451576_0037161_2152_2691 161
133 3300049130 Ga0501310_015282 Ga0501310_015282_93_629 161
134 3300049161 Ga0501305_000074 Ga0501305_000074_1711_2247 161
135 3300049528 Ga0501312_005801 Ga0501312_005801_670_1206 161
136 3300049536 Ga0501320_001060 Ga0501320_001060_699_1256 161
137 3300049539 Ga0501323_001695 Ga0501323_001695_729_1286 161
138 3300049540 Ga0501324_001840 Ga0501324_001840_690_1247 161
139 3300050515 nmdc:mga0a205_493246_c1 nmdc:mga0a205_493246_c1_467_1021 161
140 3300059477 Ga0587084_010032 Ga0587084_010032_472_1008 161
141 3300059477 Ga0587084_028993 Ga0587084_028993_101_655 161
142 3300059478 Ga0587093_003122 Ga0587093_003122_550_1086 161
143 3300059491 Ga0587070_011096 Ga0587070_011096_279_815 161
144 3300059504 Ga0587082_009571 Ga0587082_009571_291_827 161
145 3300059506 Ga0587085_032796 Ga0587085_032796_209_745 161
146 3300059511 Ga0587091_003722 Ga0587091_003722_1084_1620 161
147 3300059623 Ga0587101_013517 Ga0587101_013517_379_933 161
148 3300059627 Ga0587117_025777 Ga0587117_025777_175_711 161
149 3300059639 Ga0587062_000258 Ga0587062_000258_2275_2811 161
150 3300059639 Ga0587062_021645 Ga0587062_021645_214_750 161
151 3300059639 Ga0587062_022320 Ga0587062_022320_133_669 161
152 3300059641 Ga0587068_097563 Ga0587068_097563_22_558 161
153 3300059642 Ga0587069_032335 Ga0587069_032335_219_773 161
154 3300059643 Ga0587072_028229 Ga0587072_028229_282_818 161
155 3300059643 Ga0587072_070105 Ga0587072_070105_128_664 161
156 3300059645 Ga0587076_036160 Ga0587076_036160_169_705 161
157 3300059646 Ga0587078_004664 Ga0587078_004664_780_1316 161
158 3300059648 Ga0587100_002807 Ga0587100_002807_267_803 161
159 3300059653 Ga0587108_002632 Ga0587108_002632_166_702 161
160 3300059658 Ga0587119_015823 Ga0587119_015823_100_636 161
161 3300059660 Ga0587124_001709 Ga0587124_001709_663_1199 161
162 3300060344 Ga0587071_012831 Ga0587071_012831_660_1196 161
163 3300060346 Ga0587111_0012362 Ga0587111_0012362_314_850 161
164 3300003322 rootL2_10140716 rootL2_101407161 162
165 3300004801 Ga0058860_12167689 Ga0058860_121676891 162
166 3300035691 Ga0373931_0189098 Ga0373931_0189098_525_1064 162
167 3300049530 Ga0501314_027224 Ga0501314_027224_52_594 162
168 3300059478 Ga0587093_010675 Ga0587093_010675_486_1040 162
169 3300059491 Ga0587070_041439 Ga0587070_041439_225_770 162
170 3300059507 Ga0587086_040300 Ga0587086_040300_130_684 162
171 3300059512 Ga0587092_022610 Ga0587092_022610_318_872 162
172 3300060346 Ga0587111_0061736 Ga0587111_0061736_109_663 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00466

Ribosomal_L10

Ribosomal protein L10

1

100

0.97

Feature Viewer

pLDDT pTM Quality
55.54 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map