F255180

General Info

Members Datasets Scaffolds Average Seq Length
169 133 338 480

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0616250|Ga0436365_0616250_732_2288
Length 518
Sequence MKRWPPGGREGVPRPGRLPIRRLLVQNDPRSGGATNDEEWRMADLADIGVLGLAVMGANLARNAARKGFGVALYNRHGGRTDELIGEHGDEGSFFPAKSLGDFVKAIRKPRPIIVMVKAGKPVDDVIEELLPHLEAGDILIDGGNSQFTDTNRRSARLKDTGIRFVGMGVSGGEEGALNGPSMMPGGELESYRRIEPIVRKMAAQVDGTPCVTYIGPEGAGHYVKMVHNGIEYADMQLIAEAYDLLKTVYGLDAGAIAEIFEEWKKGDLDSYLIEITAAVLRKRDATGGALVDSIVDEAEQKGTGRWAVQSALDLGVPLTAITEAVFARALSARRTQRLAAEKLLARPAVKPRKASQADIDAIRDGLYASKIVAYAQGFEEMSAASQEYGWSLKLGELAMIWRGGCIIRARLLHRITEAYEKDAAAPNLLLQPFFSEAVTKAEANWRKMVGLAIESGVPTPAFSSSLAYYDGMRRGRGPANLLQGLRDYFGAHTYRRLDKEGSFHTRWSQDGSEVSTG

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
34 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
35 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
71 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
82 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
83 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
84 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
85 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
86 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
87 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
88 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
89 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
90 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
113 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
114 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
115 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
116 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
117 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
118 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
119 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
120 2831426010 Nostoc sp. 106C Isolate Unclassified
121 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
122 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
123 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
124 2849660919 Nostoc sp. T09 Isolate Unclassified
125 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
126 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
127 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
128 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
129 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
130 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
131 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
132 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
133 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.94
Metatranscriptomes 0
Isolates 10.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.37
Nodule 0
Rhizoplane 2.37
Rhizosphere 74.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0616250 3300039437 Bacteria 2343
2 Ga0070676_10023759 3300005328 Bacteria 3447
3 Ga0070687_100062106 3300005343 Bacteria 1977
4 Ga0070668_100066180 3300005347 Bacteria 2803
5 Ga0070671_100001423 3300005355 Bacteria 17885
6 Ga0070659_100072839 3300005366 Bacteria 2734
7 Ga0070667_100037153 3300005367 Bacteria 4083
8 Ga0070667_100203135 3300005367 Bacteria 1759
9 Ga0070709_10045345 3300005434 Bacteria 2728
10 Ga0070709_10117123 3300005434 Bacteria 1800
11 Ga0070714_100029117 3300005435 Bacteria 4589
12 Ga0070714_100166649 3300005435 Bacteria 1997
13 Ga0070713_100161884 3300005436 Bacteria 1998
14 Ga0070713_100181768 3300005436 Bacteria 1890
15 Ga0070710_10075678 3300005437 Bacteria 1951
16 Ga0070711_100085508 3300005439 Bacteria 2259
17 Ga0070700_100021701 3300005441 Bacteria 3735
18 Ga0070708_100072744 3300005445 Bacteria 3097
19 Ga0070708_100101074 3300005445 Bacteria 2640
20 Ga0070678_100107114 3300005456 Bacteria 2179
21 Ga0070707_100007719 3300005468 Bacteria 9994
22 Ga0070707_100198317 3300005468 Bacteria 1957
23 Ga0070698_100016305 3300005471 Bacteria 7843
24 Ga0070699_100000006 3300005518 Bacteria 363492
25 Ga0070699_100000134 3300005518 Bacteria 68781
26 Ga0070699_100028614 3300005518 Bacteria 4805
27 Ga0070679_100001466 3300005530 Bacteria 20918
28 Ga0070684_100101229 3300005535 Bacteria 2574
29 Ga0070697_100000004 3300005536 Bacteria 284078
30 Ga0070697_100000791 3300005536 Bacteria 23735
31 Ga0070665_100003712 3300005548 Bacteria 16168
32 Ga0068864_100071580 3300005618 Bacteria 3020
33 Ga0068863_100051219 3300005841 Bacteria 3914
34 Ga0068862_100032259 3300005844 Bacteria 4425
35 Ga0070717_10000039 3300006028 Bacteria 114756
36 Ga0070712_100030900 3300006175 Bacteria 3604
37 Ga0075436_100021721 3300006914 Bacteria 4404
38 Ga0099794_10000225 3300007265 Bacteria 20295
39 Ga0105251_10050551 3300009011 Bacteria 1985
40 Ga0157369_10266984 3300013105 Bacteria 1784
41 Ga0157376_10052961 3300014969 Bacteria 3377
42 Ga0182005_1006197 3300015265 Bacteria 3674
43 Ga0213873_10001067 3300021358 Bacteria 4461
44 Ga0213872_10047892 3300021361 Bacteria 1943
45 Ga0213876_10003501 3300021384 Bacteria 8966
46 Ga0213876_10038247 3300021384 Bacteria 2532
47 Ga0213875_10001342 3300021388 Bacteria 16193
48 Ga0209148_1000829 3300025254 Bacteria 22139
49 Ga0209455_1000661 3300025272 Bacteria 20976
50 Ga0209025_1037897 3300025294 Bacteria 2130
51 Ga0207653_10013914 3300025885 Bacteria 2522
52 Ga0207645_10115735 3300025907 Bacteria 1738
53 Ga0207643_10016492 3300025908 Bacteria 4030
54 Ga0207684_10015914 3300025910 Bacteria 6464
55 Ga0207693_10078853 3300025915 Bacteria 2577
56 Ga0207652_10001506 3300025921 Bacteria 20557
57 Ga0207646_10000493 3300025922 Bacteria 52838
58 Ga0207646_10000814 3300025922 Bacteria 40565
59 Ga0207646_10003852 3300025922 Bacteria 16662
60 Ga0207646_10016962 3300025922 Bacteria 6824
61 Ga0207646_10063047 3300025922 Bacteria 3309
62 Ga0207646_10152642 3300025922 Bacteria 2083
63 Ga0207646_10182518 3300025922 Bacteria 1895
64 Ga0207700_10048244 3300025928 Bacteria 3161
65 Ga0207700_10150094 3300025928 Bacteria 1925
66 Ga0207664_10127079 3300025929 Bacteria 2142
67 Ga0207644_10002050 3300025931 Bacteria 13050
68 Ga0207669_10032886 3300025937 Bacteria 2920
69 Ga0207704_10028393 3300025938 Bacteria 3103
70 Ga0207661_10168166 3300025944 Bacteria 1907
71 Ga0207658_10026041 3300025986 Bacteria 4098
72 Ga0207678_10001621 3300026067 Bacteria 20684
73 Ga0207708_10077274 3300026075 Bacteria 2555
74 Ga0207708_10102010 3300026075 Bacteria 2221
75 Ga0207641_10085460 3300026088 Bacteria 2749
76 Ga0207683_10103443 3300026121 Bacteria 2544
77 Ga0209588_1000160 3300027671 Bacteria 19302
78 Ga0268266_10000368 3300028379 Bacteria 69355
79 Ga0268266_10027201 3300028379 Bacteria 4865
80 Ga0268266_10107832 3300028379 Bacteria 2463
81 Ga0268264_10002135 3300028381 Bacteria 17647
82 Ga0307513_10005066 3300031456 Bacteria 17440
83 Ga0307408_100163622 3300031548 Bacteria 1770
84 Ga0307409_100091071 3300031995 Bacteria 2498
85 Ga0307416_100132831 3300032002 Bacteria 2245
86 Ga0395900_0183031 3300037418 Bacteria 2128
87 Ga0436364_1231633 3300037853 Bacteria 1850
88 Ga0436365_0045949 3300039437 Bacteria 15406
89 Ga0436365_0244188 3300039437 Bacteria 6911
90 Ga0436360_0832089 3300039438 Bacteria 5054
91 Ga0436361_0382542 3300039447 Bacteria 7192
92 Ga0436363_0214642 3300039450 Bacteria 1831
93 Ga0453683_0010790 3300044673 Bacteria 6047
94 Ga0453683_0016879 3300044673 Bacteria 4706
95 Ga0466965_0002894 3300044683 Bacteria 7412
96 Ga0453684_0014099 3300044712 Bacteria 12853
97 Ga0466970_0001507 3300044765 Bacteria 11213
98 Ga0466960_0000692 3300044901 Bacteria 11756
99 Ga0466960_0009706 3300044901 Bacteria 3978
100 Ga0466959_0100231 3300045049 Bacteria 2074
101 Ga0451576_0014327 3300045051 Bacteria 8832
102 Ga0466958_0054835 3300045836 Bacteria 2418
103 Ga0466967_0028317 3300045976 Bacteria 4676
104 Ga0466967_0068995 3300045976 Bacteria 3158
105 Ga0496104_0054222 3300048907 Bacteria 3790
106 Ga0496105_0046483 3300048908 Bacteria 3583
107 Ga0496105_0093273 3300048908 Bacteria 2486
108 Ga0496108_0129439 3300048911 Bacteria 2169
109 Ga0496116_0000974 3300048919 Bacteria 35126
110 Ga0496117_0001121 3300048920 Bacteria 40383
111 Ga0496118_0027662 3300048921 Bacteria 4791
112 Ga0496119_0001485 3300048922 Bacteria 28118
113 Ga0496119_0002117 3300048922 Bacteria 22364
114 Ga0496120_0020978 3300048923 Bacteria 4136
115 Ga0496121_0010688 3300048924 Bacteria 10302
116 Ga0496121_0112465 3300048924 Bacteria 2074
117 Ga0496125_0018277 3300048928 Bacteria 6661
118 Ga0496126_0089749 3300048929 Bacteria 2705
119 Ga0496126_0105912 3300048929 Bacteria 2454
120 Ga0501031_0005064 3300049568 Bacteria 8574
121 Ga0501033_0007190 3300049570 Bacteria 8688
122 Ga0501034_0038460 3300049571 Bacteria 4844
123 Ga0501036_0007837 3300049572 Bacteria 8738
124 Ga0501037_0006137 3300049573 Bacteria 8777
125 Ga0501038_0009722 3300049574 Bacteria 8817
126 Ga0501039_0007672 3300049575 Bacteria 8236
127 Ga0501042_0026983 3300049578 Bacteria 4037
128 Ga0501043_0007330 3300049579 Bacteria 8757
129 Ga0501046_0001176 3300049580 Bacteria 25450
130 Ga0501047_0003014 3300049581 Bacteria 15979
131 Ga0501047_0009417 3300049581 Bacteria 9228
132 Ga0501047_0293247 3300049581 Bacteria 1470
133 Ga0501048_0001599 3300049582 Bacteria 17205
134 Ga0501069_0001038 3300049585 Bacteria 13264
135 Ga0501069_0004914 3300049585 Bacteria 6928
136 Ga0501070_0001119 3300049586 Bacteria 24068
137 Ga0501073_0006916 3300049589 Bacteria 8445
138 Ga0501074_0006434 3300049590 Bacteria 8483
139 Ga0501074_0041598 3300049590 Bacteria 3327
140 Ga0501257_008423 3300049686 Bacteria 2317
141 Ga0501080_0033927 3300049742 Bacteria 4764
142 Ga0501083_0000135 3300049744 Bacteria 50108
143 Ga0501083_0005826 3300049744 Bacteria 8729
144 Ga0501083_0069926 3300049744 Bacteria 2335
145 Ga0501035_0002410 3300049822 Bacteria 18325
146 Ga0501044_0013792 3300049823 Bacteria 8733
147 Ga0501044_0089767 3300049823 Bacteria 3101
148 Ga0501045_0034241 3300049824 Bacteria 3686
149 nmdc:mga0n895_21508_c1 3300050512 Bacteria 6035
150 nmdc:mga08x19_60137_c1 3300050514 Bacteria 2461
151 Ga0500559_0007659 3300053136 Bacteria 4769
152 Ga0501082_0009293 3300060353 Bacteria 8475
153 2599106224 2597490356 Bacteria 7030811
154 2617916318 2617270889 Bacteria 9064343
155 2816508903 2816332139 Bacteria 9138787
156 2831427797 2831426010 Bacteria 8662725
157 2846956022 2846952575 Bacteria 6587527
158 2848699793 2848694841 Bacteria 9205737
159 2848862227 2848858292 Bacteria 7391279
160 2849666929 2849660919 Bacteria 8251853
161 2886629672 2886627955 Bacteria 7618130
162 2902796476 2902792274 Bacteria 7270173
163 2913849822 2913844669 Bacteria 8381711
164 2913945423 2913939268 Bacteria 8559644
165 2915361676 2915358134 Bacteria 6050864
166 2919454824 2919450847 Bacteria 5631160
167 2939673518 2939669807 Bacteria 5028511
168 642605212 642555144 Bacteria 9059191
169 8001850289 8001845381 Bacteria 5804942
170 Ga0436365_0616250
171 Ga0070676_10023759
172 Ga0070687_100062106
173 Ga0070668_100066180
174 Ga0070671_100001423
175 Ga0070659_100072839
176 Ga0070667_100037153
177 Ga0070667_100203135
178 Ga0070709_10045345
179 Ga0070709_10117123
180 Ga0070714_100029117
181 Ga0070714_100166649
182 Ga0070713_100161884
183 Ga0070713_100181768
184 Ga0070710_10075678
185 Ga0070711_100085508
186 Ga0070700_100021701
187 Ga0070708_100072744
188 Ga0070708_100101074
189 Ga0070678_100107114
190 Ga0070707_100007719
191 Ga0070707_100198317
192 Ga0070698_100016305
193 Ga0070699_100000006
194 Ga0070699_100000134
195 Ga0070699_100028614
196 Ga0070679_100001466
197 Ga0070684_100101229
198 Ga0070697_100000004
199 Ga0070697_100000791
200 Ga0070665_100003712
201 Ga0068864_100071580
202 Ga0068863_100051219
203 Ga0068862_100032259
204 Ga0070717_10000039
205 Ga0070712_100030900
206 Ga0075436_100021721
207 Ga0099794_10000225
208 Ga0105251_10050551
209 Ga0157369_10266984
210 Ga0157376_10052961
211 Ga0182005_1006197
212 Ga0213873_10001067
213 Ga0213872_10047892
214 Ga0213876_10003501
215 Ga0213876_10038247
216 Ga0213875_10001342
217 Ga0209148_1000829
218 Ga0209455_1000661
219 Ga0209025_1037897
220 Ga0207653_10013914
221 Ga0207645_10115735
222 Ga0207643_10016492
223 Ga0207684_10015914
224 Ga0207693_10078853
225 Ga0207652_10001506
226 Ga0207646_10000493
227 Ga0207646_10000814
228 Ga0207646_10003852
229 Ga0207646_10016962
230 Ga0207646_10063047
231 Ga0207646_10152642
232 Ga0207646_10182518
233 Ga0207700_10048244
234 Ga0207700_10150094
235 Ga0207664_10127079
236 Ga0207644_10002050
237 Ga0207669_10032886
238 Ga0207704_10028393
239 Ga0207661_10168166
240 Ga0207658_10026041
241 Ga0207678_10001621
242 Ga0207708_10077274
243 Ga0207708_10102010
244 Ga0207641_10085460
245 Ga0207683_10103443
246 Ga0209588_1000160
247 Ga0268266_10000368
248 Ga0268266_10027201
249 Ga0268266_10107832
250 Ga0268264_10002135
251 Ga0307513_10005066
252 Ga0307408_100163622
253 Ga0307409_100091071
254 Ga0307416_100132831
255 Ga0395900_0183031
256 Ga0436364_1231633
257 Ga0436365_0045949
258 Ga0436365_0244188
259 Ga0436360_0832089
260 Ga0436361_0382542
261 Ga0436363_0214642
262 Ga0453683_0010790
263 Ga0453683_0016879
264 Ga0466965_0002894
265 Ga0453684_0014099
266 Ga0466970_0001507
267 Ga0466960_0000692
268 Ga0466960_0009706
269 Ga0466959_0100231
270 Ga0451576_0014327
271 Ga0466958_0054835
272 Ga0466967_0028317
273 Ga0466967_0068995
274 Ga0496104_0054222
275 Ga0496105_0046483
276 Ga0496105_0093273
277 Ga0496108_0129439
278 Ga0496116_0000974
279 Ga0496117_0001121
280 Ga0496118_0027662
281 Ga0496119_0001485
282 Ga0496119_0002117
283 Ga0496120_0020978
284 Ga0496121_0010688
285 Ga0496121_0112465
286 Ga0496125_0018277
287 Ga0496126_0089749
288 Ga0496126_0105912
289 Ga0501031_0005064
290 Ga0501033_0007190
291 Ga0501034_0038460
292 Ga0501036_0007837
293 Ga0501037_0006137
294 Ga0501038_0009722
295 Ga0501039_0007672
296 Ga0501042_0026983
297 Ga0501043_0007330
298 Ga0501046_0001176
299 Ga0501047_0003014
300 Ga0501047_0009417
301 Ga0501047_0293247
302 Ga0501048_0001599
303 Ga0501069_0001038
304 Ga0501069_0004914
305 Ga0501070_0001119
306 Ga0501073_0006916
307 Ga0501074_0006434
308 Ga0501074_0041598
309 Ga0501257_008423
310 Ga0501080_0033927
311 Ga0501083_0000135
312 Ga0501083_0005826
313 Ga0501083_0069926
314 Ga0501035_0002410
315 Ga0501044_0013792
316 Ga0501044_0089767
317 Ga0501045_0034241
318 nmdc:mga0n895_21508_c1
319 nmdc:mga08x19_60137_c1
320 Ga0500559_0007659
321 Ga0501082_0009293
322 2599106224
323 2617916318
324 2816508903
325 2831427797
326 2846956022
327 2848699793
328 2848862227
329 2849666929
330 2886629672
331 2902796476
332 2913849822
333 2913945423
334 2915361676
335 2919454824
336 2939673518
337 642605212
338 8001850289

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

221

508

0.98

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

47

216

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fwn-assembly1.cif.gz_B dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate 0.9786 2 467
7cb2-assembly1.cif.gz_A the 6-phosphogluconate dehydrogenase (nadp-bound) from staphylococcus aureus 0.9782 1 467
2zya-assembly1.cif.gz_B dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate 0.9771 2 467
7cb2-assembly1.cif.gz_A the 6-phosphogluconate dehydrogenase (nadp-bound) from staphylococcus aureus 0.9741 1 467
2zya-assembly1.cif.gz_B dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate 0.973 2 467
ID Description Score Start End Superfamily
2w8zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9872 2 180 3.40.50.720
af_Q4D0X5_1_185_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.986 5 183 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9838 5 145 3.40.50.720
2w8zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9818 2 180 3.40.50.720
6fqxH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9769 3 179 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A536CT49-F1-model_v4 NADP-dependent phosphogluconate dehydrogenase 0.9998 71 158 GO:0004616
GO:0050661
AF-A0A5C8M9U3-F1-model_v4 NADP-dependent phosphogluconate dehydrogenase (EC 1.1.1.44) 0.9974 63 179 GO:0004616
GO:0050661
AF-W1YAQ0-F1-model_v4 6-phosphogluconate dehydrogenase, decarboxylating 0.9969 53 163 GO:0004616
GO:0050661
AF-B6RPT5-F1-model_v4 phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating) (EC 1.1.1.44) 0.996 318 448 GO:0004616
GO:0006098
GO:0019521
AF-A0A2N0QKL0-F1-model_v4 NAD-binding 6-phosphogluconate dehydrogenase 0.9957 74 163 GO:0004616
GO:0050661

Map