F255177

General Info

Members Datasets Scaffolds Average Seq Length
169 54 338 160

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_251383|Ga0400483_251383_28084_28668
Length 194
Sequence VKGSVFYAGGNWSKLYVQYSGSKGRHFTILVTWMRIGQGYDAHRFGSGKSLVIGGIVVPHDQGLQAHSDGDVLIHALCDALLGAAGLGDIGGHFPDTDPVYAGIDSRVLLRQVMVRVGEDGFRLSNADMTIVAQRPKLAPYIESMRRCLAEDLQLHEQRINIKATTTEGMGFTGRGEGIAALATVLLEEPRIDR

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
4 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
5 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
6 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
7 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
8 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
9 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
10 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
11 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
12 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
13 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
14 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
18 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
19 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
20 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
21 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
22 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
23 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
24 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
25 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
26 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
27 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
28 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
29 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
30 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
31 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
32 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
33 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
34 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
35 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
36 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
37 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
38 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
39 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
40 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
41 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
42 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
43 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
44 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
45 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
46 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
47 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
48 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
49 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
50 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
51 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
52 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
53 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
54 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.49
Metatranscriptomes 6.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.59
Rhizosphere 71.01
Stem 0
Stem Tuber 0
Unclassified 6.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_251383 3300039062 Bacteria 55523
2 rootH1_10130777 3300003323 Bacteria 9742
3 Ga0207699_10813503 3300025906 Bacteria 687
4 Ga0307513_10000272 3300031456 Bacteria 75284
5 Ga0316575_10000385 3300031665 Bacteria 12582
6 Ga0316575_10001560 3300031665 Bacteria 7437
7 Ga0316579_10000973 3300031691 Bacteria 10022
8 Ga0316579_10001889 3300031691 Bacteria 7785
9 Ga0316579_10008217 3300031691 Bacteria 4342
10 Ga0316579_10015270 3300031691 Bacteria 3331
11 Ga0316579_10049376 3300031691 Bacteria 1966
12 Ga0316579_10422084 3300031691 Bacteria 645
13 Ga0316576_10001053 3300031727 Bacteria 14312
14 Ga0316576_10040578 3300031727 Bacteria 3346
15 Ga0316576_10075955 3300031727 Bacteria 2486
16 Ga0316576_10218653 3300031727 Bacteria 1433
17 Ga0316576_10219463 3300031727 Bacteria 1430
18 Ga0316576_10300169 3300031727 Bacteria 1200
19 Ga0316578_10000767 3300031728 Bacteria 11792
20 Ga0316578_10018696 3300031728 Bacteria 3802
21 Ga0316578_10024311 3300031728 Bacteria 3398
22 Ga0316578_10047311 3300031728 Bacteria 2509
23 Ga0316578_10077596 3300031728 Bacteria 1972
24 Ga0316578_10119847 3300031728 Bacteria 1581
25 Ga0316578_10241401 3300031728 Bacteria 1085
26 Ga0316577_10004130 3300031733 Bacteria 7454
27 Ga0316577_10006897 3300031733 Bacteria 6034
28 Ga0316577_10014467 3300031733 Bacteria 4331
29 Ga0316577_10101526 3300031733 Bacteria 1612
30 Ga0316577_10127919 3300031733 Bacteria 1429
31 Ga0316577_10133324 3300031733 Bacteria 1398
32 Ga0307414_10150041 3300032004 Bacteria 1838
33 Ga0316583_10063025 3300032133 Bacteria 1299
34 Ga0316583_10063199 3300032133 Bacteria 1297
35 Ga0316583_10083140 3300032133 Bacteria 1118
36 Ga0316585_10000628 3300032137 Bacteria 8692
37 Ga0316585_10077546 3300032137 Bacteria 1081
38 Ga0316580_10000338 3300032139 Bacteria 10298
39 Ga0316580_10006073 3300032139 Bacteria 3549
40 Ga0316580_10019637 3300032139 Bacteria 2080
41 Ga0316580_10019973 3300032139 Bacteria 2061
42 Ga0316593_10009797 3300032168 Bacteria 2722
43 Ga0316593_10010489 3300032168 Unclassified 2658
44 Ga0316593_10022256 3300032168 Bacteria 1990
45 Ga0316593_10083645 3300032168 Bacteria 1117
46 Ga0316593_10159091 3300032168 Bacteria 824
47 Ga0316593_10184852 3300032168 Bacteria 767
48 Ga0316592_1037575 3300033524 Bacteria 1066
49 Ga0316592_1076600 3300033524 Bacteria 759
50 Ga0316596_1000703 3300033541 Bacteria 6076
51 Ga0316596_1003536 3300033541 Bacteria 3437
52 Ga0316596_1011576 3300033541 Unclassified 2158
53 Ga0316574_0000838 3300035398 Bacteria 13430
54 Ga0316574_0001102 3300035398 Bacteria 12371
55 Ga0316574_0328267 3300035398 Bacteria 970
56 Ga0316574_0382757 3300035398 Bacteria 887
57 Ga0316574_0842833 3300035398 Bacteria 556
58 Ga0316582_0000538 3300036647 Bacteria 14444
59 Ga0316582_0026070 3300036647 Bacteria 3516
60 Ga0316582_0043442 3300036647 Bacteria 2819
61 Ga0316582_0079940 3300036647 Bacteria 2133
62 Ga0316582_0102574 3300036647 Bacteria 1896
63 Ga0316582_0266672 3300036647 Bacteria 1174
64 Ga0316582_0331678 3300036647 Bacteria 1046
65 Ga0316584_0001823 3300036712 Bacteria 13173
66 Ga0316584_0003101 3300036712 Bacteria 10726
67 Ga0316584_0034193 3300036712 Bacteria 3768
68 Ga0316584_0088971 3300036712 Bacteria 2312
69 Ga0316584_0110769 3300036712 Unclassified 2054
70 Ga0316584_0127121 3300036712 Bacteria 1903
71 Ga0316584_0205542 3300036712 Bacteria 1451
72 Ga0316581_0002742 3300037588 Bacteria 4272
73 Ga0316581_0012543 3300037588 Bacteria 2387
74 Ga0316581_0036572 3300037588 Bacteria 1490
75 Ga0400484_06098 3300038725 Bacteria 7825
76 Ga0400484_15735 3300038725 Bacteria 52349
77 Ga0400484_17160 3300038725 Bacteria 3673
78 Ga0400484_23745 3300038725 Bacteria 1244
79 Ga0400484_41503 3300038725 Bacteria 3711
80 Ga0400490_04645 3300038726 Bacteria 12637
81 Ga0400490_31544 3300038726 Bacteria 1266
82 Ga0400490_32268 3300038726 Bacteria 35545
83 Ga0400491_16887 3300038727 Bacteria 2652
84 Ga0400485_16102 3300038735 Bacteria 3160
85 Ga0400485_19410 3300038735 Bacteria 5224
86 Ga0400488_00481 3300038741 Unclassified 2444
87 Ga0400488_11780 3300038741 Unclassified 3386
88 Ga0400488_13493 3300038741 Bacteria 2364
89 Ga0400488_51145 3300038741 Bacteria 4527
90 Ga0400488_52795 3300038741 Bacteria 4474
91 Ga0400486_05347 3300038742 Bacteria 4994
92 Ga0400486_06751 3300038742 Bacteria 16566
93 Ga0400483_000383 3300039062 Bacteria 6178
94 Ga0400483_006417 3300039062 Bacteria 18976
95 Ga0400483_009419 3300039062 Bacteria 9938
96 Ga0400483_012200 3300039062 Unclassified 1386
97 Ga0400483_026308 3300039062 Bacteria 223136
98 Ga0400483_034748 3300039062 Unclassified 1043
99 Ga0400483_044050 3300039062 Bacteria 7150
100 Ga0400483_078235 3300039062 Bacteria 1373
101 Ga0400483_104332 3300039062 Bacteria 1848
102 Ga0400483_130942 3300039062 Bacteria 1863
103 Ga0400483_215349 3300039062 Bacteria 8579
104 Ga0400483_235487 3300039062 Unclassified 1520
105 Ga0400483_242915 3300039062 Bacteria 8100
106 Ga0400483_247565 3300039062 Bacteria 3018
107 Ga0400483_249363 3300039062 Bacteria 6451
108 Ga0400483_250036 3300039062 Bacteria 396353
109 Ga0400483_278627 3300039062 Unclassified 2915
110 Ga0400483_281644 3300039062 Bacteria 8396
111 Ga0400483_291193 3300039062 Bacteria 5042
112 Ga0400487_03724 3300039110 Unclassified 2092
113 Ga0400487_24619 3300039110 Bacteria 1540
114 Ga0400487_25945 3300039110 Bacteria 95730
115 Ga0400487_41681 3300039110 Bacteria 1097
116 Ga0400487_53319 3300039110 Bacteria 2136
117 Ga0400487_55848 3300039110 Bacteria 3502
118 Ga0400487_59347 3300039110 Bacteria 4104
119 Ga0400487_61541 3300039110 Bacteria 1138
120 Ga0451807_2070195 3300041486 Bacteria 525
121 Ga0451577_0000999 3300042876 Bacteria 41097
122 Ga0451577_0027029 3300042876 Bacteria 5195
123 Ga0451577_0066065 3300042876 Bacteria 3226
124 Ga0451577_0095797 3300042876 Bacteria 2650
125 Ga0451577_0484023 3300042876 Bacteria 1123
126 Ga0451577_1618922 3300042876 Bacteria 571
127 Ga0453683_0000482 3300044673 Bacteria 45741
128 Ga0453683_0003630 3300044673 Bacteria 11310
129 Ga0453683_0040842 3300044673 Bacteria 2912
130 Ga0453684_0000051 3300044712 Bacteria 551033
131 Ga0453684_0000264 3300044712 Bacteria 225672
132 Ga0453684_0001730 3300044712 Bacteria 58478
133 Ga0453684_0002153 3300044712 Bacteria 49330
134 Ga0453684_0017315 3300044712 Bacteria 11175
135 Ga0453684_0028002 3300044712 Bacteria 8057
136 Ga0453684_0029340 3300044712 Bacteria 7814
137 Ga0453684_0034957 3300044712 Bacteria 6958
138 Ga0453684_0100675 3300044712 Unclassified 3536
139 Ga0453684_0286990 3300044712 Bacteria 1875
140 Ga0453684_0827630 3300044712 Bacteria 996
141 Ga0451576_0000148 3300045051 Bacteria 178544
142 Ga0451576_0000860 3300045051 Bacteria 58751
143 Ga0451576_0010544 3300045051 Bacteria 10590
144 Ga0451576_0036954 3300045051 Bacteria 5175
145 Ga0451576_0065266 3300045051 Bacteria 3791
146 Ga0501033_0003546 3300049570 Bacteria 12763
147 Ga0501034_0012572 3300049571 Bacteria 8738
148 Ga0501036_0055323 3300049572 Bacteria 3361
149 Ga0501037_0002476 3300049573 Bacteria 13336
150 Ga0501038_0030620 3300049574 Bacteria 4759
151 Ga0501039_0117558 3300049575 Bacteria 2082
152 Ga0501043_0023578 3300049579 Bacteria 4826
153 Ga0501046_0139422 3300049580 Bacteria 1836
154 Ga0501047_0168955 3300049581 Bacteria 2056
155 Ga0501047_0450120 3300049581 Bacteria 1117
156 Ga0501048_1159351 3300049582 Bacteria 556
157 Ga0501067_0024491 3300049583 Bacteria 3348
158 Ga0501068_0023754 3300049584 Bacteria 3595
159 Ga0501072_0259664 3300049588 Bacteria 1383
160 Ga0501073_0011418 3300049589 Bacteria 6499
161 Ga0501074_0402237 3300049590 Bacteria 971
162 Ga0501080_0002489 3300049742 Bacteria 16121
163 Ga0501080_0014481 3300049742 Bacteria 7264
164 Ga0501083_0019407 3300049744 Bacteria 4737
165 Ga0501035_0056658 3300049822 Bacteria 3496
166 Ga0501044_0001571 3300049823 Bacteria 26728
167 nmdc:mga0a205_515734_c1 3300050515 Bacteria 1052
168 Ga0501084_0510010 3300054114 Bacteria 1017
169 Ga0501082_0074484 3300060353 Bacteria 2924
170 Ga0400483_251383
171 rootH1_10130777
172 Ga0207699_10813503
173 Ga0307513_10000272
174 Ga0316575_10000385
175 Ga0316575_10001560
176 Ga0316579_10000973
177 Ga0316579_10001889
178 Ga0316579_10008217
179 Ga0316579_10015270
180 Ga0316579_10049376
181 Ga0316579_10422084
182 Ga0316576_10001053
183 Ga0316576_10040578
184 Ga0316576_10075955
185 Ga0316576_10218653
186 Ga0316576_10219463
187 Ga0316576_10300169
188 Ga0316578_10000767
189 Ga0316578_10018696
190 Ga0316578_10024311
191 Ga0316578_10047311
192 Ga0316578_10077596
193 Ga0316578_10119847
194 Ga0316578_10241401
195 Ga0316577_10004130
196 Ga0316577_10006897
197 Ga0316577_10014467
198 Ga0316577_10101526
199 Ga0316577_10127919
200 Ga0316577_10133324
201 Ga0307414_10150041
202 Ga0316583_10063025
203 Ga0316583_10063199
204 Ga0316583_10083140
205 Ga0316585_10000628
206 Ga0316585_10077546
207 Ga0316580_10000338
208 Ga0316580_10006073
209 Ga0316580_10019637
210 Ga0316580_10019973
211 Ga0316593_10009797
212 Ga0316593_10010489
213 Ga0316593_10022256
214 Ga0316593_10083645
215 Ga0316593_10159091
216 Ga0316593_10184852
217 Ga0316592_1037575
218 Ga0316592_1076600
219 Ga0316596_1000703
220 Ga0316596_1003536
221 Ga0316596_1011576
222 Ga0316574_0000838
223 Ga0316574_0001102
224 Ga0316574_0328267
225 Ga0316574_0382757
226 Ga0316574_0842833
227 Ga0316582_0000538
228 Ga0316582_0026070
229 Ga0316582_0043442
230 Ga0316582_0079940
231 Ga0316582_0102574
232 Ga0316582_0266672
233 Ga0316582_0331678
234 Ga0316584_0001823
235 Ga0316584_0003101
236 Ga0316584_0034193
237 Ga0316584_0088971
238 Ga0316584_0110769
239 Ga0316584_0127121
240 Ga0316584_0205542
241 Ga0316581_0002742
242 Ga0316581_0012543
243 Ga0316581_0036572
244 Ga0400484_06098
245 Ga0400484_15735
246 Ga0400484_17160
247 Ga0400484_23745
248 Ga0400484_41503
249 Ga0400490_04645
250 Ga0400490_31544
251 Ga0400490_32268
252 Ga0400491_16887
253 Ga0400485_16102
254 Ga0400485_19410
255 Ga0400488_00481
256 Ga0400488_11780
257 Ga0400488_13493
258 Ga0400488_51145
259 Ga0400488_52795
260 Ga0400486_05347
261 Ga0400486_06751
262 Ga0400483_000383
263 Ga0400483_006417
264 Ga0400483_009419
265 Ga0400483_012200
266 Ga0400483_026308
267 Ga0400483_034748
268 Ga0400483_044050
269 Ga0400483_078235
270 Ga0400483_104332
271 Ga0400483_130942
272 Ga0400483_215349
273 Ga0400483_235487
274 Ga0400483_242915
275 Ga0400483_247565
276 Ga0400483_249363
277 Ga0400483_250036
278 Ga0400483_278627
279 Ga0400483_281644
280 Ga0400483_291193
281 Ga0400487_03724
282 Ga0400487_24619
283 Ga0400487_25945
284 Ga0400487_41681
285 Ga0400487_53319
286 Ga0400487_55848
287 Ga0400487_59347
288 Ga0400487_61541
289 Ga0451807_2070195
290 Ga0451577_0000999
291 Ga0451577_0027029
292 Ga0451577_0066065
293 Ga0451577_0095797
294 Ga0451577_0484023
295 Ga0451577_1618922
296 Ga0453683_0000482
297 Ga0453683_0003630
298 Ga0453683_0040842
299 Ga0453684_0000051
300 Ga0453684_0000264
301 Ga0453684_0001730
302 Ga0453684_0002153
303 Ga0453684_0017315
304 Ga0453684_0028002
305 Ga0453684_0029340
306 Ga0453684_0034957
307 Ga0453684_0100675
308 Ga0453684_0286990
309 Ga0453684_0827630
310 Ga0451576_0000148
311 Ga0451576_0000860
312 Ga0451576_0010544
313 Ga0451576_0036954
314 Ga0451576_0065266
315 Ga0501033_0003546
316 Ga0501034_0012572
317 Ga0501036_0055323
318 Ga0501037_0002476
319 Ga0501038_0030620
320 Ga0501039_0117558
321 Ga0501043_0023578
322 Ga0501046_0139422
323 Ga0501047_0168955
324 Ga0501047_0450120
325 Ga0501048_1159351
326 Ga0501067_0024491
327 Ga0501068_0023754
328 Ga0501072_0259664
329 Ga0501073_0011418
330 Ga0501074_0402237
331 Ga0501080_0002489
332 Ga0501080_0014481
333 Ga0501083_0019407
334 Ga0501035_0056658
335 Ga0501044_0001571
336 nmdc:mga0a205_515734_c1
337 Ga0501084_0510010
338 Ga0501082_0074484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02542

YgbB

YgbB family

34

188

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b8f-assembly1.cif.gz_B x-ray crystal structure of a 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from pseudomonas aeruginosa 0.999 2 157
5l12-assembly1.cif.gz_C crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase from burkholderia pseudomallei double mutant 0.9917 2 154
3ieq-assembly1.cif.gz_C crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytidine 0.9906 2 154
1t0a-assembly1.cif.gz_C crystal structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase from shewanella oneidensis 0.9905 2 157
3k2x-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with 5'-iodo-cytosine 0.9899 2 154
ID Description Score Start End Superfamily
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9833 2 157 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9801 2 157 3.30.1330.50
1w55A02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9715 2 157 3.30.1330.50
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.971 2 157 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9678 2 157 3.30.1330.50
ID Description Score Start End GO Terms
AF-Q21LB9-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 1.003 1 155 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-C1DSS0-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 1.002 1 157 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A3L8B0D0-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 1.001 1 157 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A4R6ZIV1-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 1.001 2 156 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A2D5QFP7-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 1 1 155 GO:0008685
GO:0016114
GO:0019288
GO:0046872

Map