F253482

General Info

Members Datasets Scaffolds Average Seq Length
168 78 336 240

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0008463|Ga0501037_0008463_932_1723
Length 263
Sequence MNKISDQSLATQYSSISSGLFWRSLAFSLGQLLSTLIFGLGGLCLFFLPFSQRYRFLTQWGHFNFWWLKKTCGLSFRTRGTEHIPPGPAVVLCKHQSAWETIALQQIFPPQIWVLKRALLWIPFFGWGLALLEPIAINRRAGRKALEQIILQGRQRLTTGRWVVVFPEGTRVPPGRMGRFGIGGATLAQATGYPVVPVAHNAGRYWPRGGFIKYPGVIDVVIGPPIDTRAKTAIEVNQAAYDWIKGVMEDIDPQLLTTDASLN

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
5 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
6 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
10 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
11 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
12 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
15 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
16 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
17 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
22 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
23 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
24 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
25 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
26 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
27 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
28 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
29 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
30 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
34 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
35 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
36 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
37 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
38 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
39 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
40 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
41 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
42 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
43 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
44 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
45 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
46 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
47 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
48 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
49 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
50 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
51 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
53 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
57 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
58 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
65 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
66 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
67 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
68 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
69 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
70 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
71 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
72 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
73 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
76 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
77 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
78 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.43
Metatranscriptomes 3.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.98
Nodule 0
Rhizoplane 2.38
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 8.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0008463 3300049573 Bacteria 7545
2 Ga0070668_100303646 3300005347 Unclassified 1339
3 Ga0070714_100007091 3300005435 Bacteria 8691
4 Ga0070662_100706239 3300005457 Bacteria 853
5 Ga0070699_100141648 3300005518 Bacteria 2124
6 Ga0070697_100173703 3300005536 Bacteria 1825
7 Ga0068853_100480512 3300005539 Bacteria 1171
8 Ga0068856_100224052 3300005614 Bacteria 1896
9 Ga0068859_100735012 3300005617 Unclassified 1076
10 Ga0075366_10049989 3300006195 Bacteria 2482
11 Ga0075370_10114964 3300006353 Bacteria 1564
12 Ga0097620_100734936 3300006931 Unclassified 1076
13 Ga0105240_10000853 3300009093 Bacteria 54964
14 Ga0157370_10001594 3300013104 Bacteria 28032
15 Ga0157375_10356343 3300013308 Bacteria 1629
16 Ga0157376_10139971 3300014969 Bacteria 2170
17 Ga0207695_10000794 3300025913 Bacteria 59342
18 Ga0207649_10284917 3300025920 Bacteria 1203
19 Ga0207678_10416013 3300026067 Bacteria 1165
20 Ga0207702_10111917 3300026078 Bacteria 2429
21 Ga0265331_10007971 3300031250 Bacteria 6062
22 Ga0265327_10002731 3300031251 Bacteria 17995
23 Ga0265327_10003173 3300031251 Bacteria 16090
24 Ga0316575_10011622 3300031665 Bacteria 3261
25 Ga0316575_10039078 3300031665 Bacteria 1873
26 Ga0316579_10001934 3300031691 Bacteria 7719
27 Ga0316579_10003213 3300031691 Bacteria 6326
28 Ga0316576_10019079 3300031727 Bacteria 4694
29 Ga0316578_10001163 3300031728 Bacteria 10371
30 Ga0316578_10025488 3300031728 Bacteria 3326
31 Ga0316578_10029876 3300031728 Bacteria 3096
32 Ga0316578_10032871 3300031728 Bacteria 2967
33 Ga0316578_10125483 3300031728 Bacteria 1543
34 Ga0316577_10087964 3300031733 Bacteria 1738
35 Ga0316577_10103018 3300031733 Bacteria 1600
36 Ga0316577_10118250 3300031733 Unclassified 1489
37 Ga0316583_10000054 3300032133 Bacteria 22435
38 Ga0316583_10006065 3300032133 Bacteria 4344
39 Ga0316583_10008494 3300032133 Bacteria 3703
40 Ga0316583_10023285 3300032133 Bacteria 2214
41 Ga0316583_10073529 3300032133 Bacteria 1195
42 Ga0316580_10000800 3300032139 Bacteria 7688
43 Ga0316593_10000475 3300032168 Bacteria 7406
44 Ga0316593_10005119 3300032168 Bacteria 3430
45 Ga0316593_10006146 3300032168 Bacteria 3225
46 Ga0316592_1003316 3300033524 Bacteria 2888
47 Ga0316596_1000390 3300033541 Bacteria 7277
48 Ga0316596_1002123 3300033541 Bacteria 4185
49 Ga0316574_0000323 3300035398 Bacteria 18316
50 Ga0316574_0006451 3300035398 Bacteria 6346
51 Ga0316574_0036346 3300035398 Bacteria 3014
52 Ga0316574_0037443 3300035398 Bacteria 2975
53 Ga0316574_0090275 3300035398 Bacteria 1953
54 Ga0316574_0137382 3300035398 Bacteria 1574
55 Ga0316582_0000773 3300036647 Bacteria 12911
56 Ga0316582_0026093 3300036647 Bacteria 3514
57 Ga0316582_0047274 3300036647 Bacteria 2716
58 Ga0316582_0050228 3300036647 Bacteria 2641
59 Ga0316582_0057916 3300036647 Bacteria 2476
60 Ga0316582_0077089 3300036647 Unclassified 2169
61 Ga0316582_0177491 3300036647 Bacteria 1448
62 Ga0316584_0000492 3300036712 Bacteria 20871
63 Ga0316584_0003412 3300036712 Bacteria 10311
64 Ga0316584_0098076 3300036712 Bacteria 2194
65 Ga0316584_0143620 3300036712 Bacteria 1779
66 Ga0316584_0150142 3300036712 Bacteria 1735
67 Ga0395900_0499914 3300037418 Unclassified 1166
68 Ga0316581_0015406 3300037588 Bacteria 2184
69 Ga0316581_0070088 3300037588 Unclassified 1077
70 Ga0395901_0249396 3300038443 Unclassified 1850
71 Ga0400484_16882 3300038725 Bacteria 2638
72 Ga0400484_19991 3300038725 Bacteria 2489
73 Ga0400484_36464 3300038725 Bacteria 40399
74 Ga0400484_40693 3300038725 Bacteria 54187
75 Ga0400490_16935 3300038726 Bacteria 14185
76 Ga0400490_20339 3300038726 Bacteria 3284
77 Ga0400490_32506 3300038726 Bacteria 21361
78 Ga0400490_36115 3300038726 Bacteria 21600
79 Ga0400491_08454 3300038727 Bacteria 6584
80 Ga0400488_07912 3300038741 Unclassified 1057
81 Ga0400483_006522 3300039062 Bacteria 12660
82 Ga0400483_152728 3300039062 Bacteria 1428
83 Ga0400483_214514 3300039062 Bacteria 3419
84 Ga0400483_247144 3300039062 Bacteria 1383
85 Ga0400483_253381 3300039062 Unclassified 1253
86 Ga0400487_01392 3300039110 Bacteria 6423
87 Ga0400487_21168 3300039110 Bacteria 3023
88 Ga0400487_29890 3300039110 Bacteria 112395
89 Ga0400487_55885 3300039110 Bacteria 37403
90 Ga0451577_0034866 3300042876 Bacteria 4535
91 Ga0453684_0001497 3300044712 Bacteria 65811
92 Ga0453684_0437007 3300044712 Bacteria 1459
93 Ga0496104_0352576 3300048907 Bacteria 1384
94 Ga0496105_0455586 3300048908 Bacteria 1009
95 Ga0496113_0083266 3300048916 Bacteria 2454
96 Ga0496114_0014258 3300048917 Bacteria 6376
97 Ga0501031_0135036 3300049568 Bacteria 1611
98 Ga0501032_0000403 3300049569 Bacteria 35638
99 Ga0501032_0002238 3300049569 Bacteria 15236
100 Ga0501032_0008263 3300049569 Bacteria 7583
101 Ga0501032_0236183 3300049569 Bacteria 1188
102 Ga0501033_0002424 3300049570 Bacteria 15864
103 Ga0501033_0003302 3300049570 Bacteria 13330
104 Ga0501034_0002597 3300049571 Bacteria 21475
105 Ga0501034_0048060 3300049571 Bacteria 4306
106 Ga0501034_0191279 3300049571 Bacteria 2008
107 Ga0501036_0000268 3300049572 Bacteria 35567
108 Ga0501036_0060402 3300049572 Bacteria 3211
109 Ga0501037_0001334 3300049573 Bacteria 18109
110 Ga0501037_0008434 3300049573 Bacteria 7557
111 Ga0501037_0126342 3300049573 Bacteria 1836
112 Ga0501037_0142212 3300049573 Bacteria 1716
113 Ga0501038_0003437 3300049574 Bacteria 14768
114 Ga0501038_0004199 3300049574 Bacteria 13381
115 Ga0501038_0004487 3300049574 Bacteria 12976
116 Ga0501038_0010401 3300049574 Bacteria 8506
117 Ga0501038_0013026 3300049574 Bacteria 7583
118 Ga0501038_0037962 3300049574 Bacteria 4219
119 Ga0501038_0064136 3300049574 Bacteria 3133
120 Ga0501038_0153649 3300049574 Bacteria 1875
121 Ga0501039_0009505 3300049575 Bacteria 7412
122 Ga0501039_0077232 3300049575 Bacteria 2589
123 Ga0501039_0221161 3300049575 Bacteria 1489
124 Ga0501039_0238621 3300049575 Bacteria 1429
125 Ga0501039_0439180 3300049575 Bacteria 1025
126 Ga0501040_0063841 3300049576 Unclassified 2534
127 Ga0501042_0005064 3300049578 Bacteria 8455
128 Ga0501043_0002435 3300049579 Bacteria 15748
129 Ga0501043_0007039 3300049579 Bacteria 8953
130 Ga0501043_0007867 3300049579 Bacteria 8431
131 Ga0501043_0349754 3300049579 Bacteria 1123
132 Ga0501046_0012661 3300049580 Bacteria 7172
133 Ga0501046_0016617 3300049580 Bacteria 6158
134 Ga0501046_0096087 3300049580 Bacteria 2276
135 Ga0501047_0021198 3300049581 Bacteria 6240
136 Ga0501047_0068923 3300049581 Bacteria 3407
137 Ga0501047_0275269 3300049581 Bacteria 1529
138 Ga0501047_0559346 3300049581 Bacteria 968
139 Ga0501048_0010150 3300049582 Bacteria 7043
140 Ga0501067_0364762 3300049583 Unclassified 805
141 Ga0501068_0102089 3300049584 Bacteria 1778
142 Ga0501068_0383143 3300049584 Unclassified 906
143 Ga0501069_0025189 3300049585 Bacteria 3250
144 Ga0501070_0012715 3300049586 Bacteria 7099
145 Ga0501070_0028182 3300049586 Bacteria 4710
146 Ga0501070_0091055 3300049586 Bacteria 2524
147 Ga0501073_0000556 3300049589 Bacteria 26339
148 Ga0501074_0000309 3300049590 Bacteria 28271
149 Ga0501075_0228384 3300049591 Bacteria 1419
150 Ga0501079_0026253 3300049741 Bacteria 4465
151 Ga0501079_0298646 3300049741 Unclassified 1260
152 Ga0501080_0119289 3300049742 Bacteria 2445
153 Ga0501035_0000270 3300049822 Bacteria 61516
154 Ga0501035_0060454 3300049822 Bacteria 3373
155 Ga0501035_0112199 3300049822 Bacteria 2389
156 Ga0501035_0152246 3300049822 Bacteria 2006
157 Ga0501035_0218285 3300049822 Bacteria 1629
158 Ga0501035_0664263 3300049822 Unclassified 844
159 Ga0501044_0000261 3300049823 Bacteria 66869
160 Ga0501044_0002509 3300049823 Bacteria 20925
161 Ga0501044_0003853 3300049823 Bacteria 16825
162 Ga0501044_0039564 3300049823 Bacteria 4918
163 Ga0501044_0170148 3300049823 Bacteria 2150
164 Ga0501044_0384010 3300049823 Bacteria 1319
165 Ga0501045_0477292 3300049824 Bacteria 926
166 nmdc:mga0k408_12920_c1 3300050493 Bacteria 4573
167 nmdc:mga07m45_243400_c1 3300050496 Bacteria 1046
168 Ga0500622_0000002 3300053156 Bacteria 646442
169 Ga0501037_0008463
170 Ga0070668_100303646
171 Ga0070714_100007091
172 Ga0070662_100706239
173 Ga0070699_100141648
174 Ga0070697_100173703
175 Ga0068853_100480512
176 Ga0068856_100224052
177 Ga0068859_100735012
178 Ga0075366_10049989
179 Ga0075370_10114964
180 Ga0097620_100734936
181 Ga0105240_10000853
182 Ga0157370_10001594
183 Ga0157375_10356343
184 Ga0157376_10139971
185 Ga0207695_10000794
186 Ga0207649_10284917
187 Ga0207678_10416013
188 Ga0207702_10111917
189 Ga0265331_10007971
190 Ga0265327_10002731
191 Ga0265327_10003173
192 Ga0316575_10011622
193 Ga0316575_10039078
194 Ga0316579_10001934
195 Ga0316579_10003213
196 Ga0316576_10019079
197 Ga0316578_10001163
198 Ga0316578_10025488
199 Ga0316578_10029876
200 Ga0316578_10032871
201 Ga0316578_10125483
202 Ga0316577_10087964
203 Ga0316577_10103018
204 Ga0316577_10118250
205 Ga0316583_10000054
206 Ga0316583_10006065
207 Ga0316583_10008494
208 Ga0316583_10023285
209 Ga0316583_10073529
210 Ga0316580_10000800
211 Ga0316593_10000475
212 Ga0316593_10005119
213 Ga0316593_10006146
214 Ga0316592_1003316
215 Ga0316596_1000390
216 Ga0316596_1002123
217 Ga0316574_0000323
218 Ga0316574_0006451
219 Ga0316574_0036346
220 Ga0316574_0037443
221 Ga0316574_0090275
222 Ga0316574_0137382
223 Ga0316582_0000773
224 Ga0316582_0026093
225 Ga0316582_0047274
226 Ga0316582_0050228
227 Ga0316582_0057916
228 Ga0316582_0077089
229 Ga0316582_0177491
230 Ga0316584_0000492
231 Ga0316584_0003412
232 Ga0316584_0098076
233 Ga0316584_0143620
234 Ga0316584_0150142
235 Ga0395900_0499914
236 Ga0316581_0015406
237 Ga0316581_0070088
238 Ga0395901_0249396
239 Ga0400484_16882
240 Ga0400484_19991
241 Ga0400484_36464
242 Ga0400484_40693
243 Ga0400490_16935
244 Ga0400490_20339
245 Ga0400490_32506
246 Ga0400490_36115
247 Ga0400491_08454
248 Ga0400488_07912
249 Ga0400483_006522
250 Ga0400483_152728
251 Ga0400483_214514
252 Ga0400483_247144
253 Ga0400483_253381
254 Ga0400487_01392
255 Ga0400487_21168
256 Ga0400487_29890
257 Ga0400487_55885
258 Ga0451577_0034866
259 Ga0453684_0001497
260 Ga0453684_0437007
261 Ga0496104_0352576
262 Ga0496105_0455586
263 Ga0496113_0083266
264 Ga0496114_0014258
265 Ga0501031_0135036
266 Ga0501032_0000403
267 Ga0501032_0002238
268 Ga0501032_0008263
269 Ga0501032_0236183
270 Ga0501033_0002424
271 Ga0501033_0003302
272 Ga0501034_0002597
273 Ga0501034_0048060
274 Ga0501034_0191279
275 Ga0501036_0000268
276 Ga0501036_0060402
277 Ga0501037_0001334
278 Ga0501037_0008434
279 Ga0501037_0126342
280 Ga0501037_0142212
281 Ga0501038_0003437
282 Ga0501038_0004199
283 Ga0501038_0004487
284 Ga0501038_0010401
285 Ga0501038_0013026
286 Ga0501038_0037962
287 Ga0501038_0064136
288 Ga0501038_0153649
289 Ga0501039_0009505
290 Ga0501039_0077232
291 Ga0501039_0221161
292 Ga0501039_0238621
293 Ga0501039_0439180
294 Ga0501040_0063841
295 Ga0501042_0005064
296 Ga0501043_0002435
297 Ga0501043_0007039
298 Ga0501043_0007867
299 Ga0501043_0349754
300 Ga0501046_0012661
301 Ga0501046_0016617
302 Ga0501046_0096087
303 Ga0501047_0021198
304 Ga0501047_0068923
305 Ga0501047_0275269
306 Ga0501047_0559346
307 Ga0501048_0010150
308 Ga0501067_0364762
309 Ga0501068_0102089
310 Ga0501068_0383143
311 Ga0501069_0025189
312 Ga0501070_0012715
313 Ga0501070_0028182
314 Ga0501070_0091055
315 Ga0501073_0000556
316 Ga0501074_0000309
317 Ga0501075_0228384
318 Ga0501079_0026253
319 Ga0501079_0298646
320 Ga0501080_0119289
321 Ga0501035_0000270
322 Ga0501035_0060454
323 Ga0501035_0112199
324 Ga0501035_0152246
325 Ga0501035_0218285
326 Ga0501035_0664263
327 Ga0501044_0000261
328 Ga0501044_0002509
329 Ga0501044_0003853
330 Ga0501044_0039564
331 Ga0501044_0170148
332 Ga0501044_0384010
333 Ga0501045_0477292
334 nmdc:mga0k408_12920_c1
335 nmdc:mga07m45_243400_c1
336 Ga0500622_0000002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

75

201

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8393 1 239
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8329 1 238
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8296 1 239
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8173 1 238
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.6742 42 213
ID Description Score Start End Superfamily
af_D4AC45_64_192_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8921 63 184 3.40.50.620
af_Q9US20_86_212_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8891 63 184 3.40.50.620
af_Q93841_73_201_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8666 74 184 3.40.50.620
af_Q22267_77_205_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8637 63 184 3.40.50.2000
af_Q5AEL8_68_191_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8567 63 184 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A0S8GBR9-F1-model_v4 Acyl-phosphate glycerol 3-phosphate acyltransferase 0.9824 4 238 GO:0003841
GO:0006654
GO:0016020
AF-A0A450U0Q0-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferases 0.9814 2 238 GO:0003841
GO:0006654
GO:0016020
AF-A0A349EDJ5-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9804 5 237 GO:0003841
GO:0006654
GO:0016020
AF-A0A176S3I2-F1-model_v4 Phospholipid/glycerol acyltransferase 0.9798 46 239 GO:0003841
GO:0006654
AF-A0A4R1H8Q2-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9788 4 239 GO:0003841
GO:0006654
GO:0016020

Map