F252600

General Info

Members Datasets Scaffolds Average Seq Length
168 77 336 130

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_12164591|Ga0105242_121645911
Length 136
Sequence MATATAVQYPIWATGRRKNSTARVRMIKGQGKFVINDHSLEEFFGGHARAKWQAMRPFEVSKMGSQFDVFVDVSGGGVSGQAGAISHGVARAFSKLDNPLRVSMRKEGLLTRDSRMVERKKSGQPKARKRFQYSKR

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
15 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
16 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
17 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
18 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
24 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
25 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
26 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
27 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
28 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
29 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
30 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
31 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
32 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
33 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
34 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
35 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
36 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
37 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
38 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
39 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
40 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
41 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
42 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
43 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
44 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
50 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
51 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
52 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
53 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
54 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
55 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
56 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
57 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
58 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
59 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
60 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
61 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
62 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
63 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
64 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
65 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
72 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
73 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
74 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
75 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.17
Metatranscriptomes 20.24
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.19
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 8.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_12164591 3300009176 Bacteria 601
2 Ga0006758J48902_1013523 3300003300 Bacteria 1740
3 rootH2_10134558 3300003320 Bacteria 3661
4 Ga0007410J51695_1087170 3300003574 Bacteria 2294
5 Ga0007409J51694_1095029 3300003575 Bacteria 1033
6 Ga0007416J51690_1123730 3300003577 Bacteria 1079
7 Ga0058863_11735048 3300004799 Bacteria 1116
8 Ga0065704_10108193 3300005289 Bacteria 2035
9 Ga0070679_100081871 3300005530 Bacteria 3218
10 Ga0070665_100003998 3300005548 Bacteria 15546
11 Ga0068855_100526286 3300005563 Bacteria 1282
12 Ga0068856_100042336 3300005614 Bacteria 4479
13 Ga0068856_101867569 3300005614 Bacteria 612
14 Ga0105240_10013964 3300009093 Bacteria 10995
15 Ga0105240_12194440 3300009093 Bacteria 573
16 Ga0105242_12777374 3300009176 Bacteria 540
17 Ga0105238_10475342 3300009551 Bacteria 1249
18 Ga0105239_10129905 3300010375 Bacteria 2801
19 Ga0157372_11976377 3300013307 Unclassified 670
20 Ga0157376_10912584 3300014969 Unclassified 897
21 Ga0207695_10134537 3300025913 Bacteria 2426
22 Ga0207695_11420631 3300025913 Bacteria 574
23 Ga0207686_11460388 3300025934 Bacteria 563
24 Ga0207667_10385083 3300025949 Bacteria 1429
25 Ga0207667_11095275 3300025949 Bacteria 780
26 Ga0207702_10044418 3300026078 Bacteria 3735
27 Ga0268266_10018698 3300028379 Bacteria 5904
28 Ga0265326_10230921 3300028558 Unclassified 533
29 Ga0265322_10033719 3300028654 Bacteria 1460
30 Ga0265338_10762004 3300028800 Unclassified 665
31 Ga0265338_10807769 3300028800 Bacteria 642
32 Ga0265330_10250611 3300031235 Unclassified 746
33 Ga0265332_10004689 3300031238 Bacteria 6381
34 Ga0265332_10068870 3300031238 Bacteria 1508
35 Ga0265320_10036874 3300031240 Bacteria 2468
36 Ga0265320_10506452 3300031240 Bacteria 533
37 Ga0265329_10015331 3300031242 Bacteria 2679
38 Ga0265329_10031107 3300031242 Bacteria 1736
39 Ga0265339_10155864 3300031249 Bacteria 1152
40 Ga0265331_10035613 3300031250 Bacteria 2448
41 Ga0265331_10560606 3300031250 Bacteria 515
42 Ga0265316_10010445 3300031344 Bacteria 8458
43 Ga0265316_10016472 3300031344 Bacteria 6409
44 Ga0307408_100000723 3300031548 Bacteria 26740
45 Ga0316575_10011745 3300031665 Bacteria 3245
46 Ga0316579_10066187 3300031691 Bacteria 1706
47 Ga0316579_10119127 3300031691 Bacteria 1268
48 Ga0265314_10044823 3300031711 Bacteria 3131
49 Ga0265314_10629103 3300031711 Unclassified 550
50 Ga0265342_10040759 3300031712 Bacteria 2815
51 Ga0265342_10142852 3300031712 Bacteria 1334
52 Ga0265342_10268354 3300031712 Bacteria 906
53 Ga0265342_10404778 3300031712 Unclassified 704
54 Ga0316576_10049279 3300031727 Bacteria 3059
55 Ga0316576_10129208 3300031727 Bacteria 1900
56 Ga0316576_10180854 3300031727 Bacteria 1590
57 Ga0316576_10294230 3300031727 Bacteria 1214
58 Ga0316576_10318137 3300031727 Bacteria 1161
59 Ga0316576_10535128 3300031727 Bacteria 859
60 Ga0316576_10706668 3300031727 Bacteria 730
61 Ga0316576_10924062 3300031727 Bacteria 624
62 Ga0316576_10934262 3300031727 Bacteria 620
63 Ga0316576_11018282 3300031727 Bacteria 590
64 Ga0316578_10000386 3300031728 Bacteria 14140
65 Ga0316578_10038184 3300031728 Bacteria 2768
66 Ga0316578_10050928 3300031728 Bacteria 2424
67 Ga0316578_10185629 3300031728 Bacteria 1253
68 Ga0316578_10394942 3300031728 Bacteria 820
69 Ga0316578_10433874 3300031728 Bacteria 777
70 Ga0316578_10796497 3300031728 Bacteria 548
71 Ga0316577_10030884 3300031733 Bacteria 2992
72 Ga0316577_10094961 3300031733 Bacteria 1670
73 Ga0316577_10100487 3300031733 Bacteria 1621
74 Ga0316577_10235333 3300031733 Bacteria 1036
75 Ga0316577_10641379 3300031733 Bacteria 604
76 Ga0316583_10042636 3300032133 Bacteria 1604
77 Ga0316583_10285013 3300032133 Bacteria 572
78 Ga0316585_10015275 3300032137 Bacteria 2300
79 Ga0316585_10117049 3300032137 Bacteria 877
80 Ga0316585_10121098 3300032137 Bacteria 861
81 Ga0316580_10012546 3300032139 Bacteria 2582
82 Ga0316593_10008298 3300032168 Bacteria 2890
83 Ga0316593_10111556 3300032168 Bacteria 977
84 Ga0316593_10132764 3300032168 Bacteria 899
85 Ga0316592_1004656 3300033524 Bacteria 2562
86 Ga0316592_1034759 3300033524 Bacteria 1104
87 Ga0316592_1049575 3300033524 Bacteria 937
88 Ga0316592_1073884 3300033524 Bacteria 772
89 Ga0316592_1076609 3300033524 Bacteria 759
90 Ga0316588_1092614 3300033528 Bacteria 754
91 Ga0316588_1156467 3300033528 Unclassified 586
92 Ga0316588_1170219 3300033528 Bacteria 563
93 Ga0316587_1031298 3300033529 Bacteria 940
94 Ga0316596_1005651 3300033541 Bacteria 2866
95 Ga0316596_1005792 3300033541 Bacteria 2843
96 Ga0316596_1024876 3300033541 Unclassified 1539
97 Ga0316596_1068056 3300033541 Bacteria 952
98 Ga0316596_1076004 3300033541 Unclassified 901
99 Ga0316596_1097342 3300033541 Bacteria 795
100 Ga0316596_1134033 3300033541 Bacteria 677
101 Ga0316596_1211531 3300033541 Unclassified 541
102 Ga0373939_0103131 3300035114 Bacteria 982
103 Ga0316574_0131395 3300035398 Bacteria 1611
104 Ga0316574_0267814 3300035398 Bacteria 1090
105 Ga0316574_0350272 3300035398 Bacteria 934
106 Ga0316574_0385504 3300035398 Unclassified 884
107 Ga0373931_0040209 3300035691 Bacteria 2453
108 Ga0316582_0021328 3300036647 Bacteria 3825
109 Ga0316582_0145764 3300036647 Bacteria 1598
110 Ga0316582_0654909 3300036647 Bacteria 722
111 Ga0316584_0001138 3300036712 Bacteria 15619
112 Ga0316584_0019607 3300036712 Bacteria 4890
113 Ga0316584_0070381 3300036712 Bacteria 2623
114 Ga0316584_0077092 3300036712 Bacteria 2497
115 Ga0316584_0088769 3300036712 Bacteria 2315
116 Ga0316584_0161547 3300036712 Bacteria 1664
117 Ga0316584_0173498 3300036712 Bacteria 1598
118 Ga0316584_0574556 3300036712 Bacteria 784
119 Ga0395905_0059128 3300037471 Bacteria 3584
120 Ga0316581_0022538 3300037588 Bacteria 1857
121 Ga0316581_0068780 3300037588 Bacteria 1087
122 Ga0316581_0083133 3300037588 Bacteria 985
123 Ga0400488_20371 3300038741 Bacteria 1674
124 Ga0400483_041628 3300039062 Bacteria 35393
125 Ga0400483_143344 3300039062 Bacteria 1670
126 Ga0400489_44908 3300039093 Bacteria 1015
127 Ga0451795_0754387 3300041456 Bacteria 786
128 Ga0451795_1492259 3300041456 Bacteria 5009
129 Ga0451855_1583983 3300041511 Bacteria 815
130 Ga0451577_0000230 3300042876 Bacteria 113101
131 Ga0451577_0118479 3300042876 Bacteria 2371
132 Ga0451577_0194734 3300042876 Bacteria 1829
133 Ga0451577_0359603 3300042876 Bacteria 1320
134 Ga0451577_1054417 3300042876 Bacteria 729
135 Ga0453683_0000325 3300044673 Bacteria 58597
136 Ga0453683_0031825 3300044673 Bacteria 3331
137 Ga0453683_0052859 3300044673 Bacteria 2543
138 Ga0453683_0095641 3300044673 Bacteria 1864
139 Ga0453683_0858835 3300044673 Unclassified 599
140 Ga0453684_0000334 3300044712 Bacteria 196444
141 Ga0453684_0000759 3300044712 Bacteria 112043
142 Ga0453684_0025484 3300044712 Bacteria 8584
143 Ga0453684_0112632 3300044712 Bacteria 3302
144 Ga0453684_0130918 3300044712 Unclassified 3010
145 Ga0453684_0303082 3300044712 Bacteria 1815
146 Ga0453684_0409470 3300044712 Bacteria 1517
147 Ga0451576_0000346 3300045051 Bacteria 112037
148 Ga0451576_0002512 3300045051 Bacteria 27216
149 Ga0451576_0004532 3300045051 Bacteria 17987
150 Ga0451576_0005713 3300045051 Bacteria 15515
151 Ga0451576_0020278 3300045051 Bacteria 7241
152 Ga0451576_0083048 3300045051 Bacteria 3332
153 Ga0451576_0682352 3300045051 Bacteria 1079
154 Ga0451576_0698488 3300045051 Bacteria 1066
155 Ga0501306_000909 3300049127 Bacteria 2550
156 Ga0501307_000569 3300049162 Bacteria 2622
157 Ga0501307_002272 3300049162 Bacteria 1770
158 Ga0501311_008432 3300049527 Bacteria 1208
159 Ga0501312_013010 3300049528 Bacteria 1152
160 Ga0501320_000337 3300049536 Bacteria 2600
161 Ga0501323_000849 3300049539 Bacteria 2472
162 Ga0501198_001832 3300049649 Bacteria 2810
163 Ga0501223_014425 3300049663 Bacteria 1566
164 Ga0501241_001046 3300049758 Bacteria 5844
165 Ga0501044_0120433 3300049823 Bacteria 2626
166 Ga0587092_004200 3300059512 Bacteria 1699
167 Ga0587079_003017 3300059647 Bacteria 2152
168 2890806665 2890804823 Bacteria 3717572
169 Ga0105242_12164591
170 Ga0006758J48902_1013523
171 rootH2_10134558
172 Ga0007410J51695_1087170
173 Ga0007409J51694_1095029
174 Ga0007416J51690_1123730
175 Ga0058863_11735048
176 Ga0065704_10108193
177 Ga0070679_100081871
178 Ga0070665_100003998
179 Ga0068855_100526286
180 Ga0068856_100042336
181 Ga0068856_101867569
182 Ga0105240_10013964
183 Ga0105240_12194440
184 Ga0105242_12777374
185 Ga0105238_10475342
186 Ga0105239_10129905
187 Ga0157372_11976377
188 Ga0157376_10912584
189 Ga0207695_10134537
190 Ga0207695_11420631
191 Ga0207686_11460388
192 Ga0207667_10385083
193 Ga0207667_11095275
194 Ga0207702_10044418
195 Ga0268266_10018698
196 Ga0265326_10230921
197 Ga0265322_10033719
198 Ga0265338_10762004
199 Ga0265338_10807769
200 Ga0265330_10250611
201 Ga0265332_10004689
202 Ga0265332_10068870
203 Ga0265320_10036874
204 Ga0265320_10506452
205 Ga0265329_10015331
206 Ga0265329_10031107
207 Ga0265339_10155864
208 Ga0265331_10035613
209 Ga0265331_10560606
210 Ga0265316_10010445
211 Ga0265316_10016472
212 Ga0307408_100000723
213 Ga0316575_10011745
214 Ga0316579_10066187
215 Ga0316579_10119127
216 Ga0265314_10044823
217 Ga0265314_10629103
218 Ga0265342_10040759
219 Ga0265342_10142852
220 Ga0265342_10268354
221 Ga0265342_10404778
222 Ga0316576_10049279
223 Ga0316576_10129208
224 Ga0316576_10180854
225 Ga0316576_10294230
226 Ga0316576_10318137
227 Ga0316576_10535128
228 Ga0316576_10706668
229 Ga0316576_10924062
230 Ga0316576_10934262
231 Ga0316576_11018282
232 Ga0316578_10000386
233 Ga0316578_10038184
234 Ga0316578_10050928
235 Ga0316578_10185629
236 Ga0316578_10394942
237 Ga0316578_10433874
238 Ga0316578_10796497
239 Ga0316577_10030884
240 Ga0316577_10094961
241 Ga0316577_10100487
242 Ga0316577_10235333
243 Ga0316577_10641379
244 Ga0316583_10042636
245 Ga0316583_10285013
246 Ga0316585_10015275
247 Ga0316585_10117049
248 Ga0316585_10121098
249 Ga0316580_10012546
250 Ga0316593_10008298
251 Ga0316593_10111556
252 Ga0316593_10132764
253 Ga0316592_1004656
254 Ga0316592_1034759
255 Ga0316592_1049575
256 Ga0316592_1073884
257 Ga0316592_1076609
258 Ga0316588_1092614
259 Ga0316588_1156467
260 Ga0316588_1170219
261 Ga0316587_1031298
262 Ga0316596_1005651
263 Ga0316596_1005792
264 Ga0316596_1024876
265 Ga0316596_1068056
266 Ga0316596_1076004
267 Ga0316596_1097342
268 Ga0316596_1134033
269 Ga0316596_1211531
270 Ga0373939_0103131
271 Ga0316574_0131395
272 Ga0316574_0267814
273 Ga0316574_0350272
274 Ga0316574_0385504
275 Ga0373931_0040209
276 Ga0316582_0021328
277 Ga0316582_0145764
278 Ga0316582_0654909
279 Ga0316584_0001138
280 Ga0316584_0019607
281 Ga0316584_0070381
282 Ga0316584_0077092
283 Ga0316584_0088769
284 Ga0316584_0161547
285 Ga0316584_0173498
286 Ga0316584_0574556
287 Ga0395905_0059128
288 Ga0316581_0022538
289 Ga0316581_0068780
290 Ga0316581_0083133
291 Ga0400488_20371
292 Ga0400483_041628
293 Ga0400483_143344
294 Ga0400489_44908
295 Ga0451795_0754387
296 Ga0451795_1492259
297 Ga0451855_1583983
298 Ga0451577_0000230
299 Ga0451577_0118479
300 Ga0451577_0194734
301 Ga0451577_0359603
302 Ga0451577_1054417
303 Ga0453683_0000325
304 Ga0453683_0031825
305 Ga0453683_0052859
306 Ga0453683_0095641
307 Ga0453683_0858835
308 Ga0453684_0000334
309 Ga0453684_0000759
310 Ga0453684_0025484
311 Ga0453684_0112632
312 Ga0453684_0130918
313 Ga0453684_0303082
314 Ga0453684_0409470
315 Ga0451576_0000346
316 Ga0451576_0002512
317 Ga0451576_0004532
318 Ga0451576_0005713
319 Ga0451576_0020278
320 Ga0451576_0083048
321 Ga0451576_0682352
322 Ga0451576_0698488
323 Ga0501306_000909
324 Ga0501307_000569
325 Ga0501307_002272
326 Ga0501311_008432
327 Ga0501312_013010
328 Ga0501320_000337
329 Ga0501323_000849
330 Ga0501198_001832
331 Ga0501223_014425
332 Ga0501241_001046
333 Ga0501044_0120433
334 Ga0587092_004200
335 Ga0587079_003017
336 2890806665

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00380

Ribosomal_S9

Ribosomal protein S9/S16

15

136

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pkq-assembly1.cif.gz_i small subunit of the chlamydomonas reinhardtii mitoribosome 0.9686 3 90
4v48-assembly1.cif.gz_BI real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9597 4 100
6osi-assembly1.cif.gz_QI unmodified trna(pro) bound to thermus thermophilus 70s (near cognate) 0.942 2 105
4v48-assembly1.cif.gz_BI real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9318 4 100
6osi-assembly1.cif.gz_QI unmodified trna(pro) bound to thermus thermophilus 70s (near cognate) 0.9249 2 105
ID Description Score Start End Superfamily
af_Q7XAM9_269_415_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8047 3 128 3.30.230.10
af_O94150_208_336_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8046 3 128 3.30.230.10
af_Q54CK4_214_339_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8018 4 128 3.30.230.10
af_Q54CK4_214_339_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7894 4 128 3.30.230.10
af_Q8IHZ4_170_300_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7887 1 128 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A383E3H6-F1-model_v4 30S ribosomal protein S9 1 3 100 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A6P0EFT4-F1-model_v4 deleted 0.9982 2 102
AF-C5NX40-F1-model_v4 30S ribosomal protein S9 0.9969 2 100 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A7X7M6L1-F1-model_v4 30S ribosomal protein S9 0.9918 2 103 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A2E8BEA7-F1-model_v4 30S ribosomal protein S9 0.9904 4 104 GO:0003723
GO:0003735
GO:0005737
GO:0006412
GO:0015935

Map