F251562

General Info

Members Datasets Scaffolds Average Seq Length
167 129 128 182

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2893684298|2893686748
Length 219
Sequence VARIGKPHGIRGEVTVQLFTDDPQGRCAPGAVLQLEAATDQAARLAPTGTLEISSARWNKSVMVLGFTSVKDRNAAELLRESRLWAESEDDDQDDDAWYEHELLGLDVVLAAELERAEAEGREPAAVGRVTGLRTLPAQDLLELELADGQEGMVPFVEQIVLEVDPDAARVVIDPPPGLLDLEASQGTEGEVAERAAETGEPADLSGVELPGQTQEQRP

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
3 2739367653 Kocuria sp. OV113 Isolate Unclassified
4 2773857933 Frankia sp. BMG5.30 Isolate Nodule
5 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
6 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
7 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
8 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
9 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
10 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
11 2857727296 Kocuria sp. R-72562 Isolate Unclassified
12 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
13 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
14 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
15 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
16 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
17 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
18 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
19 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
20 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
21 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
22 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
23 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
24 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
25 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
26 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
27 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
28 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
29 2920879853 Kocuria salina CV6 Isolate Unclassified
30 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
31 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
32 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
33 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
34 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
35 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
36 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
37 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
38 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
39 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
96 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
105 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
106 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
128 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
129 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.65
Metatranscriptomes 2.99
Isolates 23.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 2.4
Rhizoplane 10.18
Rhizosphere 73.05
Stem 0
Stem Tuber 0
Unclassified 13.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1003843 3300000549 Bacteria 1989
2 LJQas_1004845 3300000549 Bacteria 1733
3 rootL2_10191676 3300003322 Bacteria 1165
4 Ga0065714_10291501 3300005288 Bacteria 684
5 Ga0070683_100163129 3300005329 Bacteria 2114
6 Ga0070683_101013998 3300005329 Bacteria 797
7 Ga0068868_101183352 3300005338 Bacteria 706
8 Ga0070660_100674919 3300005339 Bacteria 866
9 Ga0070661_100286496 3300005344 Bacteria 1279
10 Ga0070713_100591371 3300005436 Bacteria 1054
11 Ga0070684_100486982 3300005535 Bacteria 1142
12 Ga0070684_101064503 3300005535 Bacteria 760
13 Ga0070684_101122804 3300005535 Bacteria 739
14 Ga0068853_101213837 3300005539 Bacteria 728
15 Ga0070665_100410854 3300005548 Bacteria 1362
16 Ga0070665_101065626 3300005548 Bacteria 820
17 Ga0068857_100172772 3300005577 Bacteria 1964
18 Ga0068856_101556589 3300005614 Bacteria 674
19 Ga0070702_100743989 3300005615 Bacteria 752
20 Ga0068852_100857295 3300005616 Bacteria 924
21 Ga0068852_100968565 3300005616 Bacteria 869
22 Ga0081539_10000357 3300005985 Bacteria 100714
23 Ga0081539_10050261 3300005985 Bacteria 2360
24 Ga0068865_100666247 3300006881 Bacteria 886
25 Ga0105244_10063041 3300009036 Bacteria 1862
26 Ga0105245_10016696 3300009098 Bacteria 6411
27 Ga0105245_10217497 3300009098 Bacteria 1842
28 Ga0105248_10780137 3300009177 Bacteria 1079
29 Ga0105237_10742910 3300009545 Bacteria 988
30 Ga0105246_10147596 3300011119 Bacteria 1776
31 Ga0157371_10018724 3300013102 Bacteria 5117
32 Ga0157370_10006835 3300013104 Bacteria 12500
33 Ga0157369_10825156 3300013105 Bacteria 952
34 Ga0157374_10826454 3300013296 Bacteria 943
35 Ga0157374_11490803 3300013296 Bacteria 700
36 Ga0163162_10720208 3300013306 Bacteria 1118
37 Ga0163162_10820514 3300013306 Bacteria 1047
38 Ga0157375_10047778 3300013308 Bacteria 4182
39 Ga0157375_10284868 3300013308 Bacteria 1815
40 Ga0163163_11280833 3300014325 Bacteria 795
41 Ga0206349_1500931 3300020075 Bacteria 660
42 Ga0209051_1004314 3300025303 Bacteria 8829
43 Ga0207655_1031013 3300025728 Bacteria 2473
44 Ga0207655_1048278 3300025728 Bacteria 1749
45 Ga0207649_10339968 3300025920 Bacteria 1108
46 Ga0207687_10098747 3300025927 Bacteria 2144
47 Ga0207686_10271930 3300025934 Bacteria 1247
48 Ga0207661_10184361 3300025944 Bacteria 1826
49 Ga0207712_11493795 3300025961 Bacteria 605
50 Ga0207677_10184368 3300026023 Bacteria 1644
51 Ga0207641_11019686 3300026088 Bacteria 825
52 Ga0207648_10497279 3300026089 Bacteria 1115
53 Ga0207674_10394233 3300026116 Bacteria 1338
54 Ga0207698_10741572 3300026142 Bacteria 980
55 Ga0268266_10361872 3300028379 Bacteria 1365
56 Ga0307513_10056025 3300031456 Bacteria 4213
57 Ga0307408_100213543 3300031548 Bacteria 1570
58 Ga0307408_100392374 3300031548 Bacteria 1190
59 Ga0316576_10002441 3300031727 Bacteria 10575
60 Ga0316576_10101633 3300031727 Bacteria 2149
61 Ga0316578_10077915 3300031728 Bacteria 1969
62 Ga0307405_10030207 3300031731 Bacteria 3176
63 Ga0307405_10137548 3300031731 Bacteria 1698
64 Ga0307413_10540412 3300031824 Bacteria 943
65 Ga0307413_10734276 3300031824 Bacteria 824
66 Ga0307410_10151048 3300031852 Bacteria 1729
67 Ga0307410_10271633 3300031852 Bacteria 1326
68 Ga0307406_10378370 3300031901 Bacteria 1115
69 Ga0307406_10518497 3300031901 Bacteria 969
70 Ga0307407_10065952 3300031903 Bacteria 2133
71 Ga0307407_11048453 3300031903 Bacteria 632
72 Ga0307412_10149275 3300031911 Bacteria 1722
73 Ga0307412_10218999 3300031911 Bacteria 1458
74 Ga0307412_10691129 3300031911 Bacteria 875
75 Ga0307409_100052065 3300031995 Bacteria 3137
76 Ga0307409_100088219 3300031995 Bacteria 2531
77 Ga0307409_100118721 3300031995 Bacteria 2234
78 Ga0307409_100457812 3300031995 Bacteria 1233
79 Ga0307409_100462218 3300031995 Bacteria 1227
80 Ga0307409_100525976 3300031995 Bacteria 1156
81 Ga0307416_100009902 3300032002 Bacteria 6269
82 Ga0307416_100048736 3300032002 Bacteria 3363
83 Ga0307416_100419705 3300032002 Bacteria 1381
84 Ga0307416_100768986 3300032002 Bacteria 1057
85 Ga0307416_100790028 3300032002 Bacteria 1044
86 Ga0307414_10056393 3300032004 Bacteria 2756
87 Ga0307414_10144965 3300032004 Bacteria 1864
88 Ga0307411_11010410 3300032005 Bacteria 745
89 Ga0307415_100182422 3300032126 Bacteria 1648
90 Ga0316580_10080187 3300032139 Bacteria 998
91 Ga0316580_10080438 3300032139 Bacteria 997
92 Ga0316593_10029265 3300032168 Bacteria 1781
93 Ga0316593_10039697 3300032168 Bacteria 1562
94 Ga0307507_10012122 3300033179 Bacteria 10711
95 Ga0395899_0721842 3300037312 Bacteria 623
96 Ga0395900_0057149 3300037418 Bacteria 4016
97 Ga0395900_0170782 3300037418 Bacteria 2214
98 Ga0395898_0039905 3300037466 Bacteria 4645
99 Ga0395898_0052346 3300037466 Bacteria 3988
100 Ga0395905_0823510 3300037471 Bacteria 831
101 Ga0436364_1120314 3300037853 Bacteria 1552
102 Ga0395901_0196153 3300038443 Bacteria 2117
103 Ga0451793_1048851 3300041452 Bacteria 1083
104 Ga0451797_0521774 3300041453 Bacteria 1291
105 Ga0451837_1216893 3300041494 Bacteria 1269
106 Ga0451837_1474631 3300041494 Bacteria 1381
107 Ga0451577_0000005 3300042876 Bacteria 712599
108 Ga0466965_0036063 3300044683 Bacteria 2425
109 Ga0466967_0925893 3300045976 Bacteria 867
110 Ga0496100_0528951 3300048903 Bacteria 910
111 Ga0496101_0230133 3300048904 Bacteria 1440
112 Ga0496102_0230650 3300048905 Bacteria 1745
113 Ga0496103_0024917 3300048906 Bacteria 3611
114 Ga0496104_0255242 3300048907 Bacteria 1666
115 Ga0496106_0944092 3300048909 Bacteria 680
116 Ga0496108_0199426 3300048911 Bacteria 1736
117 Ga0496108_0595458 3300048911 Bacteria 963
118 Ga0496109_0522279 3300048912 Bacteria 1120
119 Ga0496110_0330494 3300048913 Bacteria 1388
120 Ga0496111_0181503 3300048914 Bacteria 1564
121 Ga0496111_0226284 3300048914 Bacteria 1389
122 Ga0496112_0083509 3300048915 Bacteria 3159
123 Ga0496113_0024221 3300048916 Bacteria 4311
124 Ga0496114_0006982 3300048917 Bacteria 8898
125 Ga0501323_009827 3300049539 Bacteria 1132
126 Ga0501039_0728200 3300049575 Bacteria 775
127 Ga0501084_0719113 3300054114 Bacteria 842
128 Ga0587088_016363 3300059508 Bacteria 1181

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025934 Ga0207686_10271930 Ga0207686_102719302 146
2 3300005985 Ga0081539_10050261 Ga0081539_100502613 149
3 iso_pu_bacteria 2884693830 2884695803 162
4 iso_pu_bacteria 2895442618 2895445484 162
5 iso_pu_bacteria 2855670206 2855671069 164
6 iso_pu_bacteria 2855676851 2855682265 164
7 iso_pu_bacteria 2858848962 2858852982 164
8 iso_pu_bacteria 2858888857 2858889771 164
9 iso_pu_bacteria 2858895516 2858896690 164
10 iso_pu_bacteria 2869068681 2869073609 164
11 3300025961 Ga0207712_11493795 Ga0207712_114937951 165
12 3300042876 Ga0451577_0000005 Ga0451577_0000005_138166_138738 166
13 iso_pu_bacteria 2739367653 2739602528 166
14 iso_pu_bacteria 2816332305 2817508960 166
15 iso_pu_bacteria 2857727296 2857729588 166
16 3300005614 Ga0068856_101556589 Ga0068856_1015565891 167
17 3300031852 Ga0307410_10271633 Ga0307410_102716332 167
18 3300031911 Ga0307412_10691129 Ga0307412_106911291 167
19 3300031995 Ga0307409_100462218 Ga0307409_1004622182 167
20 3300031995 Ga0307409_100525976 Ga0307409_1005259761 167
21 3300032002 Ga0307416_100768986 Ga0307416_1007689862 167
22 3300044683 Ga0466965_0036063 Ga0466965_0036063_498_1031 167
23 3300049575 Ga0501039_0728200 Ga0501039_0728200_32_574 167
24 3300054114 Ga0501084_0719113 Ga0501084_0719113_77_619 167
25 3300005436 Ga0070713_100591371 Ga0070713_1005913711 168
26 3300005539 Ga0068853_101213837 Ga0068853_1012138372 168
27 3300005616 Ga0068852_100857295 Ga0068852_1008572951 168
28 3300005985 Ga0081539_10000357 Ga0081539_1000035790 168
29 3300026142 Ga0207698_10741572 Ga0207698_107415722 168
30 3300031456 Ga0307513_10056025 Ga0307513_100560254 168
31 3300031727 Ga0316576_10101633 Ga0316576_101016334 168
32 3300031728 Ga0316578_10077915 Ga0316578_100779152 168
33 3300032139 Ga0316580_10080187 Ga0316580_100801872 168
34 3300032168 Ga0316593_10039697 Ga0316593_100396973 168
35 3300033179 Ga0307507_10012122 Ga0307507_100121224 168
36 3300037418 Ga0395900_0170782 Ga0395900_0170782_1501_2073 168
37 3300037466 Ga0395898_0039905 Ga0395898_0039905_2868_3440 168
38 3300037471 Ga0395905_0823510 Ga0395905_0823510_137_709 168
39 iso_pu_bacteria 8055157932 8055163007 168
40 iso_pu_bacteria 2506783011 2506868236 169
41 iso_pu_bacteria 2773857933 2774902654 169
42 3300005535 Ga0070684_100486982 Ga0070684_1004869823 171
43 3300005548 Ga0070665_100410854 Ga0070665_1004108541 171
44 3300028379 Ga0268266_10361872 Ga0268266_103618722 171
45 3300031727 Ga0316576_10002441 Ga0316576_100024419 171
46 3300032139 Ga0316580_10080438 Ga0316580_100804382 171
47 3300032168 Ga0316593_10029265 Ga0316593_100292652 171
48 3300009545 Ga0105237_10742910 Ga0105237_107429102 172
49 3300013102 Ga0157371_10018724 Ga0157371_100187244 172
50 3300013104 Ga0157370_10006835 Ga0157370_100068355 172
51 3300026088 Ga0207641_11019686 Ga0207641_110196862 172
52 3300049539 Ga0501323_009827 Ga0501323_009827_574_1119 172
53 3300005329 Ga0070683_100163129 Ga0070683_1001631292 173
54 3300005338 Ga0068868_101183352 Ga0068868_1011833521 173
55 3300005339 Ga0070660_100674919 Ga0070660_1006749192 173
56 3300005344 Ga0070661_100286496 Ga0070661_1002864962 173
57 3300005535 Ga0070684_101064503 Ga0070684_1010645031 173
58 3300005577 Ga0068857_100172772 Ga0068857_1001727723 173
59 3300005616 Ga0068852_100968565 Ga0068852_1009685652 173
60 3300009098 Ga0105245_10217497 Ga0105245_102174972 173
61 3300013296 Ga0157374_10826454 Ga0157374_108264542 173
62 3300013308 Ga0157375_10047778 Ga0157375_100477784 173
63 3300025920 Ga0207649_10339968 Ga0207649_103399683 173
64 3300025944 Ga0207661_10184361 Ga0207661_101843612 173
65 3300026023 Ga0207677_10184368 Ga0207677_101843683 173
66 3300026089 Ga0207648_10497279 Ga0207648_104972792 173
67 3300026116 Ga0207674_10394233 Ga0207674_103942333 173
68 3300037853 Ga0436364_1120314 Ga0436364_1120314_587_1120 173
69 3300048907 Ga0496104_0255242 Ga0496104_0255242_764_1294 173
70 3300048909 Ga0496106_0944092 Ga0496106_0944092_83_613 173
71 3300048911 Ga0496108_0199426 Ga0496108_0199426_227_757 173
72 3300048912 Ga0496109_0522279 Ga0496109_0522279_178_708 173
73 3300048913 Ga0496110_0330494 Ga0496110_0330494_270_800 173
74 3300048914 Ga0496111_0226284 Ga0496111_0226284_135_665 173
75 3300048915 Ga0496112_0083509 Ga0496112_0083509_202_732 173
76 3300048916 Ga0496113_0024221 Ga0496113_0024221_1769_2299 173
77 3300048917 Ga0496114_0006982 Ga0496114_0006982_462_992 173
78 3300013306 Ga0163162_10720208 Ga0163162_107202083 174
79 3300013306 Ga0163162_10820514 Ga0163162_108205142 174
80 3300031995 Ga0307409_100052065 Ga0307409_1000520653 174
81 3300032002 Ga0307416_100790028 Ga0307416_1007900282 174
82 3300041453 Ga0451797_0521774 Ga0451797_0521774_154_735 174
83 3300041494 Ga0451837_1474631 Ga0451837_1474631_662_1243 174
84 3300005329 Ga0070683_101013998 Ga0070683_1010139981 175
85 3300005535 Ga0070684_101122804 Ga0070684_1011228042 175
86 3300005548 Ga0070665_101065626 Ga0070665_1010656262 175
87 3300006881 Ga0068865_100666247 Ga0068865_1006662471 175
88 3300009098 Ga0105245_10016696 Ga0105245_100166969 175
89 3300009177 Ga0105248_10780137 Ga0105248_107801372 175
90 3300013296 Ga0157374_11490803 Ga0157374_114908031 175
91 3300013308 Ga0157375_10284868 Ga0157375_102848682 175
92 3300014325 Ga0163163_11280833 Ga0163163_112808332 175
93 3300025927 Ga0207687_10098747 Ga0207687_100987472 175
94 iso_pu_bacteria 2537561592 2537897924 175
95 iso_pu_bacteria 2945920336 2945921181 175
96 3300005288 Ga0065714_10291501 Ga0065714_102915011 176
97 3300048903 Ga0496100_0528951 Ga0496100_0528951_49_666 176
98 3300048904 Ga0496101_0230133 Ga0496101_0230133_620_1237 176
99 3300048905 Ga0496102_0230650 Ga0496102_0230650_884_1501 176
100 3300048906 Ga0496103_0024917 Ga0496103_0024917_293_910 176
101 3300048911 Ga0496108_0595458 Ga0496108_0595458_120_719 176
102 3300048914 Ga0496111_0181503 Ga0496111_0181503_245_862 176
103 iso_pu_bacteria 2857632687 2857633892 176
104 iso_pu_bacteria 2870804320 2870804818 176
105 iso_pu_bacteria 2919051321 2919054668 176
106 iso_pu_bacteria 2945916053 2945918538 176
107 iso_pu_bacteria 2946024296 2946026165 176
108 iso_pu_bacteria 8004021418 8004023233 176
109 iso_pu_bacteria 8004025490 8004029322 176
110 3300005615 Ga0070702_100743989 Ga0070702_1007439891 177
111 3300037418 Ga0395900_0057149 Ga0395900_0057149_2514_3074 177
112 3300037466 Ga0395898_0052346 Ga0395898_0052346_1054_1614 177
113 iso_pu_bacteria 2893684298 2893686748 177
114 iso_pu_bacteria 2920879853 2920882004 177
115 iso_pu_bacteria 2946003308 2946005005 177
116 iso_pu_bacteria 2808606700 2810363995 178
117 iso_pu_bacteria 2905926851 2905927304 178
118 3300031548 Ga0307408_100213543 Ga0307408_1002135431 179
119 3300031731 Ga0307405_10030207 Ga0307405_100302075 179
120 3300031824 Ga0307413_10540412 Ga0307413_105404122 179
121 3300031901 Ga0307406_10518497 Ga0307406_105184972 179
122 3300031995 Ga0307409_100118721 Ga0307409_1001187213 179
123 3300032002 Ga0307416_100009902 Ga0307416_1000099022 179
124 3300032005 Ga0307411_11010410 Ga0307411_110104102 179
125 3300032126 Ga0307415_100182422 Ga0307415_1001824222 179
126 3300045976 Ga0466967_0925893 Ga0466967_0925893_231_770 179
127 iso_pu_bacteria 2857740372 2857741588 179
128 iso_pu_bacteria 2904497146 2904500119 179
129 iso_pu_bacteria 2904776348 2904776365 179
130 iso_pu_bacteria 2910809715 2910811797 179
131 iso_pu_bacteria 2919538618 2919541883 179
132 iso_pu_bacteria 2932426870 2932428984 179
133 iso_pu_bacteria 2939674588 2939676321 179
134 3300003322 rootL2_10191676 rootL2_101916763 180
135 3300013105 Ga0157369_10825156 Ga0157369_108251562 180
136 3300020075 Ga0206349_1500931 Ga0206349_15009311 180
137 3300031548 Ga0307408_100392374 Ga0307408_1003923742 180
138 3300031731 Ga0307405_10137548 Ga0307405_101375482 180
139 3300031824 Ga0307413_10734276 Ga0307413_107342761 180
140 3300031852 Ga0307410_10151048 Ga0307410_101510482 180
141 3300031901 Ga0307406_10378370 Ga0307406_103783701 180
142 3300031903 Ga0307407_10065952 Ga0307407_100659524 180
143 3300031903 Ga0307407_11048453 Ga0307407_110484531 180
144 3300031911 Ga0307412_10149275 Ga0307412_101492752 180
145 3300031911 Ga0307412_10218999 Ga0307412_102189991 180
146 3300031995 Ga0307409_100088219 Ga0307409_1000882193 180
147 3300031995 Ga0307409_100457812 Ga0307409_1004578121 180
148 3300032002 Ga0307416_100048736 Ga0307416_1000487362 180
149 3300032002 Ga0307416_100419705 Ga0307416_1004197052 180
150 3300032004 Ga0307414_10056393 Ga0307414_100563934 180
151 3300032004 Ga0307414_10144965 Ga0307414_101449652 180
152 3300037312 Ga0395899_0721842 Ga0395899_0721842_30_593 180
153 3300038443 Ga0395901_0196153 Ga0395901_0196153_1179_1742 180
154 iso_pu_bacteria 2857479173 2857479718 180
155 iso_pu_bacteria 2870801768 2870802734 180
156 3300025728 Ga0207655_1048278 Ga0207655_10482783 182
157 3300000549 LJQas_1003843 LJQas_10038432 183
158 3300000549 LJQas_1004845 LJQas_10048452 183
159 3300009036 Ga0105244_10063041 Ga0105244_100630412 183
160 3300011119 Ga0105246_10147596 Ga0105246_101475963 183
161 3300025303 Ga0209051_1004314 Ga0209051_10043144 183
162 3300025728 Ga0207655_1031013 Ga0207655_10310133 183
163 3300041452 Ga0451793_1048851 Ga0451793_1048851_103_699 183
164 3300041494 Ga0451837_1216893 Ga0451837_1216893_452_1048 183
165 3300059508 Ga0587088_016363 Ga0587088_016363_337_891 183
166 iso_pu_bacteria 2919034639 2919037496 183
167 iso_pu_bacteria 2933418574 2933421270 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01782

RimM

RimM N-terminal domain

1

90

0.89

Feature Viewer

pLDDT pTM Quality
85.88 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map