F251453

General Info

Members Datasets Scaffolds Average Seq Length
167 123 165 301

Family's Representative Sequence

Representative Sequence 3300053093|Ga0500651_0006738|Ga0500651_0006738_2996_3991
Length 324
Sequence MTPSTPPTDLPKSDCFLPAGAAPVACVDIGGTKVSVNVVDHRGILGQRVEPTTKQGFSDALARQVLRMVSESCRAAQIRREDISALGVAACGPFVLNQGRVELAAPNICGGLAGKERGLPNDWVTAPLEAPLRGVFDLVRVENDGMAALEAERRWGALQGMDHCAYVTWSTGVGVGLCVDGQVLRGKNGMFVSDNGDALCGCGNIGDVEALVGGNAMPRRFSALGYADAAAVLIAAKSGDAGAAAIIDEICRVMGRALYNLVVTLDLQRISLGGSVFWHHRDYLLPRLQAQISGKLPALTEDFSLVPAGLKDKVGDYAALALVV

Samples

Sample ID Description Type Environment
1 2842733646 Variovorax sp. R-72446 Isolate Unclassified
2 2842747753 Variovorax sp. R-72060 Isolate Unclassified
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
36 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
37 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
59 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
60 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
61 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
62 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
77 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
78 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
79 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
80 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
81 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
82 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
83 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
84 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
85 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
86 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
87 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
88 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
89 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
90 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
91 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
92 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
93 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
94 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
95 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
96 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
97 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
98 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
104 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
120 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
121 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
122 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
123 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.75
Nodule 0
Rhizoplane 1.2
Rhizosphere 65.27
Stem 0
Stem Tuber 0
Unclassified 10.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10002122 3300003187 Bacteria 12374
2 JGI25153J46596_10047598 3300003215 Bacteria 1260
3 Ga0055536_1001919 3300003781 Bacteria 12045
4 Ga0055534_1002481 3300003784 Bacteria 6354
5 Ga0055530_10001195 3300003791 Bacteria 20077
6 Ga0055540_1006409 3300003792 Bacteria 4680
7 Ga0055531_10003661 3300003794 Bacteria 9688
8 Ga0065714_10029837 3300005288 Bacteria 1284
9 Ga0070658_10035342 3300005327 Bacteria 4025
10 Ga0068868_100052621 3300005338 Bacteria 3205
11 Ga0068868_100056531 3300005338 Bacteria 3098
12 Ga0070660_100030918 3300005339 Bacteria 4019
13 Ga0070714_100170843 3300005435 Bacteria 1973
14 Ga0070679_100141143 3300005530 Bacteria 2388
15 Ga0068853_100024223 3300005539 Bacteria 5087
16 Ga0068855_100067070 3300005563 Bacteria 4182
17 Ga0068855_100129034 3300005563 Bacteria 2889
18 Ga0068855_100145097 3300005563 Bacteria 2703
19 Ga0068864_100154588 3300005618 Bacteria 2081
20 Ga0068863_100084030 3300005841 Bacteria 3017
21 Ga0068862_100017123 3300005844 Bacteria 6031
22 Ga0075365_10021971 3300006038 Bacteria 3989
23 Ga0075365_10188933 3300006038 Bacteria 1441
24 Ga0075363_100046182 3300006048 Bacteria 2310
25 Ga0075363_100104024 3300006048 Bacteria 1573
26 Ga0075363_100153047 3300006048 Bacteria 1303
27 Ga0075432_10018676 3300006058 Bacteria 2365
28 Ga0075367_10099606 3300006178 Bacteria 1775
29 Ga0075366_10070778 3300006195 Bacteria 2078
30 Ga0075370_10044993 3300006353 Bacteria 2496
31 Ga0105240_10152079 3300009093 Bacteria 2755
32 Ga0105243_10102100 3300009148 Bacteria 2382
33 Ga0105242_10005484 3300009176 Bacteria 9797
34 Ga0105248_10244977 3300009177 Bacteria 2018
35 Ga0105238_10017745 3300009551 Bacteria 7236
36 Ga0157370_10330601 3300013104 Bacteria 1405
37 Ga0157378_10147223 3300013297 Bacteria 2192
38 Ga0182008_10000065 3300014497 Bacteria 88652
39 Ga0183362_10003 3300015683 Bacteria 977584
40 Ga0207425_1002432 3300025245 Bacteria 6555
41 Ga0209673_1009409 3300025273 Bacteria 4236
42 Ga0209130_1003952 3300025284 Bacteria 5936
43 Ga0209675_1000386 3300025291 Bacteria 36723
44 Ga0209676_1000028 3300025292 Bacteria 559745
45 Ga0209676_1000216 3300025292 Bacteria 125759
46 Ga0209676_1012347 3300025292 Bacteria 3363
47 Ga0209676_1014026 3300025292 Bacteria 3043
48 Ga0209050_1000072 3300025298 Bacteria 293619
49 Ga0209050_1000133 3300025298 Bacteria 184688
50 Ga0209050_1042197 3300025298 Bacteria 1247
51 Ga0209051_1000015 3300025303 Bacteria 546798
52 Ga0209051_1000440 3300025303 Bacteria 56410
53 Ga0209257_1000037 3300025304 Bacteria 612915
54 Ga0207705_10046891 3300025909 Bacteria 3107
55 Ga0207660_10301143 3300025917 Bacteria 1277
56 Ga0207657_10021851 3300025919 Bacteria 6009
57 Ga0207687_10035519 3300025927 Bacteria 3390
58 Ga0207686_10002496 3300025934 Bacteria 9994
59 Ga0207711_10048455 3300025941 Bacteria 3635
60 Ga0207667_10124161 3300025949 Bacteria 2659
61 Ga0207677_10066562 3300026023 Bacteria 2520
62 Ga0207677_10164841 3300026023 Bacteria 1726
63 Ga0207639_10038664 3300026041 Bacteria 3550
64 Ga0207702_10225932 3300026078 Bacteria 1747
65 Ga0207641_10060504 3300026088 Bacteria 3228
66 Ga0207676_10046995 3300026095 Bacteria 3343
67 Ga0268265_10022768 3300028380 Bacteria 4407
68 Ga0307515_10000378 3300028794 Bacteria 108916
69 Ga0316179_1040178 3300030734 Bacteria 2041
70 Ga0316180_1101359 3300030736 Bacteria 1531
71 Ga0316183_1023150 3300030742 Bacteria 3225
72 Ga0316181_1048647 3300030744 Bacteria 4123
73 Ga0316181_1135417 3300030744 Bacteria 2537
74 Ga0316182_1282305 3300030745 Bacteria 6258
75 Ga0307513_10001719 3300031456 Bacteria 31238
76 Ga0307513_10080601 3300031456 Bacteria 3357
77 Ga0307408_100115262 3300031548 Bacteria 2072
78 Ga0307408_100188804 3300031548 Bacteria 1658
79 Ga0307514_10000827 3300031649 Bacteria 50048
80 Ga0265342_10085078 3300031712 Bacteria 1821
81 Ga0307516_10006405 3300031730 Bacteria 13803
82 Ga0307405_10197070 3300031731 Bacteria 1459
83 Ga0307412_10016254 3300031911 Bacteria 4430
84 Ga0307412_10132718 3300031911 Bacteria 1811
85 Ga0307412_10373339 3300031911 Bacteria 1152
86 Ga0307414_10080394 3300032004 Bacteria 2383
87 Ga0307411_10127607 3300032005 Bacteria 1853
88 Ga0307411_10287130 3300032005 Bacteria 1312
89 Ga0307411_10463210 3300032005 Bacteria 1063
90 Ga0395899_0001500 3300037312 Bacteria 19821
91 Ga0395900_0044505 3300037418 Bacteria 4573
92 Ga0395900_0607505 3300037418 Bacteria 1034
93 Ga0395905_0023401 3300037471 Bacteria 5838
94 Ga0395905_0117522 3300037471 Bacteria 2499
95 Ga0395905_0135276 3300037471 Bacteria 2318
96 Ga0395905_0237496 3300037471 Bacteria 1703
97 Ga0395901_0008418 3300038443 Bacteria 10424
98 Ga0395901_0125795 3300038443 Bacteria 2694
99 Ga0395901_0182024 3300038443 Bacteria 2204
100 Ga0439436_0002281 3300041404 Bacteria 5745
101 Ga0439436_0023032 3300041404 Bacteria 1844
102 Ga0439439_0005391 3300041406 Bacteria 2919
103 Ga0439439_0008506 3300041406 Bacteria 2426
104 Ga0439461_0006905 3300041410 Bacteria 1992
105 Ga0439466_0006820 3300041411 Bacteria 4331
106 Ga0439466_0017774 3300041411 Bacteria 2557
107 Ga0439465_0019564 3300041413 Bacteria 2117
108 Ga0439465_0049789 3300041413 Bacteria 1370
109 Ga0451849_0071903 3300041505 Bacteria 1317
110 Ga0439445_0056350 3300042004 Bacteria 1068
111 Ga0439432_013836 3300042006 Bacteria 2737
112 Ga0439449_0000299 3300042007 Bacteria 17855
113 Ga0439449_0040832 3300042007 Bacteria 1725
114 Ga0439452_004325 3300042010 Bacteria 4792
115 Ga0439457_011710 3300042014 Bacteria 1988
116 Ga0439462_0002818 3300042015 Bacteria 4101
117 Ga0439462_0021963 3300042015 Bacteria 1669
118 Ga0450911_000234 3300042115 Bacteria 21144
119 Ga0450920_007142 3300042122 Bacteria 2019
120 Ga0450923_001111 3300042125 Bacteria 3406
121 Ga0450896_007378 3300042133 Bacteria 1517
122 Ga0450898_001607 3300042134 Bacteria 3025
123 Ga0450906_002179 3300042145 Bacteria 4276
124 Ga0450910_001456 3300042147 Bacteria 2983
125 Ga0439446_0020807 3300042156 Bacteria 1851
126 Ga0439434_0008584 3300042435 Bacteria 2999
127 Ga0439434_0009398 3300042435 Bacteria 2873
128 Ga0450918_001850 3300042531 Bacteria 4113
129 Ga0450893_0003784 3300042532 Bacteria 2394
130 Ga0451577_0033539 3300042876 Bacteria 4628
131 Ga0451577_0114120 3300042876 Bacteria 2418
132 Ga0453683_0018556 3300044673 Bacteria 4465
133 Ga0453684_0175526 3300044712 Bacteria 2521
134 Ga0451576_0003144 3300045051 Bacteria 23130
135 Ga0451576_0005996 3300045051 Bacteria 15027
136 Ga0451576_0029895 3300045051 Bacteria 5828
137 Ga0451576_0331774 3300045051 Bacteria 1592
138 Ga0495642_0019811 3300046528 Bacteria 2637
139 Ga0495654_0001682 3300046530 Bacteria 14895
140 Ga0495609_0020101 3300046538 Bacteria 3086
141 Ga0495656_0018130 3300046615 Bacteria 2698
142 Ga0495656_0075001 3300046615 Bacteria 1512
143 Ga0495625_0000329 3300046660 Bacteria 72358
144 Ga0496101_0025941 3300048904 Bacteria 4070
145 Ga0496115_0059427 3300048918 Bacteria 3079
146 Ga0496118_0007943 3300048921 Bacteria 11101
147 Ga0496121_0008650 3300048924 Bacteria 11904
148 Ga0496122_0000319 3300048925 Bacteria 105543
149 Ga0496123_0000117 3300048926 Bacteria 161679
150 Ga0496123_0073087 3300048926 Bacteria 2129
151 Ga0496124_0251948 3300048927 Bacteria 1305
152 Ga0496125_0004511 3300048928 Bacteria 16008
153 Ga0496125_0015146 3300048928 Bacteria 7472
154 Ga0496125_0041094 3300048928 Bacteria 3957
155 Ga0496126_0137171 3300048929 Bacteria 2109
156 Ga0501225_0003874 3300049705 Bacteria 4488
157 nmdc:mga0yw44_157790_c1 3300050492 Bacteria 1483
158 nmdc:mga0yw44_8475_c1 3300050492 Bacteria 5126
159 nmdc:mga07m45_110977_c1 3300050496 Bacteria 1579
160 nmdc:mga07m45_33991_c1 3300050496 Bacteria 2833
161 Ga0500651_0006738 3300053093 Bacteria 6652
162 Ga0500594_0044273 3300053118 Bacteria 1230
163 Ga0500559_0000819 3300053136 Bacteria 20200
164 Ga0500559_0107892 3300053136 Bacteria 1288
165 Ga0500634_0055486 3300053161 Bacteria 2119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0607505 Ga0395900_0607505_16_798 249
2 3300037471 Ga0395905_0237496 Ga0395905_0237496_95_1018 270
3 3300037471 Ga0395905_0117522 Ga0395905_0117522_334_1278 273
4 3300031730 Ga0307516_10006405 Ga0307516_100064059 280
5 3300005563 Ga0068855_100129034 Ga0068855_1001290342 284
6 3300025949 Ga0207667_10124161 Ga0207667_101241614 284
7 3300037471 Ga0395905_0023401 Ga0395905_0023401_2537_3460 285
8 3300006353 Ga0075370_10044993 Ga0075370_100449933 286
9 3300050496 nmdc:mga07m45_33991_c1 nmdc:mga07m45_33991_c1_1778_2704 286
10 3300053118 Ga0500594_0044273 Ga0500594_0044273_258_1187 288
11 3300053136 Ga0500559_0000819 Ga0500559_0000819_17343_18272 288
12 3300041505 Ga0451849_0071903 Ga0451849_0071903_213_1160 292
13 3300014497 Ga0182008_10000065 Ga0182008_1000006513 293
14 3300048918 Ga0496115_0059427 Ga0496115_0059427_1312_2292 293
15 iso_pu_bacteria 2842733646 2842734059 293
16 iso_pu_bacteria 2842747753 2842749662 293
17 3300006058 Ga0075432_10018676 Ga0075432_100186763 294
18 3300031456 Ga0307513_10001719 Ga0307513_1000171915 294
19 3300042876 Ga0451577_0033539 Ga0451577_0033539_276_1268 294
20 3300044673 Ga0453683_0018556 Ga0453683_0018556_557_1531 294
21 3300045051 Ga0451576_0003144 Ga0451576_0003144_21073_22047 294
22 3300053093 Ga0500651_0006738 Ga0500651_0006738_2996_3991 294
23 3300005338 Ga0068868_100052621 Ga0068868_1000526212 295
24 3300005563 Ga0068855_100145097 Ga0068855_1001450972 295
25 3300026023 Ga0207677_10164841 Ga0207677_101648412 295
26 3300037471 Ga0395905_0135276 Ga0395905_0135276_1177_2100 295
27 3300045051 Ga0451576_0331774 Ga0451576_0331774_142_1065 295
28 3300005327 Ga0070658_10035342 Ga0070658_100353423 296
29 3300005338 Ga0068868_100056531 Ga0068868_1000565312 296
30 3300005339 Ga0070660_100030918 Ga0070660_1000309184 296
31 3300005435 Ga0070714_100170843 Ga0070714_1001708433 296
32 3300005530 Ga0070679_100141143 Ga0070679_1001411432 296
33 3300005563 Ga0068855_100067070 Ga0068855_1000670705 296
34 3300005618 Ga0068864_100154588 Ga0068864_1001545882 296
35 3300005841 Ga0068863_100084030 Ga0068863_1000840302 296
36 3300006038 Ga0075365_10021971 Ga0075365_100219713 296
37 3300006038 Ga0075365_10188933 Ga0075365_101889333 296
38 3300006048 Ga0075363_100153047 Ga0075363_1001530472 296
39 3300006178 Ga0075367_10099606 Ga0075367_100996062 296
40 3300006195 Ga0075366_10070778 Ga0075366_100707783 296
41 3300009093 Ga0105240_10152079 Ga0105240_101520793 296
42 3300009177 Ga0105248_10244977 Ga0105248_102449771 296
43 3300009551 Ga0105238_10017745 Ga0105238_100177454 296
44 3300013297 Ga0157378_10147223 Ga0157378_101472233 296
45 3300025909 Ga0207705_10046891 Ga0207705_100468914 296
46 3300025917 Ga0207660_10301143 Ga0207660_103011432 296
47 3300025919 Ga0207657_10021851 Ga0207657_100218516 296
48 3300025927 Ga0207687_10035519 Ga0207687_100355193 296
49 3300025941 Ga0207711_10048455 Ga0207711_100484556 296
50 3300026023 Ga0207677_10066562 Ga0207677_100665623 296
51 3300026078 Ga0207702_10225932 Ga0207702_102259322 296
52 3300026088 Ga0207641_10060504 Ga0207641_100605042 296
53 3300026095 Ga0207676_10046995 Ga0207676_100469952 296
54 3300028794 Ga0307515_10000378 Ga0307515_1000037884 296
55 3300031456 Ga0307513_10080601 Ga0307513_100806013 296
56 3300031649 Ga0307514_10000827 Ga0307514_1000082729 296
57 3300031712 Ga0265342_10085078 Ga0265342_100850783 296
58 3300031911 Ga0307412_10016254 Ga0307412_100162542 296
59 3300031911 Ga0307412_10132718 Ga0307412_101327182 296
60 3300037312 Ga0395899_0001500 Ga0395899_0001500_7528_8451 296
61 3300037418 Ga0395900_0044505 Ga0395900_0044505_930_1853 296
62 3300038443 Ga0395901_0008418 Ga0395901_0008418_8890_9813 296
63 3300038443 Ga0395901_0125795 Ga0395901_0125795_922_1845 296
64 3300038443 Ga0395901_0182024 Ga0395901_0182024_1141_2064 296
65 3300041406 Ga0439439_0008506 Ga0439439_0008506_1030_1953 296
66 3300042007 Ga0439449_0000299 Ga0439449_0000299_9674_10597 296
67 3300042015 Ga0439462_0002818 Ga0439462_0002818_1730_2653 296
68 3300042115 Ga0450911_000234 Ga0450911_000234_3032_3961 296
69 3300042532 Ga0450893_0003784 Ga0450893_0003784_217_1140 296
70 3300042876 Ga0451577_0114120 Ga0451577_0114120_1349_2302 296
71 3300044712 Ga0453684_0175526 Ga0453684_0175526_578_1531 296
72 3300045051 Ga0451576_0005996 Ga0451576_0005996_4888_5814 296
73 3300045051 Ga0451576_0029895 Ga0451576_0029895_929_1882 296
74 3300046528 Ga0495642_0019811 Ga0495642_0019811_1475_2398 296
75 3300046530 Ga0495654_0001682 Ga0495654_0001682_7784_8719 296
76 3300046615 Ga0495656_0018130 Ga0495656_0018130_1143_2066 296
77 3300046615 Ga0495656_0075001 Ga0495656_0075001_300_1223 296
78 3300048924 Ga0496121_0008650 Ga0496121_0008650_9536_10465 296
79 3300048928 Ga0496125_0004511 Ga0496125_0004511_5974_6909 296
80 3300048928 Ga0496125_0015146 Ga0496125_0015146_3133_4062 296
81 3300048928 Ga0496125_0041094 Ga0496125_0041094_2394_3323 296
82 3300048929 Ga0496126_0137171 Ga0496126_0137171_662_1591 296
83 3300050492 nmdc:mga0yw44_157790_c1 nmdc:mga0yw44_157790_c1_260_1183 296
84 3300050492 nmdc:mga0yw44_8475_c1 nmdc:mga0yw44_8475_c1_1976_2908 296
85 3300050496 nmdc:mga07m45_110977_c1 nmdc:mga07m45_110977_c1_600_1523 296
86 3300053136 Ga0500559_0107892 Ga0500559_0107892_266_1207 296
87 3300003187 JGI25151J46595_10002122 JGI25151J46595_1000212211 297
88 3300003215 JGI25153J46596_10047598 JGI25153J46596_100475982 297
89 3300003781 Ga0055536_1001919 Ga0055536_10019197 297
90 3300003784 Ga0055534_1002481 Ga0055534_10024815 297
91 3300003791 Ga0055530_10001195 Ga0055530_100011958 297
92 3300003792 Ga0055540_1006409 Ga0055540_10064093 297
93 3300003794 Ga0055531_10003661 Ga0055531_100036614 297
94 3300005288 Ga0065714_10029837 Ga0065714_100298372 297
95 3300005539 Ga0068853_100024223 Ga0068853_1000242234 297
96 3300005844 Ga0068862_100017123 Ga0068862_1000171234 297
97 3300006048 Ga0075363_100046182 Ga0075363_1000461822 297
98 3300006048 Ga0075363_100104024 Ga0075363_1001040242 297
99 3300009148 Ga0105243_10102100 Ga0105243_101021003 297
100 3300009176 Ga0105242_10005484 Ga0105242_100054848 297
101 3300013104 Ga0157370_10330601 Ga0157370_103306012 297
102 3300015683 Ga0183362_10003 Ga0183362_10003819 297
103 3300025245 Ga0207425_1002432 Ga0207425_10024323 297
104 3300025273 Ga0209673_1009409 Ga0209673_10094093 297
105 3300025284 Ga0209130_1003952 Ga0209130_10039525 297
106 3300025291 Ga0209675_1000386 Ga0209675_100038635 297
107 3300025292 Ga0209676_1000028 Ga0209676_1000028485 297
108 3300025292 Ga0209676_1000216 Ga0209676_100021634 297
109 3300025292 Ga0209676_1012347 Ga0209676_10123475 297
110 3300025292 Ga0209676_1014026 Ga0209676_10140265 297
111 3300025298 Ga0209050_1000072 Ga0209050_1000072242 297
112 3300025298 Ga0209050_1000133 Ga0209050_100013325 297
113 3300025298 Ga0209050_1042197 Ga0209050_10421972 297
114 3300025303 Ga0209051_1000015 Ga0209051_1000015414 297
115 3300025303 Ga0209051_1000440 Ga0209051_100044016 297
116 3300025304 Ga0209257_1000037 Ga0209257_1000037331 297
117 3300025934 Ga0207686_10002496 Ga0207686_100024964 297
118 3300026041 Ga0207639_10038664 Ga0207639_100386645 297
119 3300028380 Ga0268265_10022768 Ga0268265_100227682 297
120 3300030734 Ga0316179_1040178 Ga0316179_10401783 297
121 3300030736 Ga0316180_1101359 Ga0316180_11013592 297
122 3300030742 Ga0316183_1023150 Ga0316183_10231505 297
123 3300030744 Ga0316181_1048647 Ga0316181_10486472 297
124 3300030744 Ga0316181_1135417 Ga0316181_11354173 297
125 3300030745 Ga0316182_1282305 Ga0316182_12823054 297
126 3300031548 Ga0307408_100115262 Ga0307408_1001152622 297
127 3300031548 Ga0307408_100188804 Ga0307408_1001888042 297
128 3300031731 Ga0307405_10197070 Ga0307405_101970702 297
129 3300031911 Ga0307412_10373339 Ga0307412_103733391 297
130 3300032004 Ga0307414_10080394 Ga0307414_100803942 297
131 3300032005 Ga0307411_10127607 Ga0307411_101276073 297
132 3300032005 Ga0307411_10287130 Ga0307411_102871302 297
133 3300032005 Ga0307411_10463210 Ga0307411_104632101 297
134 3300041404 Ga0439436_0002281 Ga0439436_0002281_4078_5004 297
135 3300041404 Ga0439436_0023032 Ga0439436_0023032_871_1797 297
136 3300041406 Ga0439439_0005391 Ga0439439_0005391_744_1670 297
137 3300041410 Ga0439461_0006905 Ga0439461_0006905_533_1459 297
138 3300041411 Ga0439466_0006820 Ga0439466_0006820_459_1385 297
139 3300041411 Ga0439466_0017774 Ga0439466_0017774_827_1753 297
140 3300041413 Ga0439465_0019564 Ga0439465_0019564_367_1293 297
141 3300041413 Ga0439465_0049789 Ga0439465_0049789_299_1225 297
142 3300042004 Ga0439445_0056350 Ga0439445_0056350_21_947 297
143 3300042006 Ga0439432_013836 Ga0439432_013836_865_1791 297
144 3300042007 Ga0439449_0040832 Ga0439449_0040832_702_1628 297
145 3300042010 Ga0439452_004325 Ga0439452_004325_3408_4334 297
146 3300042014 Ga0439457_011710 Ga0439457_011710_66_992 297
147 3300042015 Ga0439462_0021963 Ga0439462_0021963_476_1402 297
148 3300042122 Ga0450920_007142 Ga0450920_007142_1076_2002 297
149 3300042125 Ga0450923_001111 Ga0450923_001111_367_1293 297
150 3300042133 Ga0450896_007378 Ga0450896_007378_572_1498 297
151 3300042134 Ga0450898_001607 Ga0450898_001607_473_1399 297
152 3300042145 Ga0450906_002179 Ga0450906_002179_2525_3451 297
153 3300042147 Ga0450910_001456 Ga0450910_001456_948_1874 297
154 3300042156 Ga0439446_0020807 Ga0439446_0020807_250_1176 297
155 3300042435 Ga0439434_0008584 Ga0439434_0008584_328_1254 297
156 3300042435 Ga0439434_0009398 Ga0439434_0009398_1702_2628 297
157 3300042531 Ga0450918_001850 Ga0450918_001850_2610_3536 297
158 3300046538 Ga0495609_0020101 Ga0495609_0020101_176_1102 297
159 3300046660 Ga0495625_0000329 Ga0495625_0000329_43458_44384 297
160 3300048904 Ga0496101_0025941 Ga0496101_0025941_2020_2946 297
161 3300048921 Ga0496118_0007943 Ga0496118_0007943_5200_6126 297
162 3300048925 Ga0496122_0000319 Ga0496122_0000319_68139_69068 297
163 3300048926 Ga0496123_0000117 Ga0496123_0000117_50134_51063 297
164 3300048926 Ga0496123_0073087 Ga0496123_0073087_477_1403 297
165 3300048927 Ga0496124_0251948 Ga0496124_0251948_98_1024 297
166 3300049705 Ga0501225_0003874 Ga0501225_0003874_3004_3930 297
167 3300053161 Ga0500634_0055486 Ga0500634_0055486_612_1559 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00480

ROK

ROK family

24

324

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qm1-assembly1.cif.gz_B crystal structure of glucokinase from enterococcus faecalis 0.786 2 296
1z6r-assembly1.cif.gz_A crystal structure of mlc from escherichia coli 0.7788 2 296
2qm1-assembly1.cif.gz_B crystal structure of glucokinase from enterococcus faecalis 0.7787 2 296
5f7q-assembly1.cif.gz_C rok repressor lmo0178 from listeria monocytogenes bound to operator 0.7734 2 296
1z6r-assembly1.cif.gz_A crystal structure of mlc from escherichia coli 0.7716 2 296
ID Description Score Start End Superfamily
3zyyY03 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Domain of unknown function (DUF4445) 0.8628 2 68 3.30.420.480
af_Q2FY27_114_312_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8391 123 290 3.30.420.40
af_I6Y8D3_109_294_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8192 125 290 3.30.420.40
3zyyX04 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Domain of unknown function (DUF4445) 0.8183 3 73 3.30.420.480
5nckB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8154 123 296 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A520GKM3-F1-model_v4 ROK family protein 0.9357 1 284 GO:0003824
AF-A0A4Q3NHU3-F1-model_v4 ROK family protein 0.9196 1 297 GO:0003824
AF-A0A4Q3NHU3-F1-model_v4 ROK family protein 0.9166 1 297 GO:0003824
AF-A0A4Q5VVK8-F1-model_v4 deleted 0.9121 1 248
AF-A0A520GKM3-F1-model_v4 ROK family protein 0.9013 1 284 GO:0003824

Feature Viewer

pLDDT pTM Quality
85.12 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map