F250010

General Info

Members Datasets Scaffolds Average Seq Length
167 104 334 115

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100357377|Ga0070708_1003573772
Length 136
Sequence MPGRRSPDRGDVVWISLNPQAGHEQAGRRPALVVSPASYNGKVGLAVLCPITSQVKGYPFEVLIPSGLKVAGAVLSDQVKNLDWRARQAQFLCRLPKRTVVEVLQKLGTLISPTGLDAPGAGLRGRGFLATTLHRE

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
51 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
54 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
55 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
66 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
67 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
76 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
83 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
85 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
89 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
90 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
91 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
92 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
93 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
94 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
95 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
99 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
100 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
101 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
102 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
103 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
104 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 1.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.01
Stem 0
Stem Tuber 0
Unclassified 26.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100357377 3300005445 Bacteria 1377
2 JGI25406J46586_10048311 3300003203 Bacteria 1444
3 Ga0070689_100168481 3300005340 Bacteria 1774
4 Ga0070669_101111154 3300005353 Bacteria 681
5 Ga0070673_100009654 3300005364 Bacteria 6491
6 Ga0070673_100759165 3300005364 Bacteria 893
7 Ga0070701_10011172 3300005438 Bacteria 4002
8 Ga0070700_100058614 3300005441 Unclassified 2420
9 Ga0070700_100297770 3300005441 Unclassified 1176
10 Ga0070708_100097598 3300005445 Bacteria 2686
11 Ga0068867_100673050 3300005459 Bacteria 910
12 Ga0070685_10001921 3300005466 Bacteria 10782
13 Ga0070685_10492020 3300005466 Unclassified 866
14 Ga0070698_102015916 3300005471 Unclassified 530
15 Ga0070699_101028118 3300005518 Unclassified 756
16 Ga0070697_100000394 3300005536 Bacteria 33837
17 Ga0070686_100022810 3300005544 Bacteria 3733
18 Ga0070696_100528499 3300005546 Unclassified 942
19 Ga0068857_101784748 3300005577 Bacteria 602
20 Ga0068856_101238089 3300005614 Unclassified 762
21 Ga0068859_101289839 3300005617 Unclassified 805
22 Ga0068864_100106770 3300005618 Unclassified 2490
23 Ga0068861_101546936 3300005719 Bacteria 652
24 Ga0068863_100028272 3300005841 Bacteria 5354
25 Ga0068863_102048028 3300005841 Bacteria 582
26 Ga0068862_100061573 3300005844 Bacteria 3226
27 Ga0081539_10013253 3300005985 Bacteria 6229
28 Ga0075428_100085577 3300006844 Bacteria 3438
29 Ga0075428_100138694 3300006844 Bacteria 2644
30 Ga0075428_101168613 3300006844 Unclassified 812
31 Ga0075428_101745862 3300006844 Bacteria 649
32 Ga0075433_10015725 3300006852 Bacteria 6217
33 Ga0075433_10054290 3300006852 Bacteria 3495
34 Ga0075433_10332306 3300006852 Bacteria 1344
35 Ga0075433_10357565 3300006852 Bacteria 1290
36 Ga0075434_100038666 3300006871 Bacteria 4726
37 Ga0075434_100949478 3300006871 Bacteria 874
38 Ga0075429_100011154 3300006880 Bacteria 7779
39 Ga0075429_100152462 3300006880 Bacteria 2024
40 Ga0075429_100524030 3300006880 Unclassified 1038
41 Ga0075429_100563278 3300006880 Unclassified 998
42 Ga0075429_100610789 3300006880 Bacteria 955
43 Ga0075429_100950147 3300006880 Bacteria 752
44 Ga0075436_100126622 3300006914 Bacteria 1790
45 Ga0075436_100659795 3300006914 Unclassified 773
46 Ga0097620_101290053 3300006931 Unclassified 805
47 Ga0075435_100011689 3300007076 Bacteria 6472
48 Ga0111539_10900185 3300009094 Bacteria 1029
49 Ga0114129_10031266 3300009147 Bacteria 7528
50 Ga0114129_10085164 3300009147 Bacteria 4385
51 Ga0114129_10194099 3300009147 Bacteria 2755
52 Ga0114129_10255797 3300009147 Bacteria 2349
53 Ga0114129_10463797 3300009147 Bacteria 1660
54 Ga0114129_10634608 3300009147 Bacteria 1380
55 Ga0114129_10965909 3300009147 Bacteria 1075
56 Ga0114129_11234667 3300009147 Bacteria 929
57 Ga0114129_11886081 3300009147 Unclassified 725
58 Ga0105243_10521711 3300009148 Bacteria 1130
59 Ga0105249_10650240 3300009553 Bacteria 1112
60 Ga0105239_11447388 3300010375 Bacteria 793
61 Ga0157378_10117999 3300013297 Bacteria 2442
62 Ga0157380_10046590 3300014326 Bacteria 3406
63 Ga0157380_10085770 3300014326 Unclassified 2585
64 Ga0206356_11573692 3300020070 Unclassified 897
65 Ga0213875_10069263 3300021388 Bacteria 1648
66 Ga0207660_10151243 3300025917 Bacteria 1783
67 Ga0207681_11058440 3300025923 Bacteria 681
68 Ga0207706_10001365 3300025933 Bacteria 24416
69 Ga0207651_10008218 3300025960 Bacteria 5623
70 Ga0207651_10946203 3300025960 Bacteria 768
71 Ga0207708_10187828 3300026075 Bacteria 1643
72 Ga0207641_10008147 3300026088 Bacteria 8675
73 Ga0207676_10834470 3300026095 Bacteria 901
74 Ga0207674_11572264 3300026116 Bacteria 626
75 Ga0209971_1082699 3300027682 Bacteria 782
76 Ga0209966_1073499 3300027695 Unclassified 751
77 Ga0268265_10094594 3300028380 Bacteria 2397
78 Ga0265322_10039970 3300028654 Bacteria 1335
79 Ga0265760_10244858 3300031090 Bacteria 619
80 Ga0265327_10009540 3300031251 Bacteria 6984
81 Ga0316579_10008042 3300031691 Unclassified 4380
82 Ga0316576_10170559 3300031727 Unclassified 1642
83 Ga0316577_10099013 3300031733 Bacteria 1633
84 Ga0307410_10255984 3300031852 Bacteria 1363
85 Ga0307410_10258134 3300031852 Bacteria 1358
86 Ga0307406_10552658 3300031901 Bacteria 942
87 Ga0307406_12025386 3300031901 Unclassified 515
88 Ga0307406_12133384 3300031901 Unclassified 502
89 Ga0307407_10256732 3300031903 Bacteria 1200
90 Ga0307412_12159051 3300031911 Unclassified 518
91 Ga0307409_101061989 3300031995 Bacteria 830
92 Ga0307409_101097277 3300031995 Bacteria 817
93 Ga0307409_101109953 3300031995 Bacteria 812
94 Ga0307416_100284741 3300032002 Bacteria 1632
95 Ga0307416_101237376 3300032002 Bacteria 852
96 Ga0307414_10415772 3300032004 Unclassified 1171
97 Ga0307411_11029410 3300032005 Bacteria 739
98 Ga0307415_100134685 3300032126 Bacteria 1877
99 Ga0307415_100164910 3300032126 Bacteria 1722
100 Ga0316583_10027372 3300032133 Bacteria 2035
101 Ga0373942_0365657 3300035207 Bacteria 512
102 Ga0316574_0022922 3300035398 Bacteria 3723
103 Ga0373947_0093433 3300035725 Bacteria 1880
104 Ga0316584_0298054 3300036712 Bacteria 1168
105 Ga0395900_0047632 3300037418 Bacteria 4414
106 Ga0395898_0045616 3300037466 Bacteria 4308
107 Ga0436364_0385463 3300037853 Bacteria 993
108 Ga0436364_1182354 3300037853 Bacteria 1838
109 Ga0395901_0048412 3300038443 Bacteria 4414
110 Ga0436361_0523596 3300039447 Unclassified 582
111 Ga0436362_0297616 3300039453 Unclassified 558
112 Ga0451849_0914782 3300041505 Unclassified 537
113 Ga0451577_0177132 3300042876 Bacteria 1922
114 Ga0451577_0281292 3300042876 Bacteria 1507
115 Ga0451577_1136048 3300042876 Bacteria 698
116 Ga0466969_0016754 3300044656 Bacteria 3833
117 Ga0466965_0060275 3300044683 Bacteria 1895
118 Ga0453684_0000271 3300044712 Bacteria 223654
119 Ga0453684_0013258 3300044712 Bacteria 13424
120 Ga0453684_0016683 3300044712 Bacteria 11455
121 Ga0453684_0019644 3300044712 Bacteria 10267
122 Ga0453684_0071607 3300044712 Bacteria 4382
123 Ga0453684_0196606 3300044712 Bacteria 2354
124 Ga0453684_0431251 3300044712 Bacteria 1470
125 Ga0451576_0064270 3300045051 Unclassified 3823
126 Ga0451576_1164565 3300045051 Unclassified 806
127 Ga0496122_0004449 3300048925 Bacteria 17377
128 Ga0501041_0636846 3300049577 Unclassified 681
129 Ga0501070_0298667 3300049586 Bacteria 1312
130 Ga0501071_0511613 3300049587 Bacteria 921
131 Ga0501075_1002225 3300049591 Bacteria 635
132 Ga0501076_0915744 3300049592 Unclassified 723
133 Ga0501076_1815185 3300049592 Unclassified 500
134 Ga0501077_0046031 3300049593 Bacteria 2772
135 Ga0501216_115627 3300049660 Unclassified 607
136 Ga0501227_001197 3300049665 Bacteria 5815
137 Ga0501233_206209 3300049668 Unclassified 574
138 Ga0501253_208153 3300049683 Unclassified 519
139 Ga0501221_064476 3300049704 Unclassified 853
140 Ga0501225_0079846 3300049705 Unclassified 938
141 Ga0501229_032350 3300049706 Unclassified 721
142 nmdc:mga05p37_271096_c1 3300050507 Bacteria 2028
143 nmdc:mga05p37_62751_c1 3300050507 Bacteria 4573
144 nmdc:mga05p37_77489_c1 3300050507 Bacteria 4092
145 nmdc:mga05p37_901638_c1 3300050507 Unclassified 953
146 nmdc:mga05p37_922164_c1 3300050507 Bacteria 939
147 nmdc:mga05p37_951_c1 3300050507 Bacteria 32730
148 nmdc:mga09592_270183_c1 3300050508 Bacteria 1475
149 nmdc:mga09592_483982_c1 3300050508 Bacteria 1066
150 nmdc:mga09592_52073_c1 3300050508 Unclassified 3455
151 nmdc:mga06r32_1004319_c1 3300050510 Unclassified 787
152 nmdc:mga06r32_1384836_c1 3300050510 Bacteria 645
153 nmdc:mga06r32_2085203_c1 3300050510 Unclassified 500
154 nmdc:mga06r32_740700_c1 3300050510 Bacteria 946
155 nmdc:mga06r32_888750_c1 3300050510 Bacteria 848
156 nmdc:mga08y16_974896_c1 3300050511 Bacteria 829
157 nmdc:mga0n895_14724_c1 3300050512 Bacteria 7114
158 nmdc:mga0n895_893372_c1 3300050512 Bacteria 874
159 nmdc:mga0rr50_18585_c1 3300050513 Bacteria 4673
160 nmdc:mga0rr50_838626_c1 3300050513 Unclassified 784
161 nmdc:mga08x19_319378_c1 3300050514 Unclassified 1080
162 nmdc:mga08x19_322383_c1 3300050514 Bacteria 1075
163 nmdc:mga0a205_20200_c1 3300050515 Bacteria 6283
164 nmdc:mga0a205_20753_c1 3300050515 Bacteria 6205
165 nmdc:mga0a205_94316_c1 3300050515 Bacteria 2891
166 nmdc:mga0a205_974794_c1 3300050515 Bacteria 695
167 Ga0530510_0744632 3300061734 Bacteria 747
168 Ga0070708_100357377
169 JGI25406J46586_10048311
170 Ga0070689_100168481
171 Ga0070669_101111154
172 Ga0070673_100009654
173 Ga0070673_100759165
174 Ga0070701_10011172
175 Ga0070700_100058614
176 Ga0070700_100297770
177 Ga0070708_100097598
178 Ga0068867_100673050
179 Ga0070685_10001921
180 Ga0070685_10492020
181 Ga0070698_102015916
182 Ga0070699_101028118
183 Ga0070697_100000394
184 Ga0070686_100022810
185 Ga0070696_100528499
186 Ga0068857_101784748
187 Ga0068856_101238089
188 Ga0068859_101289839
189 Ga0068864_100106770
190 Ga0068861_101546936
191 Ga0068863_100028272
192 Ga0068863_102048028
193 Ga0068862_100061573
194 Ga0081539_10013253
195 Ga0075428_100085577
196 Ga0075428_100138694
197 Ga0075428_101168613
198 Ga0075428_101745862
199 Ga0075433_10015725
200 Ga0075433_10054290
201 Ga0075433_10332306
202 Ga0075433_10357565
203 Ga0075434_100038666
204 Ga0075434_100949478
205 Ga0075429_100011154
206 Ga0075429_100152462
207 Ga0075429_100524030
208 Ga0075429_100563278
209 Ga0075429_100610789
210 Ga0075429_100950147
211 Ga0075436_100126622
212 Ga0075436_100659795
213 Ga0097620_101290053
214 Ga0075435_100011689
215 Ga0111539_10900185
216 Ga0114129_10031266
217 Ga0114129_10085164
218 Ga0114129_10194099
219 Ga0114129_10255797
220 Ga0114129_10463797
221 Ga0114129_10634608
222 Ga0114129_10965909
223 Ga0114129_11234667
224 Ga0114129_11886081
225 Ga0105243_10521711
226 Ga0105249_10650240
227 Ga0105239_11447388
228 Ga0157378_10117999
229 Ga0157380_10046590
230 Ga0157380_10085770
231 Ga0206356_11573692
232 Ga0213875_10069263
233 Ga0207660_10151243
234 Ga0207681_11058440
235 Ga0207706_10001365
236 Ga0207651_10008218
237 Ga0207651_10946203
238 Ga0207708_10187828
239 Ga0207641_10008147
240 Ga0207676_10834470
241 Ga0207674_11572264
242 Ga0209971_1082699
243 Ga0209966_1073499
244 Ga0268265_10094594
245 Ga0265322_10039970
246 Ga0265760_10244858
247 Ga0265327_10009540
248 Ga0316579_10008042
249 Ga0316576_10170559
250 Ga0316577_10099013
251 Ga0307410_10255984
252 Ga0307410_10258134
253 Ga0307406_10552658
254 Ga0307406_12025386
255 Ga0307406_12133384
256 Ga0307407_10256732
257 Ga0307412_12159051
258 Ga0307409_101061989
259 Ga0307409_101097277
260 Ga0307409_101109953
261 Ga0307416_100284741
262 Ga0307416_101237376
263 Ga0307414_10415772
264 Ga0307411_11029410
265 Ga0307415_100134685
266 Ga0307415_100164910
267 Ga0316583_10027372
268 Ga0373942_0365657
269 Ga0316574_0022922
270 Ga0373947_0093433
271 Ga0316584_0298054
272 Ga0395900_0047632
273 Ga0395898_0045616
274 Ga0436364_0385463
275 Ga0436364_1182354
276 Ga0395901_0048412
277 Ga0436361_0523596
278 Ga0436362_0297616
279 Ga0451849_0914782
280 Ga0451577_0177132
281 Ga0451577_0281292
282 Ga0451577_1136048
283 Ga0466969_0016754
284 Ga0466965_0060275
285 Ga0453684_0000271
286 Ga0453684_0013258
287 Ga0453684_0016683
288 Ga0453684_0019644
289 Ga0453684_0071607
290 Ga0453684_0196606
291 Ga0453684_0431251
292 Ga0451576_0064270
293 Ga0451576_1164565
294 Ga0496122_0004449
295 Ga0501041_0636846
296 Ga0501070_0298667
297 Ga0501071_0511613
298 Ga0501075_1002225
299 Ga0501076_0915744
300 Ga0501076_1815185
301 Ga0501077_0046031
302 Ga0501216_115627
303 Ga0501227_001197
304 Ga0501233_206209
305 Ga0501253_208153
306 Ga0501221_064476
307 Ga0501225_0079846
308 Ga0501229_032350
309 nmdc:mga05p37_271096_c1
310 nmdc:mga05p37_62751_c1
311 nmdc:mga05p37_77489_c1
312 nmdc:mga05p37_901638_c1
313 nmdc:mga05p37_922164_c1
314 nmdc:mga05p37_951_c1
315 nmdc:mga09592_270183_c1
316 nmdc:mga09592_483982_c1
317 nmdc:mga09592_52073_c1
318 nmdc:mga06r32_1004319_c1
319 nmdc:mga06r32_1384836_c1
320 nmdc:mga06r32_2085203_c1
321 nmdc:mga06r32_740700_c1
322 nmdc:mga06r32_888750_c1
323 nmdc:mga08y16_974896_c1
324 nmdc:mga0n895_14724_c1
325 nmdc:mga0n895_893372_c1
326 nmdc:mga0rr50_18585_c1
327 nmdc:mga0rr50_838626_c1
328 nmdc:mga08x19_319378_c1
329 nmdc:mga08x19_322383_c1
330 nmdc:mga0a205_20200_c1
331 nmdc:mga0a205_20753_c1
332 nmdc:mga0a205_94316_c1
333 nmdc:mga0a205_974794_c1
334 Ga0530510_0744632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

8

111

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d2n-assembly1.cif.gz_D crystal structure of maze-mazf (form-iii) from deinococcus radiodurans 0.9884 3 112
7d2n-assembly1.cif.gz_D crystal structure of maze-mazf (form-iii) from deinococcus radiodurans 0.9786 3 112
7d2p-assembly1.cif.gz_D crystal structure of maze-mazf (form-ii) from deinococcus radiodurans 0.9785 3 112
7d2p-assembly1.cif.gz_C crystal structure of maze-mazf (form-ii) from deinococcus radiodurans 0.9678 3 112
5co7-assembly3.cif.gz_F e. coli mazf form iii 0.9677 3 108
ID Description Score Start End Superfamily
5cqyB00 Mainly Beta;Roll;SH3 type barrels.; 0.9499 1 112 2.30.30.110
5cqyB00 Mainly Beta;Roll;SH3 type barrels.; 0.932 1 112 2.30.30.110
af_P33647_7_115_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9127 6 108 2.30.30.110
1m1fB00 Mainly Beta;Roll;SH3 type barrels.; 0.8846 6 109 2.30.30.110
af_V5QRX7_1_106_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8714 7 111 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A353QEX1-F1-model_v4 mRNA-degrading endonuclease 1 29 108 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A1F9CI30-F1-model_v4 mRNA-degrading endonuclease 0.9917 42 109 GO:0003677
AF-A0A3N5RPJ6-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9871 33 109 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A1V1WV98-F1-model_v4 mRNA-degrading endonuclease 0.9867 23 108 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A2G2MPK6-F1-model_v4 Uncharacterized protein 0.9864 47 109 GO:0003677

Map