F249261

General Info

Members Datasets Scaffolds Average Seq Length
166 121 332 317

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0160423|Ga0501038_0160423_649_1635
Length 328
Sequence MESVAVLFGMEQTFPPALVEAINLRGDDVRAEFLQVGGVKIDDLSRYTLIIDRISQDIPFYRAMLKHAVLNGTRVINNPFWWSADDKFFNYALAQKLGVAVPKTVLLPTKEHPPGTTSTSMRNLIYPLNWDDIFGYVGFPAWLKPFDGGGWKNVYKVHSAEEFFDAYNQTGDICMTLQEGIEFEEYYRCYVVGQKHVHIMPYEPRNPHHLRYDAGFAPSGEMHKRLTQDCITICRALGYDINTVEFAVRDGIPYAIDYMNPAPDAERTSVGEDNFQWFIETVASFAIEEALKGRRVPEEYRWSTFLRGPESPTAEDGAPKKVARKAVR

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
82 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
88 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
89 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
92 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
93 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
94 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
109 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
115 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
116 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
117 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
118 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
119 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
121 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0.6
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.61
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 9.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0160423 3300049574 Bacteria 1828
2 Ga0058863_11931346 3300004799 Unclassified 2757
3 Ga0065715_10037690 3300005293 Bacteria 1266
4 Ga0070658_10113800 3300005327 Bacteria 2243
5 Ga0070670_100145130 3300005331 Bacteria 2053
6 Ga0070680_100077361 3300005336 Unclassified 2740
7 Ga0070660_100017248 3300005339 Bacteria 5260
8 Ga0070689_100179055 3300005340 Bacteria 1721
9 Ga0070689_100407772 3300005340 Bacteria 1150
10 Ga0070671_100220395 3300005355 Bacteria 1609
11 Ga0070688_100169905 3300005365 Bacteria 1504
12 Ga0070681_10244210 3300005458 Unclassified 1709
13 Ga0070679_100258240 3300005530 Unclassified 1698
14 Ga0070697_100001608 3300005536 Bacteria 17219
15 Ga0070697_100012757 3300005536 Bacteria 6582
16 Ga0070693_100028414 3300005547 Bacteria 3040
17 Ga0070704_100187682 3300005549 Bacteria 1659
18 Ga0068855_100078042 3300005563 Bacteria 3842
19 Ga0068857_100363244 3300005577 Bacteria 1342
20 Ga0068856_100030218 3300005614 Bacteria 5297
21 Ga0068859_100173364 3300005617 Bacteria 2239
22 Ga0068851_10067410 3300005834 Bacteria 1845
23 Ga0070716_100010709 3300006173 Bacteria 4607
24 Ga0068871_100066401 3300006358 Bacteria 2957
25 Ga0075428_100089299 3300006844 Bacteria 3361
26 Ga0075431_100295109 3300006847 Bacteria 1639
27 Ga0075431_100496782 3300006847 Bacteria 1211
28 Ga0075433_10102827 3300006852 Bacteria 2530
29 Ga0075434_100368791 3300006871 Bacteria 1457
30 Ga0075429_100406940 3300006880 Bacteria 1192
31 Ga0097620_100173367 3300006931 Bacteria 2239
32 Ga0097620_100203273 3300006931 Bacteria 2066
33 Ga0105240_10000752 3300009093 Bacteria 59142
34 Ga0105240_10301361 3300009093 Bacteria 1833
35 Ga0111539_10005996 3300009094 Bacteria 15703
36 Ga0111539_10217278 3300009094 Bacteria 2226
37 Ga0111539_10759308 3300009094 Bacteria 1129
38 Ga0114129_10003295 3300009147 Bacteria 22672
39 Ga0114129_10062750 3300009147 Bacteria 5190
40 Ga0105241_10207897 3300009174 Bacteria 1639
41 Ga0105249_10524291 3300009553 Unclassified 1232
42 Ga0157373_10043765 3300013100 Bacteria 3198
43 Ga0157371_10048080 3300013102 Bacteria 3033
44 Ga0157371_10203148 3300013102 Unclassified 1421
45 Ga0157370_10040846 3300013104 Bacteria 4478
46 Ga0157370_10098347 3300013104 Unclassified 2744
47 Ga0157370_10264716 3300013104 Bacteria 1589
48 Ga0157369_10029505 3300013105 Bacteria 6060
49 Ga0157369_10088729 3300013105 Bacteria 3301
50 Ga0157369_10177995 3300013105 Bacteria 2239
51 Ga0157374_10002484 3300013296 Bacteria 15572
52 Ga0157372_10014371 3300013307 Bacteria 8466
53 Ga0157372_10127507 3300013307 Unclassified 2926
54 Ga0157372_10191020 3300013307 Unclassified 2372
55 Ga0157376_10246650 3300014969 Bacteria 1666
56 Ga0182007_10043252 3300015262 Bacteria 1497
57 Ga0213872_10016488 3300021361 Bacteria 3428
58 Ga0213871_10007682 3300021441 Unclassified 2345
59 Ga0207705_10005843 3300025909 Bacteria 9161
60 Ga0207707_10268305 3300025912 Unclassified 1480
61 Ga0207695_10009114 3300025913 Bacteria 12321
62 Ga0207695_10104838 3300025913 Bacteria 2815
63 Ga0207693_10173678 3300025915 Bacteria 1696
64 Ga0207660_10142412 3300025917 Bacteria 1834
65 Ga0207657_10029251 3300025919 Bacteria 5017
66 Ga0207657_10135449 3300025919 Bacteria 2016
67 Ga0207649_10164219 3300025920 Bacteria 1541
68 Ga0207652_10215274 3300025921 Unclassified 1730
69 Ga0207650_10372039 3300025925 Bacteria 1179
70 Ga0207706_10026400 3300025933 Bacteria 5199
71 Ga0207667_10008612 3300025949 Bacteria 12101
72 Ga0207712_10158852 3300025961 Bacteria 1754
73 Ga0207712_10324197 3300025961 Bacteria 1272
74 Ga0207702_10345438 3300026078 Unclassified 1422
75 Ga0207683_10313501 3300026121 Bacteria 1436
76 Ga0207698_10037355 3300026142 Bacteria 3576
77 Ga0207428_10055508 3300027907 Bacteria 3149
78 Ga0207428_10057409 3300027907 Bacteria 3090
79 Ga0265316_10179526 3300031344 Bacteria 1577
80 Ga0307408_100037895 3300031548 Bacteria 3398
81 Ga0307408_100065018 3300031548 Bacteria 2674
82 Ga0265313_10023394 3300031595 Bacteria 3328
83 Ga0265314_10016479 3300031711 Bacteria 5833
84 Ga0307405_10164652 3300031731 Bacteria 1575
85 Ga0307413_10031379 3300031824 Bacteria 2998
86 Ga0307413_10092113 3300031824 Bacteria 1977
87 Ga0307410_10003791 3300031852 Bacteria 7673
88 Ga0307410_10033154 3300031852 Bacteria 3332
89 Ga0307406_10080469 3300031901 Bacteria 2163
90 Ga0307407_10040680 3300031903 Bacteria 2594
91 Ga0307407_10131783 3300031903 Bacteria 1600
92 Ga0307412_10020752 3300031911 Bacteria 4003
93 Ga0307412_10402325 3300031911 Bacteria 1115
94 Ga0307409_100064409 3300031995 Bacteria 2879
95 Ga0307409_100068069 3300031995 Bacteria 2814
96 Ga0307416_100003962 3300032002 Bacteria 8818
97 Ga0307416_100394144 3300032002 Bacteria 1420
98 Ga0307414_10011031 3300032004 Bacteria 5281
99 Ga0307414_10011213 3300032004 Bacteria 5246
100 Ga0307411_10002108 3300032005 Bacteria 8588
101 Ga0307411_10098960 3300032005 Bacteria 2057
102 Ga0307411_10267644 3300032005 Bacteria 1353
103 Ga0307415_100066273 3300032126 Bacteria 2519
104 Ga0307415_100248726 3300032126 Bacteria 1443
105 Ga0373943_0090092 3300035170 Bacteria 1587
106 Ga0436364_0075872 3300037853 Unclassified 1228
107 Ga0436365_1622014 3300039437 Bacteria 1410
108 Ga0436360_0435719 3300039438 Bacteria 5303
109 Ga0436361_0423938 3300039447 Bacteria 16249
110 Ga0436361_0511876 3300039447 Bacteria 10388
111 Ga0436361_0769183 3300039447 Bacteria 1714
112 Ga0436361_0878656 3300039447 Bacteria 5256
113 Ga0436363_0540690 3300039450 Bacteria 2018
114 Ga0451807_2078217 3300041486 Bacteria 1199
115 Ga0439444_0002159 3300042437 Bacteria 2660
116 Ga0453684_0000889 3300044712 Bacteria 99678
117 Ga0451576_0108380 3300045051 Bacteria 2890
118 Ga0495653_0112421 3300046463 Bacteria 1955
119 Ga0495667_0060322 3300046559 Bacteria 2488
120 Ga0495659_0005335 3300046664 Bacteria 4042
121 Ga0495623_0026397 3300046679 Bacteria 3739
122 Ga0495604_0097697 3300047317 Bacteria 2165
123 Ga0495604_0109627 3300047317 Bacteria 2015
124 Ga0495680_0144108 3300047322 Bacteria 1741
125 Ga0495675_0055274 3300047444 Bacteria 2518
126 Ga0495684_0000387 3300047471 Bacteria 35887
127 Ga0495686_0012264 3300047472 Bacteria 6003
128 Ga0495602_0039250 3300048088 Bacteria 4363
129 Ga0495602_0098252 3300048088 Bacteria 2410
130 Ga0496105_0222116 3300048908 Bacteria 1538
131 Ga0496109_0095699 3300048912 Bacteria 2750
132 Ga0496112_0046824 3300048915 Bacteria 4243
133 Ga0496112_0207272 3300048915 Bacteria 1918
134 Ga0496113_0318023 3300048916 Bacteria 1247
135 Ga0501033_0220746 3300049570 Bacteria 1349
136 Ga0501036_0138489 3300049572 Bacteria 2054
137 Ga0501036_0234746 3300049572 Bacteria 1539
138 Ga0501039_0024934 3300049575 Bacteria 4595
139 Ga0501040_0231396 3300049576 Bacteria 1316
140 Ga0501041_0082980 3300049577 Bacteria 1975
141 Ga0501042_0376587 3300049578 Bacteria 1027
142 Ga0501048_0110503 3300049582 Bacteria 1941
143 Ga0501071_0027187 3300049587 Bacteria 4023
144 Ga0501076_0014779 3300049592 Bacteria 5887
145 Ga0501076_0206823 3300049592 Bacteria 1603
146 Ga0501076_0302617 3300049592 Bacteria 1311
147 Ga0501081_0126077 3300049743 Bacteria 1826
148 Ga0501045_0119656 3300049824 Bacteria 1955
149 nmdc:mga05p37_18447_c1 3300050507 Bacteria 8429
150 nmdc:mga05p37_263509_c1 3300050507 Bacteria 2061
151 nmdc:mga05p37_504591_c1 3300050507 Bacteria 1387
152 nmdc:mga09592_489245_c1 3300050508 Bacteria 1060
153 nmdc:mga06r32_463642_c1 3300050510 Bacteria 1246
154 nmdc:mga08y16_111576_c1 3300050511 Bacteria 2847
155 nmdc:mga08y16_176107_c1 3300050511 Bacteria 2221
156 nmdc:mga08y16_9988_c1 3300050511 Bacteria 9961
157 nmdc:mga0a205_237912_c1 3300050515 Bacteria 1702
158 Ga0501084_0587806 3300054114 Bacteria 941
159 Ga0590071_000048 3300059421 Bacteria 31376
160 Ga0590074_005515 3300059423 Unclassified 2097
161 Ga0590074_024664 3300059423 Bacteria 1046
162 Ga0590077_000450 3300059426 Bacteria 11569
163 Ga0501082_0079615 3300060353 Bacteria 2827
164 Ga0530510_0045383 3300061734 Bacteria 3175
165 Ga0530510_0382921 3300061734 Bacteria 1059
166 2919512526 2919509842 Bacteria 4104664
167 Ga0501038_0160423
168 Ga0058863_11931346
169 Ga0065715_10037690
170 Ga0070658_10113800
171 Ga0070670_100145130
172 Ga0070680_100077361
173 Ga0070660_100017248
174 Ga0070689_100179055
175 Ga0070689_100407772
176 Ga0070671_100220395
177 Ga0070688_100169905
178 Ga0070681_10244210
179 Ga0070679_100258240
180 Ga0070697_100001608
181 Ga0070697_100012757
182 Ga0070693_100028414
183 Ga0070704_100187682
184 Ga0068855_100078042
185 Ga0068857_100363244
186 Ga0068856_100030218
187 Ga0068859_100173364
188 Ga0068851_10067410
189 Ga0070716_100010709
190 Ga0068871_100066401
191 Ga0075428_100089299
192 Ga0075431_100295109
193 Ga0075431_100496782
194 Ga0075433_10102827
195 Ga0075434_100368791
196 Ga0075429_100406940
197 Ga0097620_100173367
198 Ga0097620_100203273
199 Ga0105240_10000752
200 Ga0105240_10301361
201 Ga0111539_10005996
202 Ga0111539_10217278
203 Ga0111539_10759308
204 Ga0114129_10003295
205 Ga0114129_10062750
206 Ga0105241_10207897
207 Ga0105249_10524291
208 Ga0157373_10043765
209 Ga0157371_10048080
210 Ga0157371_10203148
211 Ga0157370_10040846
212 Ga0157370_10098347
213 Ga0157370_10264716
214 Ga0157369_10029505
215 Ga0157369_10088729
216 Ga0157369_10177995
217 Ga0157374_10002484
218 Ga0157372_10014371
219 Ga0157372_10127507
220 Ga0157372_10191020
221 Ga0157376_10246650
222 Ga0182007_10043252
223 Ga0213872_10016488
224 Ga0213871_10007682
225 Ga0207705_10005843
226 Ga0207707_10268305
227 Ga0207695_10009114
228 Ga0207695_10104838
229 Ga0207693_10173678
230 Ga0207660_10142412
231 Ga0207657_10029251
232 Ga0207657_10135449
233 Ga0207649_10164219
234 Ga0207652_10215274
235 Ga0207650_10372039
236 Ga0207706_10026400
237 Ga0207667_10008612
238 Ga0207712_10158852
239 Ga0207712_10324197
240 Ga0207702_10345438
241 Ga0207683_10313501
242 Ga0207698_10037355
243 Ga0207428_10055508
244 Ga0207428_10057409
245 Ga0265316_10179526
246 Ga0307408_100037895
247 Ga0307408_100065018
248 Ga0265313_10023394
249 Ga0265314_10016479
250 Ga0307405_10164652
251 Ga0307413_10031379
252 Ga0307413_10092113
253 Ga0307410_10003791
254 Ga0307410_10033154
255 Ga0307406_10080469
256 Ga0307407_10040680
257 Ga0307407_10131783
258 Ga0307412_10020752
259 Ga0307412_10402325
260 Ga0307409_100064409
261 Ga0307409_100068069
262 Ga0307416_100003962
263 Ga0307416_100394144
264 Ga0307414_10011031
265 Ga0307414_10011213
266 Ga0307411_10002108
267 Ga0307411_10098960
268 Ga0307411_10267644
269 Ga0307415_100066273
270 Ga0307415_100248726
271 Ga0373943_0090092
272 Ga0436364_0075872
273 Ga0436365_1622014
274 Ga0436360_0435719
275 Ga0436361_0423938
276 Ga0436361_0511876
277 Ga0436361_0769183
278 Ga0436361_0878656
279 Ga0436363_0540690
280 Ga0451807_2078217
281 Ga0439444_0002159
282 Ga0453684_0000889
283 Ga0451576_0108380
284 Ga0495653_0112421
285 Ga0495667_0060322
286 Ga0495659_0005335
287 Ga0495623_0026397
288 Ga0495604_0097697
289 Ga0495604_0109627
290 Ga0495680_0144108
291 Ga0495675_0055274
292 Ga0495684_0000387
293 Ga0495686_0012264
294 Ga0495602_0039250
295 Ga0495602_0098252
296 Ga0496105_0222116
297 Ga0496109_0095699
298 Ga0496112_0046824
299 Ga0496112_0207272
300 Ga0496113_0318023
301 Ga0501033_0220746
302 Ga0501036_0138489
303 Ga0501036_0234746
304 Ga0501039_0024934
305 Ga0501040_0231396
306 Ga0501041_0082980
307 Ga0501042_0376587
308 Ga0501048_0110503
309 Ga0501071_0027187
310 Ga0501076_0014779
311 Ga0501076_0206823
312 Ga0501076_0302617
313 Ga0501081_0126077
314 Ga0501045_0119656
315 nmdc:mga05p37_18447_c1
316 nmdc:mga05p37_263509_c1
317 nmdc:mga05p37_504591_c1
318 nmdc:mga09592_489245_c1
319 nmdc:mga06r32_463642_c1
320 nmdc:mga08y16_111576_c1
321 nmdc:mga08y16_176107_c1
322 nmdc:mga08y16_9988_c1
323 nmdc:mga0a205_237912_c1
324 Ga0501084_0587806
325 Ga0590071_000048
326 Ga0590074_005515
327 Ga0590074_024664
328 Ga0590077_000450
329 Ga0501082_0079615
330 Ga0530510_0045383
331 Ga0530510_0382921
332 2919512526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uc9-assembly1.cif.gz_B crystal structure of a lysine biosynthesis enzyme, lysx, from thermus thermophilus hb8 0.7702 4 290
1uc8-assembly1.cif.gz_B crystal structure of a lysine biosynthesis enzyme, lysx, from thermus thermophilus hb8 0.7569 4 290
1uc9-assembly1.cif.gz_B crystal structure of a lysine biosynthesis enzyme, lysx, from thermus thermophilus hb8 0.7566 4 290
1uc9-assembly1.cif.gz_A crystal structure of a lysine biosynthesis enzyme, lysx, from thermus thermophilus hb8 0.7487 4 290
3vpd-assembly1.cif.gz_B-2 lysx from thermus thermophilus complexed with amp-pnp 0.7451 4 294
ID Description Score Start End Superfamily
5k2mB02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.7971 134 182 3.30.1490.20
af_Q58766_2_238_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.7735 1 37 3.40.718.10
5i47A02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.759 103 182 3.30.1490.20
4hnvD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.7546 182 264 3.30.470.20
af_Q9XUC3_200_260_3.30.1490.20 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.7541 131 182 3.30.1490.20
ID Description Score Start End GO Terms
AF-A0A7J4VAE4-F1-model_v4 ATP-grasp domain-containing protein 0.9501 1 300 GO:0005524
GO:0005737
GO:0009432
GO:0018169
AF-A0A838TNY5-F1-model_v4 Uncharacterized protein 0.9449 1 76
AF-A0A3N5LX09-F1-model_v4 ATP-grasp domain-containing protein 0.9426 1 292 GO:0005524
GO:0005737
GO:0009432
GO:0018169
GO:0046872
AF-A0A1F8R3I1-F1-model_v4 Glutathione synthase 0.9394 1 272 GO:0005524
GO:0005737
GO:0009432
GO:0018169
GO:0046872
AF-A0A5C6RS39-F1-model_v4 ATP-grasp domain-containing protein 0.9373 1 297 GO:0005524
GO:0005737
GO:0009432
GO:0018169
GO:0046872

Map