F249070

General Info

Members Datasets Scaffolds Average Seq Length
166 116 162 175

Family's Representative Sequence

Representative Sequence 3300046536|Ga0495587_0202686|Ga0495587_0202686_81_680
Length 199
Sequence MADVGGTDRPRADLDCACLEGGVKDTGGTLLILALHFSLLSFLAIGGAISALPEMHRQAVDVYHWMTSTQFAQLVAIAQAAPGPNVLIVTLIGQQVAGIPGALIATICMCGPACAVAFHIVRAFHHFRESKWAIAVQAGLVPVSVGLVGATAFIVARSAYQGWGTLVITAATFALAHWTRVSPLWALAGASALGLAGVL

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
3 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
4 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
20 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
21 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
22 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
30 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
31 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
32 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
33 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
34 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
35 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
36 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
37 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
38 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
39 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
40 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
41 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
42 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
43 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
44 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
45 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
46 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
47 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
48 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
52 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
53 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
54 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
55 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
56 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
63 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
64 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
65 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
66 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
67 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
68 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
69 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
70 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
71 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
72 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
73 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
74 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
75 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
76 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
77 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
78 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
79 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
80 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
81 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
84 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
91 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
92 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
93 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
104 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
105 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
109 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
110 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
112 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
113 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
114 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
115 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
116 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.59
Metatranscriptomes 0
Isolates 2.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.01
Nodule 0
Rhizoplane 10.84
Rhizosphere 78.92
Stem 0
Stem Tuber 0
Unclassified 7.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10032944 3300005289 Bacteria 1175
2 Ga0070658_10849838 3300005327 Bacteria 793
3 Ga0070680_101205085 3300005336 Bacteria 655
4 Ga0070661_100736719 3300005344 Bacteria 805
5 Ga0070673_101276159 3300005364 Unclassified 689
6 Ga0070714_100157367 3300005435 Bacteria 2052
7 Ga0070714_100190109 3300005435 Bacteria 1873
8 Ga0070714_100384995 3300005435 Bacteria 1323
9 Ga0070713_100151597 3300005436 Bacteria 2063
10 Ga0070713_100301866 3300005436 Bacteria 1474
11 Ga0070711_100106033 3300005439 Bacteria 2054
12 Ga0068853_100074322 3300005539 Bacteria 2965
13 Ga0068855_101197901 3300005563 Bacteria 790
14 Ga0068857_100067671 3300005577 Bacteria 3179
15 Ga0081455_10001289 3300005937 Bacteria 31161
16 Ga0099794_10014569 3300007265 Bacteria 3449
17 Ga0105239_13034902 3300010375 Bacteria 547
18 Ga0213872_10013442 3300021361 Bacteria 3835
19 Ga0213872_10135514 3300021361 Bacteria 1083
20 Ga0213876_10044669 3300021384 Bacteria 2342
21 Ga0213875_10282689 3300021388 Bacteria 784
22 Ga0207693_10117383 3300025915 Bacteria 2089
23 Ga0207693_10124105 3300025915 Bacteria 2029
24 Ga0207700_10270468 3300025928 Bacteria 1458
25 Ga0207700_10872999 3300025928 Bacteria 805
26 Ga0207664_10213421 3300025929 Bacteria 1671
27 Ga0207690_10656186 3300025932 Bacteria 860
28 Ga0207665_10094183 3300025939 Bacteria 2080
29 Ga0207674_10029501 3300026116 Bacteria 5775
30 Ga0209588_1059505 3300027671 Bacteria 1235
31 Ga0265323_10008113 3300028653 Bacteria 4343
32 Ga0265338_10158237 3300028800 Bacteria 1752
33 Ga0265324_10064282 3300029957 Unclassified 1252
34 Ga0265325_10166718 3300031241 Unclassified 1033
35 Ga0265331_10136396 3300031250 Unclassified 1117
36 Ga0265327_10005335 3300031251 Bacteria 10767
37 Ga0265316_10024710 3300031344 Bacteria 5026
38 Ga0265316_10095151 3300031344 Bacteria 2269
39 Ga0265316_10110666 3300031344 Bacteria 2080
40 Ga0265316_10119670 3300031344 Bacteria 1989
41 Ga0265316_10187936 3300031344 Bacteria 1536
42 Ga0265314_10048888 3300031711 Plasmid 2964
43 Ga0316576_10037893 3300031727 Bacteria 3454
44 Ga0373923_0159719 3300035111 Bacteria 1028
45 Ga0373936_0173543 3300035113 Bacteria 943
46 Ga0316574_0000154 3300035398 Bacteria 22281
47 Ga0373931_0387691 3300035691 Bacteria 882
48 Ga0373935_0018083 3300035692 Bacteria 4285
49 Ga0373935_0961763 3300035692 Unclassified 634
50 Ga0373927_0069993 3300035695 Bacteria 2271
51 Ga0373927_0379022 3300035695 Unclassified 933
52 Ga0373927_0453023 3300035695 Bacteria 847
53 Ga0373947_0005951 3300035725 Bacteria 7106
54 Ga0373947_0046376 3300035725 Bacteria 2603
55 Ga0373937_1116136 3300036401 Bacteria 737
56 Ga0316584_0003492 3300036712 Bacteria 10237
57 Ga0373925_0106244 3300037068 Unclassified 2164
58 Ga0373925_0230984 3300037068 Bacteria 1479
59 Ga0373925_0333832 3300037068 Unclassified 1229
60 Ga0373925_0554215 3300037068 Bacteria 945
61 Ga0395899_0009110 3300037312 Bacteria 7625
62 Ga0395900_0023941 3300037418 Bacteria 6248
63 Ga0395900_0671480 3300037418 Bacteria 971
64 Ga0395898_0055188 3300037466 Bacteria 3875
65 Ga0395898_0575313 3300037466 Bacteria 1069
66 Ga0436364_0516915 3300037853 Bacteria 811
67 Ga0436364_0839189 3300037853 Bacteria 2416
68 Ga0395901_0012616 3300038443 Bacteria 8574
69 Ga0395901_0207571 3300038443 Bacteria 2051
70 Ga0436365_0231932 3300039437 Bacteria 2333
71 Ga0436365_0410447 3300039437 Bacteria 2680
72 Ga0436365_0691100 3300039437 Bacteria 2328
73 Ga0436365_1887573 3300039437 Bacteria 1752
74 Ga0436360_0570696 3300039438 Unclassified 609
75 Ga0436360_0582362 3300039438 Bacteria 2830
76 Ga0436360_1085766 3300039438 Bacteria 1004
77 Ga0436361_0093476 3300039447 Bacteria 13714
78 Ga0436361_1202738 3300039447 Bacteria 3334
79 Ga0451843_1264371 3300041509 Bacteria 728
80 Ga0451577_0000234 3300042876 Bacteria 110808
81 Ga0451577_0077329 3300042876 Bacteria 2967
82 Ga0451577_0174989 3300042876 Bacteria 1934
83 Ga0453683_0405638 3300044673 Bacteria 879
84 Ga0453684_0000005 3300044712 Bacteria 1431632
85 Ga0453684_0000102 3300044712 Bacteria 366870
86 Ga0453684_0001609 3300044712 Bacteria 62038
87 Ga0453684_0006657 3300044712 Bacteria 21817
88 Ga0453684_0007758 3300044712 Bacteria 19575
89 Ga0453684_0378150 3300044712 Bacteria 1591
90 Ga0451576_0000936 3300045051 Bacteria 55015
91 Ga0451576_1800669 3300045051 Bacteria 633
92 Ga0466967_0377504 3300045976 Bacteria 1376
93 Ga0495580_0053171 3300046472 Bacteria 2859
94 Ga0495664_0450581 3300046477 Unclassified 771
95 Ga0495664_0491679 3300046477 Bacteria 733
96 Ga0495618_0181118 3300046514 Bacteria 1339
97 Ga0495666_0264586 3300046526 Bacteria 782
98 Ga0495652_0071760 3300046529 Bacteria 2889
99 Ga0495640_0009751 3300046533 Bacteria 7460
100 Ga0495640_0013197 3300046533 Bacteria 6285
101 Ga0495640_0141600 3300046533 Bacteria 1550
102 Ga0495587_0202686 3300046536 Bacteria 1122
103 Ga0495634_0096764 3300046642 Bacteria 1911
104 Ga0495635_0804340 3300046663 Unclassified 606
105 Ga0495588_0049694 3300046674 Bacteria 2157
106 Ga0495588_0618008 3300046674 Unclassified 567
107 Ga0495599_0378789 3300046678 Bacteria 845
108 Ga0495624_0517638 3300046690 Unclassified 713
109 Ga0495581_0391543 3300047315 Bacteria 811
110 Ga0495674_0063638 3300047319 Bacteria 3208
111 Ga0495674_0505413 3300047319 Bacteria 966
112 Ga0495680_0251654 3300047322 Bacteria 1252
113 Ga0495675_0831329 3300047444 Bacteria 509
114 Ga0495679_193451 3300047446 Bacteria 536
115 Ga0495684_0149904 3300047471 Bacteria 1744
116 Ga0496100_0200772 3300048903 Bacteria 1453
117 Ga0496101_0075245 3300048904 Bacteria 2485
118 Ga0496104_0308342 3300048907 Bacteria 1496
119 Ga0496105_0135614 3300048908 Bacteria 2028
120 Ga0496105_0192488 3300048908 Bacteria 1667
121 Ga0496107_0325155 3300048910 Unclassified 1144
122 Ga0496107_0404361 3300048910 Unclassified 1015
123 Ga0496108_0109480 3300048911 Bacteria 2361
124 Ga0496109_1229081 3300048912 Unclassified 686
125 Ga0496111_0086715 3300048914 Bacteria 2291
126 Ga0496112_0054907 3300048915 Bacteria 3915
127 Ga0496112_0616615 3300048915 Bacteria 1016
128 Ga0496113_0164322 3300048916 Bacteria 1756
129 Ga0496114_0039473 3300048917 Bacteria 3907
130 Ga0496114_0118066 3300048917 Bacteria 2279
131 Ga0496114_0279073 3300048917 Bacteria 1473
132 Ga0496115_0128195 3300048918 Bacteria 2091
133 Ga0496115_1210211 3300048918 Bacteria 567
134 Ga0496119_0001369 3300048922 Bacteria 29726
135 Ga0496122_0003848 3300048925 Bacteria 19282
136 Ga0496123_0002454 3300048926 Bacteria 22981
137 Ga0501034_0013508 3300049571 Bacteria 8405
138 Ga0501047_0262278 3300049581 Bacteria 1575
139 Ga0501067_0009352 3300049583 Bacteria 5430
140 Ga0501067_0127079 3300049583 Bacteria 1418
141 Ga0501069_0285503 3300049585 Bacteria 966
142 Ga0501070_0023547 3300049586 Bacteria 5159
143 Ga0501070_0024843 3300049586 Bacteria 5024
144 Ga0501072_0114948 3300049588 Bacteria 2142
145 Ga0501073_0046498 3300049589 Bacteria 3052
146 Ga0501073_0885053 3300049589 Bacteria 615
147 Ga0501074_0032088 3300049590 Bacteria 3807
148 Ga0501076_0648062 3300049592 Bacteria 872
149 Ga0501079_0372229 3300049741 Bacteria 1120
150 Ga0501083_0003091 3300049744 Bacteria 11575
151 Ga0501083_0023222 3300049744 Bacteria 4302
152 Ga0501035_0117003 3300049822 Bacteria 2333
153 Ga0501044_0151276 3300049823 Bacteria 2303
154 nmdc:mga0yw44_203668_c1 3300050492 Bacteria 1307
155 Ga0495601_0130969 3300053077 Bacteria 1633
156 Ga0495612_0122964 3300053078 Unclassified 1117
157 Ga0495619_0013199 3300053085 Bacteria 5206
158 Ga0500556_0000250 3300053104 Bacteria 43584
159 Ga0500592_073812 3300053116 Bacteria 564
160 Ga0500652_089350 3300053131 Bacteria 1286
161 Ga0500616_0000166 3300053153 Bacteria 110141
162 Ga0501082_0015106 3300060353 Bacteria 6652

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046477 Ga0495664_0491679 Ga0495664_0491679_13_450 124
2 3300047444 Ga0495675_0831329 Ga0495675_0831329_33_470 124
3 3300047446 Ga0495679_193451 Ga0495679_193451_75_518 124
4 3300048918 Ga0496115_1210211 Ga0496115_1210211_14_457 124
5 3300021361 Ga0213872_10135514 Ga0213872_101355142 136
6 3300039447 Ga0436361_1202738 Ga0436361_1202738_402_935 136
7 3300050492 nmdc:mga0yw44_203668_c1 nmdc:mga0yw44_203668_c1_148_684 137
8 3300010375 Ga0105239_13034902 Ga0105239_130349021 139
9 3300046674 Ga0495588_0049694 Ga0495588_0049694_25_507 139
10 3300048915 Ga0496112_0616615 Ga0496112_0616615_495_977 139
11 3300053116 Ga0500592_073812 Ga0500592_073812_12_494 139
12 3300042876 Ga0451577_0000234 Ga0451577_0000234_39863_40393 142
13 3300044712 Ga0453684_0000005 Ga0453684_0000005_1221026_1221556 142
14 3300048912 Ga0496109_1229081 Ga0496109_1229081_225_671 142
15 3300048917 Ga0496114_0039473 Ga0496114_0039473_2955_3401 142
16 3300046674 Ga0495588_0618008 Ga0495588_0618008_11_511 144
17 3300035691 Ga0373931_0387691 Ga0373931_0387691_196_714 146
18 iso_pu_bacteria 2547132103 2547373552 146
19 iso_pu_bacteria 2843690924 2843694521 146
20 iso_pu_bacteria 2998344455 2998348016 146
21 3300037418 Ga0395900_0671480 Ga0395900_0671480_37_552 149
22 3300037466 Ga0395898_0055188 Ga0395898_0055188_2704_3219 149
23 3300038443 Ga0395901_0207571 Ga0395901_0207571_771_1286 149
24 3300031344 Ga0265316_10119670 Ga0265316_101196702 151
25 3300031711 Ga0265314_10048888 Ga0265314_100488882 151
26 3300041509 Ga0451843_1264371 Ga0451843_1264371_56_574 151
27 3300044673 Ga0453683_0405638 Ga0453683_0405638_181_699 151
28 3300044712 Ga0453684_0001609 Ga0453684_0001609_14933_15451 151
29 3300044712 Ga0453684_0006657 Ga0453684_0006657_18847_19365 151
30 iso_pu_bacteria 2919450847 2919451653 151
31 3300021361 Ga0213872_10013442 Ga0213872_100134424 152
32 3300021388 Ga0213875_10282689 Ga0213875_102826892 152
33 3300028653 Ga0265323_10008113 Ga0265323_100081132 152
34 3300029957 Ga0265324_10064282 Ga0265324_100642822 152
35 3300031241 Ga0265325_10166718 Ga0265325_101667182 152
36 3300031250 Ga0265331_10136396 Ga0265331_101363962 152
37 3300031344 Ga0265316_10024710 Ga0265316_100247103 152
38 3300031344 Ga0265316_10095151 Ga0265316_100951513 152
39 3300031344 Ga0265316_10110666 Ga0265316_101106662 152
40 3300037853 Ga0436364_0839189 Ga0436364_0839189_1351_1887 152
41 3300039447 Ga0436361_0093476 Ga0436361_0093476_8677_9198 152
42 3300042876 Ga0451577_0077329 Ga0451577_0077329_1121_1651 152
43 3300042876 Ga0451577_0174989 Ga0451577_0174989_812_1339 152
44 3300044712 Ga0453684_0000102 Ga0453684_0000102_111645_112175 152
45 3300044712 Ga0453684_0007758 Ga0453684_0007758_2299_2829 152
46 3300044712 Ga0453684_0378150 Ga0453684_0378150_427_948 152
47 3300045051 Ga0451576_0000936 Ga0451576_0000936_15210_15740 152
48 3300045051 Ga0451576_1800669 Ga0451576_1800669_75_596 152
49 3300045976 Ga0466967_0377504 Ga0466967_0377504_678_1214 152
50 3300005289 Ga0065704_10032944 Ga0065704_100329442 153
51 3300005327 Ga0070658_10849838 Ga0070658_108498381 153
52 3300005336 Ga0070680_101205085 Ga0070680_1012050851 153
53 3300005344 Ga0070661_100736719 Ga0070661_1007367191 153
54 3300005364 Ga0070673_101276159 Ga0070673_1012761591 153
55 3300005435 Ga0070714_100157367 Ga0070714_1001573672 153
56 3300005435 Ga0070714_100190109 Ga0070714_1001901093 153
57 3300005435 Ga0070714_100384995 Ga0070714_1003849952 153
58 3300005436 Ga0070713_100151597 Ga0070713_1001515971 153
59 3300005436 Ga0070713_100301866 Ga0070713_1003018662 153
60 3300005439 Ga0070711_100106033 Ga0070711_1001060331 153
61 3300005539 Ga0068853_100074322 Ga0068853_1000743223 153
62 3300005563 Ga0068855_101197901 Ga0068855_1011979012 153
63 3300005577 Ga0068857_100067671 Ga0068857_1000676714 153
64 3300005937 Ga0081455_10001289 Ga0081455_100012899 153
65 3300007265 Ga0099794_10014569 Ga0099794_100145692 153
66 3300021384 Ga0213876_10044669 Ga0213876_100446693 153
67 3300025915 Ga0207693_10117383 Ga0207693_101173832 153
68 3300025915 Ga0207693_10124105 Ga0207693_101241051 153
69 3300025928 Ga0207700_10270468 Ga0207700_102704682 153
70 3300025928 Ga0207700_10872999 Ga0207700_108729992 153
71 3300025929 Ga0207664_10213421 Ga0207664_102134212 153
72 3300025932 Ga0207690_10656186 Ga0207690_106561862 153
73 3300025939 Ga0207665_10094183 Ga0207665_100941832 153
74 3300026116 Ga0207674_10029501 Ga0207674_100295014 153
75 3300027671 Ga0209588_1059505 Ga0209588_10595052 153
76 3300028800 Ga0265338_10158237 Ga0265338_101582373 153
77 3300031251 Ga0265327_10005335 Ga0265327_100053354 153
78 3300031344 Ga0265316_10187936 Ga0265316_101879363 153
79 3300031727 Ga0316576_10037893 Ga0316576_100378933 153
80 3300035111 Ga0373923_0159719 Ga0373923_0159719_464_997 153
81 3300035113 Ga0373936_0173543 Ga0373936_0173543_353_889 153
82 3300035398 Ga0316574_0000154 Ga0316574_0000154_8229_8762 153
83 3300035692 Ga0373935_0018083 Ga0373935_0018083_73_609 153
84 3300035692 Ga0373935_0961763 Ga0373935_0961763_37_570 153
85 3300035695 Ga0373927_0069993 Ga0373927_0069993_816_1352 153
86 3300035695 Ga0373927_0379022 Ga0373927_0379022_258_788 153
87 3300035695 Ga0373927_0453023 Ga0373927_0453023_249_782 153
88 3300035725 Ga0373947_0005951 Ga0373947_0005951_6426_6959 153
89 3300035725 Ga0373947_0046376 Ga0373947_0046376_1127_1663 153
90 3300036401 Ga0373937_1116136 Ga0373937_1116136_170_703 153
91 3300036712 Ga0316584_0003492 Ga0316584_0003492_9576_10109 153
92 3300037068 Ga0373925_0106244 Ga0373925_0106244_877_1410 153
93 3300037068 Ga0373925_0230984 Ga0373925_0230984_397_930 153
94 3300037068 Ga0373925_0333832 Ga0373925_0333832_295_825 153
95 3300037068 Ga0373925_0554215 Ga0373925_0554215_16_552 153
96 3300037312 Ga0395899_0009110 Ga0395899_0009110_1677_2204 153
97 3300037418 Ga0395900_0023941 Ga0395900_0023941_1643_2170 153
98 3300037466 Ga0395898_0575313 Ga0395898_0575313_521_1048 153
99 3300037853 Ga0436364_0516915 Ga0436364_0516915_102_638 153
100 3300038443 Ga0395901_0012616 Ga0395901_0012616_7166_7693 153
101 3300039437 Ga0436365_0231932 Ga0436365_0231932_1096_1629 153
102 3300039437 Ga0436365_0410447 Ga0436365_0410447_879_1415 153
103 3300039437 Ga0436365_0691100 Ga0436365_0691100_1191_1721 153
104 3300039437 Ga0436365_1887573 Ga0436365_1887573_1093_1626 153
105 3300039438 Ga0436360_0570696 Ga0436360_0570696_37_570 153
106 3300039438 Ga0436360_0582362 Ga0436360_0582362_1189_1722 153
107 3300039438 Ga0436360_1085766 Ga0436360_1085766_212_742 153
108 3300046472 Ga0495580_0053171 Ga0495580_0053171_1586_2119 153
109 3300046477 Ga0495664_0450581 Ga0495664_0450581_103_636 153
110 3300046514 Ga0495618_0181118 Ga0495618_0181118_298_831 153
111 3300046526 Ga0495666_0264586 Ga0495666_0264586_211_744 153
112 3300046529 Ga0495652_0071760 Ga0495652_0071760_996_1529 153
113 3300046533 Ga0495640_0009751 Ga0495640_0009751_1790_2326 153
114 3300046533 Ga0495640_0013197 Ga0495640_0013197_3694_4227 153
115 3300046533 Ga0495640_0141600 Ga0495640_0141600_130_663 153
116 3300046536 Ga0495587_0202686 Ga0495587_0202686_81_680 153
117 3300046642 Ga0495634_0096764 Ga0495634_0096764_278_811 153
118 3300046663 Ga0495635_0804340 Ga0495635_0804340_42_578 153
119 3300046678 Ga0495599_0378789 Ga0495599_0378789_222_755 153
120 3300046690 Ga0495624_0517638 Ga0495624_0517638_110_643 153
121 3300047315 Ga0495581_0391543 Ga0495581_0391543_53_586 153
122 3300047319 Ga0495674_0063638 Ga0495674_0063638_1723_2256 153
123 3300047319 Ga0495674_0505413 Ga0495674_0505413_224_760 153
124 3300047322 Ga0495680_0251654 Ga0495680_0251654_368_901 153
125 3300047471 Ga0495684_0149904 Ga0495684_0149904_399_932 153
126 3300048903 Ga0496100_0200772 Ga0496100_0200772_19_552 153
127 3300048904 Ga0496101_0075245 Ga0496101_0075245_64_597 153
128 3300048907 Ga0496104_0308342 Ga0496104_0308342_454_1053 153
129 3300048908 Ga0496105_0135614 Ga0496105_0135614_892_1491 153
130 3300048908 Ga0496105_0192488 Ga0496105_0192488_741_1277 153
131 3300048910 Ga0496107_0325155 Ga0496107_0325155_114_647 153
132 3300048910 Ga0496107_0404361 Ga0496107_0404361_100_636 153
133 3300048911 Ga0496108_0109480 Ga0496108_0109480_1371_1970 153
134 3300048914 Ga0496111_0086715 Ga0496111_0086715_1395_1994 153
135 3300048915 Ga0496112_0054907 Ga0496112_0054907_2767_3300 153
136 3300048916 Ga0496113_0164322 Ga0496113_0164322_824_1423 153
137 3300048917 Ga0496114_0118066 Ga0496114_0118066_1416_2015 153
138 3300048917 Ga0496114_0279073 Ga0496114_0279073_810_1346 153
139 3300048918 Ga0496115_0128195 Ga0496115_0128195_327_926 153
140 3300048922 Ga0496119_0001369 Ga0496119_0001369_1270_1809 153
141 3300048925 Ga0496122_0003848 Ga0496122_0003848_11470_12003 153
142 3300048926 Ga0496123_0002454 Ga0496123_0002454_9426_9959 153
143 3300049571 Ga0501034_0013508 Ga0501034_0013508_195_719 153
144 3300049581 Ga0501047_0262278 Ga0501047_0262278_389_913 153
145 3300049583 Ga0501067_0009352 Ga0501067_0009352_4759_5283 153
146 3300049583 Ga0501067_0127079 Ga0501067_0127079_426_953 153
147 3300049585 Ga0501069_0285503 Ga0501069_0285503_92_619 153
148 3300049586 Ga0501070_0023547 Ga0501070_0023547_343_870 153
149 3300049586 Ga0501070_0024843 Ga0501070_0024843_2368_2892 153
150 3300049588 Ga0501072_0114948 Ga0501072_0114948_593_1117 153
151 3300049589 Ga0501073_0046498 Ga0501073_0046498_22_546 153
152 3300049589 Ga0501073_0885053 Ga0501073_0885053_31_558 153
153 3300049590 Ga0501074_0032088 Ga0501074_0032088_1197_1721 153
154 3300049592 Ga0501076_0648062 Ga0501076_0648062_43_576 153
155 3300049741 Ga0501079_0372229 Ga0501079_0372229_296_820 153
156 3300049744 Ga0501083_0003091 Ga0501083_0003091_9239_9763 153
157 3300049744 Ga0501083_0023222 Ga0501083_0023222_786_1313 153
158 3300049822 Ga0501035_0117003 Ga0501035_0117003_1197_1721 153
159 3300049823 Ga0501044_0151276 Ga0501044_0151276_1490_2014 153
160 3300053077 Ga0495601_0130969 Ga0495601_0130969_334_867 153
161 3300053078 Ga0495612_0122964 Ga0495612_0122964_215_748 153
162 3300053085 Ga0495619_0013199 Ga0495619_0013199_740_1339 153
163 3300053104 Ga0500556_0000250 Ga0500556_0000250_862_1395 153
164 3300053131 Ga0500652_089350 Ga0500652_089350_120_653 153
165 3300053153 Ga0500616_0000166 Ga0500616_0000166_41615_42148 153
166 3300060353 Ga0501082_0015106 Ga0501082_0015106_5866_6393 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02417

Chromate_transp

Chromate transporter

31

195

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v8p-assembly3.cif.gz_FQ t.thermophila 60s ribosomal subunit in complex with initiation factor 6. 0.3487 25 91
3ff6-assembly1.cif.gz_A human acc2 ct domain with cp-640186 0.2923 8 112
6h3t-assembly1.cif.gz_A schmallenberg virus glycoprotein gc head domain in complex with scfv 1c11 0.2906 10 82
1w0k-assembly1.cif.gz_G adp inhibited bovine f1-atpase 0.2739 3 120
1w0k-assembly1.cif.gz_G adp inhibited bovine f1-atpase 0.2515 3 120
ID Description Score Start End Superfamily
af_B6TWQ1_1_127_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3845 3 101 1.20.58.70
af_D3ZTJ6_528_679_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.378 2 110 1.10.287.70
af_Q93XP7_258_441_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.3544 40 82 3.40.50.2000
4a18Q01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L36 0.3484 25 91 1.10.10.1760
af_A0A0R0KXL7_130_223_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.3456 2 101 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A660TE47-F1-model_v4 Chromate transporter 0.9414 8 102 GO:0005886
GO:0015109
AF-A0A7Y3F2Y7-F1-model_v4 Chromate transporter 0.9366 5 102 GO:0005886
GO:0015109
AF-A0A399SQ28-F1-model_v4 Chromate efflux transporter 0.9266 3 102 GO:0005886
GO:0015109
AF-A0A353RS64-F1-model_v4 Chromate transporter 0.9234 5 102 GO:0005886
GO:0015109
AF-A0A350KN71-F1-model_v4 Chromate transporter 0.9232 4 93 GO:0005886
GO:0015109

Feature Viewer

pLDDT pTM Quality
80.65 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map